diff -Nru kde-l10n-hr-4.12.97/debian/changelog kde-l10n-hr-4.13.0/debian/changelog
--- kde-l10n-hr-4.12.97/debian/changelog 2014-04-03 15:21:35.000000000 +0000
+++ kde-l10n-hr-4.13.0/debian/changelog 2014-04-10 11:33:11.000000000 +0000
@@ -1,3 +1,9 @@
+kde-l10n-hr (4:4.13.0-0ubuntu1) trusty; urgency=medium
+
+ * New upstream release of KDE Software Compilation
+
+ -- Jonathan Riddell Thu, 10 Apr 2014 12:22:05 +0100
+
kde-l10n-hr (4:4.12.97-0ubuntu1) trusty; urgency=medium
* New upstream release
diff -Nru kde-l10n-hr-4.12.97/messages/CMakeLists.txt kde-l10n-hr-4.13.0/messages/CMakeLists.txt
--- kde-l10n-hr-4.12.97/messages/CMakeLists.txt 2014-03-27 01:01:17.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/CMakeLists.txt 2014-04-10 09:29:48.000000000 +0000
@@ -1,5 +1,4 @@
add_subdirectory(applications)
-add_subdirectory(frameworks)
add_subdirectory(kdeaccessibility)
add_subdirectory(kdeadmin)
add_subdirectory(kdeartwork)
diff -Nru kde-l10n-hr-4.12.97/messages/frameworks/CMakeLists.txt kde-l10n-hr-4.13.0/messages/frameworks/CMakeLists.txt
--- kde-l10n-hr-4.12.97/messages/frameworks/CMakeLists.txt 2014-03-27 01:01:17.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/frameworks/CMakeLists.txt 1970-01-01 00:00:00.000000000 +0000
@@ -1,2 +0,0 @@
-file(GLOB _po_files *.po)
-GETTEXT_PROCESS_PO_FILES(${CURRENT_LANG} ALL INSTALL_DESTINATION ${LOCALE_INSTALL_DIR} ${_po_files} )
diff -Nru kde-l10n-hr-4.12.97/messages/frameworks/kdecalendarsystems.po kde-l10n-hr-4.13.0/messages/frameworks/kdecalendarsystems.po
--- kde-l10n-hr-4.12.97/messages/frameworks/kdecalendarsystems.po 2014-01-25 21:41:22.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/frameworks/kdecalendarsystems.po 1970-01-01 00:00:00.000000000 +0000
@@ -1,4921 +0,0 @@
-# Translation of kdecalendarsystems to Croatian
-#
-# Renato Pavicic , 2006.
-# Zarko Pintar , 2009.
-# Marko Dimjasevic , 2009, 2010.
-# Andrej Dundović , 2009, 2010.
-# DoDo , 2009.
-# Andrej Dundovic , 2009, 2010.
-# Marko Dimjašević , 2011.
-msgid ""
-msgstr ""
-"Project-Id-Version: kdelibs4\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2014-01-24 18:50+0000\n"
-"PO-Revision-Date: 2011-07-22 16:48+0200\n"
-"Last-Translator: Marko Dimjašević \n"
-"Language-Team: Croatian \n"
-"Language: hr\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n"
-"%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"X-Generator: Lokalize 1.2\n"
-"X-Poedit-Language: Croatian\n"
-"X-Poedit-Country: CROATIA\n"
-"X-Poedit-Bookmarks: 1601,-1,-1,-1,-1,-1,-1,-1,-1,-1\n"
-"X-Environment: kde\n"
-"X-Accelerator-Marker: &\n"
-"X-Text-Markup: kde4\n"
-
-#: kcalendarsystem.cpp:108
-msgctxt "@item Calendar system"
-msgid "Gregorian"
-msgstr "Gregorijanski"
-
-#: kcalendarsystem.cpp:110
-msgctxt "@item Calendar system"
-msgid "Coptic"
-msgstr "Koptski"
-
-#: kcalendarsystem.cpp:112
-msgctxt "@item Calendar system"
-msgid "Ethiopian"
-msgstr "Etiopijski"
-
-#: kcalendarsystem.cpp:114
-msgctxt "@item Calendar system"
-msgid "Hebrew"
-msgstr "Hebrejski"
-
-#: kcalendarsystem.cpp:116
-msgctxt "@item Calendar system"
-msgid "Islamic / Hijri (Civil)"
-msgstr "Islamski / Hijri (građanski)"
-
-#: kcalendarsystem.cpp:118
-msgctxt "@item Calendar system"
-msgid "Indian National"
-msgstr "Indijski, nacionalni"
-
-#: kcalendarsystem.cpp:120
-msgctxt "@item Calendar system"
-msgid "Jalali"
-msgstr "Jalalski"
-
-#: kcalendarsystem.cpp:122
-msgctxt "@item Calendar system"
-msgid "Japanese"
-msgstr "Japanski"
-
-#: kcalendarsystem.cpp:124
-msgctxt "@item Calendar system"
-msgid "Julian"
-msgstr "Julianski"
-
-#: kcalendarsystem.cpp:126
-msgctxt "@item Calendar system"
-msgid "Taiwanese"
-msgstr "Tajvanski"
-
-#: kcalendarsystem.cpp:128
-msgctxt "@item Calendar system"
-msgid "Thai"
-msgstr "Tajlandski"
-
-#: kcalendarsystem.cpp:131
-msgctxt "@item Calendar system"
-msgid "Invalid Calendar Type"
-msgstr "Neispravna vrsta kalendara"
-
-#: kcalendarsystem.cpp:1494
-msgctxt "Negative symbol as used for year numbers, e.g. -5 = 5 BC"
-msgid "-"
-msgstr "-"
-
-#: kcalendarsystem.cpp:1531
-msgid "Today"
-msgstr "Danas"
-
-#: kcalendarsystem.cpp:1533
-msgid "Yesterday"
-msgstr "Jučer"
-
-#: kcalendarsystemcoptic.cpp:45
-msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, LongFormat"
-msgid "Anno Martyrum"
-msgstr "Anno Martyrum"
-
-#: kcalendarsystemcoptic.cpp:46
-msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat"
-msgid "AM"
-msgstr "AM"
-
-#: kcalendarsystemcoptic.cpp:47
-#, c-format
-msgctxt ""
-"(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM"
-msgid "%Ey %EC"
-msgstr "%Ey %EC"
-
-#: kcalendarsystemcoptic.cpp:153
-msgctxt "Coptic month 1 - KLocale::NarrowName"
-msgid "T"
-msgstr ""
-
-#: kcalendarsystemcoptic.cpp:155
-#, fuzzy
-#| msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat"
-#| msgid "AP"
-msgctxt "Coptic month 2 - KLocale::NarrowName"
-msgid "P"
-msgstr "AP"
-
-#: kcalendarsystemcoptic.cpp:157
-#, fuzzy
-#| msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat"
-#| msgid "AH"
-msgctxt "Coptic month 3 - KLocale::NarrowName"
-msgid "H"
-msgstr "AH"
-
-#: kcalendarsystemcoptic.cpp:159
-msgctxt "Coptic month 4 - KLocale::NarrowName"
-msgid "K"
-msgstr ""
-
-#: kcalendarsystemcoptic.cpp:161
-msgctxt "Coptic month 5 - KLocale::NarrowName"
-msgid "T"
-msgstr ""
-
-#: kcalendarsystemcoptic.cpp:163
-#, fuzzy
-#| msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat"
-#| msgid "AM"
-msgctxt "Coptic month 6 - KLocale::NarrowName"
-msgid "M"
-msgstr "AM"
-
-#: kcalendarsystemcoptic.cpp:165
-#, fuzzy
-#| msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat"
-#| msgid "AP"
-msgctxt "Coptic month 7 - KLocale::NarrowName"
-msgid "P"
-msgstr "AP"
-
-#: kcalendarsystemcoptic.cpp:167
-#, fuzzy
-#| msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat"
-#| msgid "AP"
-msgctxt "Coptic month 8 - KLocale::NarrowName"
-msgid "P"
-msgstr "AP"
-
-#: kcalendarsystemcoptic.cpp:169
-#, fuzzy
-#| msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat"
-#| msgid "AP"
-msgctxt "Coptic month 9 - KLocale::NarrowName"
-msgid "P"
-msgstr "AP"
-
-#: kcalendarsystemcoptic.cpp:171
-#, fuzzy
-#| msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat"
-#| msgid "AP"
-msgctxt "Coptic month 10 - KLocale::NarrowName"
-msgid "P"
-msgstr "AP"
-
-#: kcalendarsystemcoptic.cpp:173
-#, fuzzy
-#| msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat"
-#| msgid "CE"
-msgctxt "Coptic month 11 - KLocale::NarrowName"
-msgid "E"
-msgstr "CE"
-
-#: kcalendarsystemcoptic.cpp:175
-#, fuzzy
-#| msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat"
-#| msgid "AM"
-msgctxt "Coptic month 12 - KLocale::NarrowName"
-msgid "M"
-msgstr "AM"
-
-#: kcalendarsystemcoptic.cpp:177
-msgctxt "Coptic month 13 - KLocale::NarrowName"
-msgid "K"
-msgstr ""
-
-#: kcalendarsystemcoptic.cpp:186
-#, fuzzy
-#| msgctxt "Coptic month 1 - ShortNamePossessive"
-#| msgid "of Tho"
-msgctxt "Coptic month 1 - KLocale::ShortName Possessive"
-msgid "of Tho"
-msgstr "od Tho"
-
-#: kcalendarsystemcoptic.cpp:188
-#, fuzzy
-#| msgctxt "Coptic month 2 - ShortNamePossessive"
-#| msgid "of Pao"
-msgctxt "Coptic month 2 - KLocale::ShortName Possessive"
-msgid "of Pao"
-msgstr "od Pao"
-
-#: kcalendarsystemcoptic.cpp:190
-#, fuzzy
-#| msgctxt "Coptic month 3 - ShortNamePossessive"
-#| msgid "of Hat"
-msgctxt "Coptic month 3 - KLocale::ShortName Possessive"
-msgid "of Hat"
-msgstr "od Hat"
-
-#: kcalendarsystemcoptic.cpp:192
-#, fuzzy
-#| msgctxt "Coptic month 4 - ShortNamePossessive"
-#| msgid "of Kia"
-msgctxt "Coptic month 4 - KLocale::ShortName Possessive"
-msgid "of Kia"
-msgstr "od Kia"
-
-#: kcalendarsystemcoptic.cpp:194
-#, fuzzy
-#| msgctxt "Coptic month 5 - ShortNamePossessive"
-#| msgid "of Tob"
-msgctxt "Coptic month 5 - KLocale::ShortName Possessive"
-msgid "of Tob"
-msgstr "od Tob"
-
-#: kcalendarsystemcoptic.cpp:196
-#, fuzzy
-#| msgctxt "Coptic month 6 - ShortNamePossessive"
-#| msgid "of Mes"
-msgctxt "Coptic month 6 - KLocale::ShortName Possessive"
-msgid "of Mes"
-msgstr "od Mes"
-
-#: kcalendarsystemcoptic.cpp:198
-#, fuzzy
-#| msgctxt "Coptic month 7 - ShortNamePossessive"
-#| msgid "of Par"
-msgctxt "Coptic month 7 - KLocale::ShortName Possessive"
-msgid "of Par"
-msgstr "od Par"
-
-#: kcalendarsystemcoptic.cpp:200
-#, fuzzy
-#| msgctxt "Coptic month 8 - ShortNamePossessive"
-#| msgid "of Pam"
-msgctxt "Coptic month 8 - KLocale::ShortName Possessive"
-msgid "of Pam"
-msgstr "od Pam"
-
-#: kcalendarsystemcoptic.cpp:202
-#, fuzzy
-#| msgctxt "Coptic month 9 - ShortNamePossessive"
-#| msgid "of Pas"
-msgctxt "Coptic month 9 - KLocale::ShortName Possessive"
-msgid "of Pas"
-msgstr "od Pas"
-
-#: kcalendarsystemcoptic.cpp:204
-#, fuzzy
-#| msgctxt "Coptic month 10 - ShortNamePossessive"
-#| msgid "of Pan"
-msgctxt "Coptic month 10 - KLocale::ShortName Possessive"
-msgid "of Pan"
-msgstr "od Pan"
-
-#: kcalendarsystemcoptic.cpp:206
-#, fuzzy
-#| msgctxt "Coptic month 11 - ShortNamePossessive"
-#| msgid "of Epe"
-msgctxt "Coptic month 11 - KLocale::ShortName Possessive"
-msgid "of Epe"
-msgstr "od Epe"
-
-#: kcalendarsystemcoptic.cpp:208
-#, fuzzy
-#| msgctxt "Coptic month 12 - ShortNamePossessive"
-#| msgid "of Meo"
-msgctxt "Coptic month 12 - KLocale::ShortName Possessive"
-msgid "of Meo"
-msgstr "od Meo"
-
-#: kcalendarsystemcoptic.cpp:210
-#, fuzzy
-#| msgctxt "Coptic month 13 - ShortNamePossessive"
-#| msgid "of Kou"
-msgctxt "Coptic month 13 - KLocale::ShortName Possessive"
-msgid "of Kou"
-msgstr "od Kou"
-
-#: kcalendarsystemcoptic.cpp:219
-#, fuzzy
-#| msgctxt "Coptic month 1 - ShortName"
-#| msgid "Tho"
-msgctxt "Coptic month 1 - KLocale::ShortName"
-msgid "Tho"
-msgstr "Tho"
-
-#: kcalendarsystemcoptic.cpp:221
-#, fuzzy
-#| msgctxt "Coptic month 2 - ShortName"
-#| msgid "Pao"
-msgctxt "Coptic month 2 - KLocale::ShortName"
-msgid "Pao"
-msgstr "Pao"
-
-#: kcalendarsystemcoptic.cpp:223
-#, fuzzy
-#| msgctxt "Coptic month 3 - ShortName"
-#| msgid "Hat"
-msgctxt "Coptic month 3 - KLocale::ShortName"
-msgid "Hat"
-msgstr "Hat"
-
-#: kcalendarsystemcoptic.cpp:225
-#, fuzzy
-#| msgctxt "Coptic month 4 - ShortName"
-#| msgid "Kia"
-msgctxt "Coptic month 4 - KLocale::ShortName"
-msgid "Kia"
-msgstr "Kia"
-
-#: kcalendarsystemcoptic.cpp:227
-#, fuzzy
-#| msgctxt "Coptic month 5 - ShortName"
-#| msgid "Tob"
-msgctxt "Coptic month 5 - KLocale::ShortName"
-msgid "Tob"
-msgstr "Tob"
-
-#: kcalendarsystemcoptic.cpp:229
-#, fuzzy
-#| msgctxt "Coptic month 6 - ShortName"
-#| msgid "Mes"
-msgctxt "Coptic month 6 - KLocale::ShortName"
-msgid "Mes"
-msgstr "Mes"
-
-#: kcalendarsystemcoptic.cpp:231
-#, fuzzy
-#| msgctxt "Coptic month 7 - ShortName"
-#| msgid "Par"
-msgctxt "Coptic month 7 - KLocale::ShortName"
-msgid "Par"
-msgstr "Par"
-
-#: kcalendarsystemcoptic.cpp:233
-#, fuzzy
-#| msgctxt "Coptic month 8 - ShortName"
-#| msgid "Pam"
-msgctxt "Coptic month 8 - KLocale::ShortName"
-msgid "Pam"
-msgstr "Pam"
-
-#: kcalendarsystemcoptic.cpp:235
-#, fuzzy
-#| msgctxt "Coptic month 9 - ShortName"
-#| msgid "Pas"
-msgctxt "Coptic month 9 - KLocale::ShortName"
-msgid "Pas"
-msgstr "Pas"
-
-#: kcalendarsystemcoptic.cpp:237
-#, fuzzy
-#| msgctxt "Coptic month 10 - ShortName"
-#| msgid "Pan"
-msgctxt "Coptic month 10 - KLocale::ShortName"
-msgid "Pan"
-msgstr "Pan"
-
-#: kcalendarsystemcoptic.cpp:239
-#, fuzzy
-#| msgctxt "Coptic month 11 - ShortName"
-#| msgid "Epe"
-msgctxt "Coptic month 11 - KLocale::ShortName"
-msgid "Epe"
-msgstr "Epe"
-
-#: kcalendarsystemcoptic.cpp:241
-#, fuzzy
-#| msgctxt "Coptic month 12 - ShortName"
-#| msgid "Meo"
-msgctxt "Coptic month 12 - KLocale::ShortName"
-msgid "Meo"
-msgstr "Meo"
-
-#: kcalendarsystemcoptic.cpp:243
-#, fuzzy
-#| msgctxt "Coptic month 13 - ShortName"
-#| msgid "Kou"
-msgctxt "Coptic month 12 - KLocale::ShortName"
-msgid "Kou"
-msgstr "Kou"
-
-#: kcalendarsystemcoptic.cpp:252
-#, fuzzy
-#| msgctxt "Coptic month 1 - LongNamePossessive"
-#| msgid "of Thoout"
-msgctxt "Coptic month 1 - KLocale::LongName Possessive"
-msgid "of Thoout"
-msgstr "od Thoouta"
-
-#: kcalendarsystemcoptic.cpp:254
-#, fuzzy
-#| msgctxt "Coptic month 2 - LongNamePossessive"
-#| msgid "of Paope"
-msgctxt "Coptic month 2 - KLocale::LongName Possessive"
-msgid "of Paope"
-msgstr "od Paope"
-
-#: kcalendarsystemcoptic.cpp:256
-#, fuzzy
-#| msgctxt "Coptic month 3 - LongNamePossessive"
-#| msgid "of Hathor"
-msgctxt "Coptic month 3 - KLocale::LongName Possessive"
-msgid "of Hathor"
-msgstr "od Hathora"
-
-#: kcalendarsystemcoptic.cpp:258
-#, fuzzy
-#| msgctxt "Coptic month 4 - LongNamePossessive"
-#| msgid "of Kiahk"
-msgctxt "Coptic month 4 - KLocale::LongName Possessive"
-msgid "of Kiahk"
-msgstr "od Kiahka"
-
-#: kcalendarsystemcoptic.cpp:260
-#, fuzzy
-#| msgctxt "Coptic month 5 - LongNamePossessive"
-#| msgid "of Tobe"
-msgctxt "Coptic month 5 - KLocale::LongName Possessive"
-msgid "of Tobe"
-msgstr "od Tobe"
-
-#: kcalendarsystemcoptic.cpp:262
-#, fuzzy
-#| msgctxt "Coptic month 6 - LongNamePossessive"
-#| msgid "of Meshir"
-msgctxt "Coptic month 6 - KLocale::LongName Possessive"
-msgid "of Meshir"
-msgstr "od Meshira"
-
-#: kcalendarsystemcoptic.cpp:264
-#, fuzzy
-#| msgctxt "Coptic month 7 - LongNamePossessive"
-#| msgid "of Paremhotep"
-msgctxt "Coptic month 7 - KLocale::LongName Possessive"
-msgid "of Paremhotep"
-msgstr "od Paremhotepa"
-
-#: kcalendarsystemcoptic.cpp:266
-#, fuzzy
-#| msgctxt "Coptic month 8 - LongNamePossessive"
-#| msgid "of Parmoute"
-msgctxt "Coptic month 8 - KLocale::LongName Possessive"
-msgid "of Parmoute"
-msgstr "od Parmoute"
-
-#: kcalendarsystemcoptic.cpp:268
-#, fuzzy
-#| msgctxt "Coptic month 9 - LongNamePossessive"
-#| msgid "of Pashons"
-msgctxt "Coptic month 9 - KLocale::LongName Possessive"
-msgid "of Pashons"
-msgstr "od Pashonsa"
-
-#: kcalendarsystemcoptic.cpp:270
-#, fuzzy
-#| msgctxt "Coptic month 10 - LongNamePossessive"
-#| msgid "of Paone"
-msgctxt "Coptic month 10 - KLocale::LongName Possessive"
-msgid "of Paone"
-msgstr "od Paone"
-
-#: kcalendarsystemcoptic.cpp:272
-#, fuzzy
-#| msgctxt "Coptic month 11 - LongNamePossessive"
-#| msgid "of Epep"
-msgctxt "Coptic month 11 - KLocale::LongName Possessive"
-msgid "of Epep"
-msgstr "od Epepa"
-
-#: kcalendarsystemcoptic.cpp:274
-#, fuzzy
-#| msgctxt "Coptic month 12 - LongNamePossessive"
-#| msgid "of Mesore"
-msgctxt "Coptic month 12 - KLocale::LongName Possessive"
-msgid "of Mesore"
-msgstr "od Mesore"
-
-#: kcalendarsystemcoptic.cpp:276
-#, fuzzy
-#| msgctxt "Coptic month 13 - LongNamePossessive"
-#| msgid "of Kouji nabot"
-msgctxt "Coptic month 12 - KLocale::LongName Possessive"
-msgid "of Kouji nabot"
-msgstr "od Kouji nabota"
-
-#: kcalendarsystemcoptic.cpp:285
-#, fuzzy
-#| msgctxt "Coptic month 1 - LongName"
-#| msgid "Thoout"
-msgctxt "Coptic month 1 - KLocale::LongName"
-msgid "Thoout"
-msgstr "Thoout"
-
-#: kcalendarsystemcoptic.cpp:287
-#, fuzzy
-#| msgctxt "Coptic month 2 - LongName"
-#| msgid "Paope"
-msgctxt "Coptic month 2 - KLocale::LongName"
-msgid "Paope"
-msgstr "Paope"
-
-#: kcalendarsystemcoptic.cpp:289
-#, fuzzy
-#| msgctxt "Coptic month 3 - LongName"
-#| msgid "Hathor"
-msgctxt "Coptic month 3 - KLocale::LongName"
-msgid "Hathor"
-msgstr "Hathor"
-
-#: kcalendarsystemcoptic.cpp:291
-#, fuzzy
-#| msgctxt "Coptic month 4 - LongName"
-#| msgid "Kiahk"
-msgctxt "Coptic month 4 - KLocale::LongName"
-msgid "Kiahk"
-msgstr "Kiahk"
-
-#: kcalendarsystemcoptic.cpp:293
-#, fuzzy
-#| msgctxt "Coptic month 5 - LongName"
-#| msgid "Tobe"
-msgctxt "Coptic month 5 - KLocale::LongName"
-msgid "Tobe"
-msgstr "Tobe"
-
-#: kcalendarsystemcoptic.cpp:295
-#, fuzzy
-#| msgctxt "Coptic month 6 - LongName"
-#| msgid "Meshir"
-msgctxt "Coptic month 6 - KLocale::LongName"
-msgid "Meshir"
-msgstr "Meshir"
-
-#: kcalendarsystemcoptic.cpp:297
-#, fuzzy
-#| msgctxt "Coptic month 7 - LongName"
-#| msgid "Paremhotep"
-msgctxt "Coptic month 7 - KLocale::LongName"
-msgid "Paremhotep"
-msgstr "Paremhotep"
-
-#: kcalendarsystemcoptic.cpp:299
-#, fuzzy
-#| msgctxt "Coptic month 8 - LongName"
-#| msgid "Parmoute"
-msgctxt "Coptic month 8 - KLocale::LongName"
-msgid "Parmoute"
-msgstr "Parmoute"
-
-#: kcalendarsystemcoptic.cpp:301
-#, fuzzy
-#| msgctxt "Coptic month 9 - LongName"
-#| msgid "Pashons"
-msgctxt "Coptic month 9 - KLocale::LongName"
-msgid "Pashons"
-msgstr "Pashons"
-
-#: kcalendarsystemcoptic.cpp:303
-#, fuzzy
-#| msgctxt "Coptic month 10 - LongName"
-#| msgid "Paone"
-msgctxt "Coptic month 10 - KLocale::LongName"
-msgid "Paone"
-msgstr "Paone"
-
-#: kcalendarsystemcoptic.cpp:305
-#, fuzzy
-#| msgctxt "Coptic month 11 - LongName"
-#| msgid "Epep"
-msgctxt "Coptic month 11 - KLocale::LongName"
-msgid "Epep"
-msgstr "Epep"
-
-#: kcalendarsystemcoptic.cpp:307
-#, fuzzy
-#| msgctxt "Coptic month 12 - LongName"
-#| msgid "Mesore"
-msgctxt "Coptic month 12 - KLocale::LongName"
-msgid "Mesore"
-msgstr "Mesore"
-
-#: kcalendarsystemcoptic.cpp:309
-#, fuzzy
-#| msgctxt "Coptic month 13 - LongName"
-#| msgid "Kouji nabot"
-msgctxt "Coptic month 12 - KLocale::LongName"
-msgid "Kouji nabot"
-msgstr "Kouji nabot"
-
-#: kcalendarsystemcoptic.cpp:324
-#, fuzzy
-#| msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat"
-#| msgid "AP"
-msgctxt "Coptic weekday 1 - KLocale::NarrowName"
-msgid "P"
-msgstr "AP"
-
-#: kcalendarsystemcoptic.cpp:326
-#, fuzzy
-#| msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat"
-#| msgid "AP"
-msgctxt "Coptic weekday 2 - KLocale::NarrowName"
-msgid "P"
-msgstr "AP"
-
-#: kcalendarsystemcoptic.cpp:328
-#, fuzzy
-#| msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat"
-#| msgid "AP"
-msgctxt "Coptic weekday 3 - KLocale::NarrowName"
-msgid "P"
-msgstr "AP"
-
-#: kcalendarsystemcoptic.cpp:330
-#, fuzzy
-#| msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat"
-#| msgid "AP"
-msgctxt "Coptic weekday 4 - KLocale::NarrowName"
-msgid "P"
-msgstr "AP"
-
-#: kcalendarsystemcoptic.cpp:332
-#, fuzzy
-#| msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat"
-#| msgid "AP"
-msgctxt "Coptic weekday 5 - KLocale::NarrowName"
-msgid "P"
-msgstr "AP"
-
-#: kcalendarsystemcoptic.cpp:334
-#, fuzzy
-#| msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat"
-#| msgid "AP"
-msgctxt "Coptic weekday 6 - KLocale::NarrowName"
-msgid "P"
-msgstr "AP"
-
-#: kcalendarsystemcoptic.cpp:336
-msgctxt "Coptic weekday 7 - KLocale::NarrowName"
-msgid "T"
-msgstr ""
-
-#: kcalendarsystemcoptic.cpp:345
-#, fuzzy
-#| msgctxt "Coptic weekday 1 - ShortDayName"
-#| msgid "Pes"
-msgctxt "Coptic weekday 1 - KLocale::ShortName"
-msgid "Pes"
-msgstr "Pes"
-
-#: kcalendarsystemcoptic.cpp:347
-#, fuzzy
-#| msgctxt "Coptic weekday 2 - ShortDayName"
-#| msgid "Psh"
-msgctxt "Coptic weekday 2 - KLocale::ShortName"
-msgid "Psh"
-msgstr "Psh"
-
-#: kcalendarsystemcoptic.cpp:349
-#, fuzzy
-#| msgctxt "Coptic weekday 3 - ShortDayName"
-#| msgid "Pef"
-msgctxt "Coptic weekday 3 - KLocale::ShortName"
-msgid "Pef"
-msgstr "Pef"
-
-#: kcalendarsystemcoptic.cpp:351
-#, fuzzy
-#| msgctxt "Coptic weekday 4 - ShortDayName"
-#| msgid "Pti"
-msgctxt "Coptic weekday 4 - KLocale::ShortName"
-msgid "Pti"
-msgstr "Pti"
-
-#: kcalendarsystemcoptic.cpp:353
-#, fuzzy
-#| msgctxt "Coptic weekday 5 - ShortDayName"
-#| msgid "Pso"
-msgctxt "Coptic weekday 5 - KLocale::ShortName"
-msgid "Pso"
-msgstr "Pso"
-
-#: kcalendarsystemcoptic.cpp:355
-#, fuzzy
-#| msgctxt "Coptic weekday 6 - ShortDayName"
-#| msgid "Psa"
-msgctxt "Coptic weekday 6 - KLocale::ShortName"
-msgid "Psa"
-msgstr "Psa"
-
-#: kcalendarsystemcoptic.cpp:357
-#, fuzzy
-#| msgctxt "Coptic weekday 7 - ShortDayName"
-#| msgid "Tky"
-msgctxt "Coptic weekday 7 - KLocale::ShortName"
-msgid "Tky"
-msgstr "Tky"
-
-#: kcalendarsystemcoptic.cpp:365
-#, fuzzy
-#| msgctxt "Coptic weekday 1 - LongDayName"
-#| msgid "Pesnau"
-msgctxt "Coptic weekday 1 - KLocale::LongName"
-msgid "Pesnau"
-msgstr "Pesnau"
-
-#: kcalendarsystemcoptic.cpp:367
-#, fuzzy
-#| msgctxt "Coptic weekday 2 - LongDayName"
-#| msgid "Pshoment"
-msgctxt "Coptic weekday 2 - KLocale::LongName"
-msgid "Pshoment"
-msgstr "Pshoment"
-
-#: kcalendarsystemcoptic.cpp:369
-#, fuzzy
-#| msgctxt "Coptic weekday 3 - LongDayName"
-#| msgid "Peftoou"
-msgctxt "Coptic weekday 3 - KLocale::LongName"
-msgid "Peftoou"
-msgstr "Peftoou"
-
-#: kcalendarsystemcoptic.cpp:371
-#, fuzzy
-#| msgctxt "Coptic weekday 4 - LongDayName"
-#| msgid "Ptiou"
-msgctxt "Coptic weekday 4 - KLocale::LongName"
-msgid "Ptiou"
-msgstr "Ptiou"
-
-#: kcalendarsystemcoptic.cpp:373
-#, fuzzy
-#| msgctxt "Coptic weekday 5 - LongDayName"
-#| msgid "Psoou"
-msgctxt "Coptic weekday 5 - KLocale::LongName"
-msgid "Psoou"
-msgstr "Psoou"
-
-#: kcalendarsystemcoptic.cpp:375
-#, fuzzy
-#| msgctxt "Coptic weekday 6 - LongDayName"
-#| msgid "Psabbaton"
-msgctxt "Coptic weekday 6 - KLocale::LongName"
-msgid "Psabbaton"
-msgstr "Psabbaton"
-
-#: kcalendarsystemcoptic.cpp:377
-#, fuzzy
-#| msgctxt "Coptic weekday 7 - LongDayName"
-#| msgid "Tkyriakē"
-msgctxt "Coptic weekday 7 - KLocale::LongName"
-msgid "Tkyriakē"
-msgstr "Tkyriakē"
-
-#: kcalendarsystemethiopian.cpp:50
-msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, LongFormat"
-msgid "Amata Mehrat"
-msgstr "Amata Mehrat"
-
-#: kcalendarsystemethiopian.cpp:51
-msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, ShortFormat"
-msgid "AM"
-msgstr "AM"
-
-#: kcalendarsystemethiopian.cpp:52
-#, c-format
-msgctxt ""
-"(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM"
-msgid "%Ey %EC"
-msgstr "%Ey %EC"
-
-#: kcalendarsystemethiopian.cpp:66
-#, fuzzy
-#| msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat"
-#| msgid "AM"
-msgctxt "Ethiopian month 1 - KLocale::NarrowName"
-msgid "M"
-msgstr "AM"
-
-#: kcalendarsystemethiopian.cpp:68
-msgctxt "Ethiopian month 2 - KLocale::NarrowName"
-msgid "T"
-msgstr ""
-
-#: kcalendarsystemethiopian.cpp:70
-#, fuzzy
-#| msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat"
-#| msgid "AH"
-msgctxt "Ethiopian month 3 - KLocale::NarrowName"
-msgid "H"
-msgstr "AH"
-
-#: kcalendarsystemethiopian.cpp:72
-msgctxt "Ethiopian month 4 - KLocale::NarrowName"
-msgid "T"
-msgstr ""
-
-#: kcalendarsystemethiopian.cpp:74
-msgctxt "Ethiopian month 5 - KLocale::NarrowName"
-msgid "T"
-msgstr ""
-
-#: kcalendarsystemethiopian.cpp:76
-msgctxt "Ethiopian month 6 - KLocale::NarrowName"
-msgid "Y"
-msgstr ""
-
-#: kcalendarsystemethiopian.cpp:78
-#, fuzzy
-#| msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat"
-#| msgid "AM"
-msgctxt "Ethiopian month 7 - KLocale::NarrowName"
-msgid "M"
-msgstr "AM"
-
-#: kcalendarsystemethiopian.cpp:80
-#, fuzzy
-#| msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat"
-#| msgid "AM"
-msgctxt "Ethiopian month 8 - KLocale::NarrowName"
-msgid "M"
-msgstr "AM"
-
-#: kcalendarsystemethiopian.cpp:82
-msgctxt "Ethiopian month 9 - KLocale::NarrowName"
-msgid "G"
-msgstr ""
-
-#: kcalendarsystemethiopian.cpp:84
-#, fuzzy
-#| msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat"
-#| msgid "SE"
-msgctxt "Ethiopian month 10 - KLocale::NarrowName"
-msgid "S"
-msgstr "SE"
-
-#: kcalendarsystemethiopian.cpp:86
-#, fuzzy
-#| msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat"
-#| msgid "AH"
-msgctxt "Ethiopian month 11 - KLocale::NarrowName"
-msgid "H"
-msgstr "AH"
-
-#: kcalendarsystemethiopian.cpp:88
-msgctxt "Ethiopian month 12 - KLocale::NarrowName"
-msgid "N"
-msgstr ""
-
-#: kcalendarsystemethiopian.cpp:90
-#, fuzzy
-#| msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat"
-#| msgid "AP"
-msgctxt "Ethiopian month 13 - KLocale::NarrowName"
-msgid "P"
-msgstr "AP"
-
-#: kcalendarsystemethiopian.cpp:99
-#, fuzzy
-#| msgctxt "Coptic month 6 - ShortNamePossessive"
-#| msgid "of Mes"
-msgctxt "Ethiopian month 1 - KLocale::ShortName Possessive"
-msgid "of Mes"
-msgstr "od Mes"
-
-#: kcalendarsystemethiopian.cpp:101
-#, fuzzy
-#| msgctxt "Ethiopian month 2 - ShortNamePossessive"
-#| msgid "of Teq"
-msgctxt "Ethiopian month 2 - KLocale::ShortName Possessive"
-msgid "of Teq"
-msgstr "od Teq"
-
-#: kcalendarsystemethiopian.cpp:103
-#, fuzzy
-#| msgctxt "Ethiopian month 3 - ShortNamePossessive"
-#| msgid "of Hed"
-msgctxt "Ethiopian month 3 - KLocale::ShortName Possessive"
-msgid "of Hed"
-msgstr "od Hed"
-
-#: kcalendarsystemethiopian.cpp:105
-#, fuzzy
-#| msgctxt "Ethiopian month 4 - ShortNamePossessive"
-#| msgid "of Tah"
-msgctxt "Ethiopian month 4 - KLocale::ShortName Possessive"
-msgid "of Tah"
-msgstr "od Tah"
-
-#: kcalendarsystemethiopian.cpp:107
-#, fuzzy
-#| msgctxt "Ethiopian month 5 - ShortNamePossessive"
-#| msgid "of Ter"
-msgctxt "Ethiopian month 5 - KLocale::ShortName Possessive"
-msgid "of Ter"
-msgstr "od Ter"
-
-#: kcalendarsystemethiopian.cpp:109
-#, fuzzy
-#| msgctxt "Ethiopian month 6 - ShortNamePossessive"
-#| msgid "of Yak"
-msgctxt "Ethiopian month 6 - KLocale::ShortName Possessive"
-msgid "of Yak"
-msgstr "od Yak"
-
-#: kcalendarsystemethiopian.cpp:111
-#, fuzzy
-#| msgctxt "Ethiopian month 7 - ShortNamePossessive"
-#| msgid "of Mag"
-msgctxt "Ethiopian month 7 - KLocale::ShortName Possessive"
-msgid "of Mag"
-msgstr "od Mag"
-
-#: kcalendarsystemethiopian.cpp:113
-#, fuzzy
-#| msgctxt "Ethiopian month 8 - ShortNamePossessive"
-#| msgid "of Miy"
-msgctxt "Ethiopian month 8 - KLocale::ShortName Possessive"
-msgid "of Miy"
-msgstr "od Miy"
-
-#: kcalendarsystemethiopian.cpp:115
-#, fuzzy
-#| msgctxt "Ethiopian month 9 - ShortNamePossessive"
-#| msgid "of Gen"
-msgctxt "Ethiopian month 9 - KLocale::ShortName Possessive"
-msgid "of Gen"
-msgstr "od Gen"
-
-#: kcalendarsystemethiopian.cpp:117
-#, fuzzy
-#| msgctxt "Ethiopian month 10 - ShortNamePossessive"
-#| msgid "of Sen"
-msgctxt "Ethiopian month 10 - KLocale::ShortName Possessive"
-msgid "of Sen"
-msgstr "od Sen"
-
-#: kcalendarsystemethiopian.cpp:119
-#, fuzzy
-#| msgctxt "Ethiopian month 11 - ShortNamePossessive"
-#| msgid "of Ham"
-msgctxt "Ethiopian month 11 - KLocale::ShortName Possessive"
-msgid "of Ham"
-msgstr "od Ham"
-
-#: kcalendarsystemethiopian.cpp:121
-#, fuzzy
-#| msgctxt "Ethiopian month 12 - ShortNamePossessive"
-#| msgid "of Neh"
-msgctxt "Ethiopian month 12 - KLocale::ShortName Possessive"
-msgid "of Neh"
-msgstr "od Neh"
-
-#: kcalendarsystemethiopian.cpp:123
-#, fuzzy
-#| msgctxt "Ethiopian month 13 - ShortNamePossessive"
-#| msgid "of Pag"
-msgctxt "Ethiopian month 13 - KLocale::ShortName Possessive"
-msgid "of Pag"
-msgstr "od Pag"
-
-#: kcalendarsystemethiopian.cpp:132
-#, fuzzy
-#| msgctxt "Coptic month 6 - ShortName"
-#| msgid "Mes"
-msgctxt "Ethiopian month 1 - KLocale::ShortName"
-msgid "Mes"
-msgstr "Mes"
-
-#: kcalendarsystemethiopian.cpp:134
-#, fuzzy
-#| msgctxt "Ethiopian month 2 - ShortName"
-#| msgid "Teq"
-msgctxt "Ethiopian month 2 - KLocale::ShortName"
-msgid "Teq"
-msgstr "Teq"
-
-#: kcalendarsystemethiopian.cpp:136
-#, fuzzy
-#| msgctxt "Ethiopian month 3 - ShortName"
-#| msgid "Hed"
-msgctxt "Ethiopian month 3 - KLocale::ShortName"
-msgid "Hed"
-msgstr "Hed"
-
-#: kcalendarsystemethiopian.cpp:138
-#, fuzzy
-#| msgctxt "Ethiopian month 4 - ShortName"
-#| msgid "Tah"
-msgctxt "Ethiopian month 4 - KLocale::ShortName"
-msgid "Tah"
-msgstr "Tah"
-
-#: kcalendarsystemethiopian.cpp:140
-#, fuzzy
-#| msgctxt "Ethiopian month 5 - ShortName"
-#| msgid "Ter"
-msgctxt "Ethiopian month 5 - KLocale::ShortName"
-msgid "Ter"
-msgstr "Ter"
-
-#: kcalendarsystemethiopian.cpp:142
-#, fuzzy
-#| msgctxt "Ethiopian month 6 - ShortName"
-#| msgid "Yak"
-msgctxt "Ethiopian month 6 - KLocale::ShortName"
-msgid "Yak"
-msgstr "Yak"
-
-#: kcalendarsystemethiopian.cpp:144
-#, fuzzy
-#| msgctxt "Ethiopian month 7 - ShortName"
-#| msgid "Mag"
-msgctxt "Ethiopian month 7 - KLocale::ShortName"
-msgid "Mag"
-msgstr "Mag"
-
-#: kcalendarsystemethiopian.cpp:146
-#, fuzzy
-#| msgctxt "Ethiopian month 8 - ShortName"
-#| msgid "Miy"
-msgctxt "Ethiopian month 8 - KLocale::ShortName"
-msgid "Miy"
-msgstr "Miy"
-
-#: kcalendarsystemethiopian.cpp:148
-#, fuzzy
-#| msgctxt "Ethiopian month 9 - ShortName"
-#| msgid "Gen"
-msgctxt "Ethiopian month 9 - KLocale::ShortName"
-msgid "Gen"
-msgstr "Gen"
-
-#: kcalendarsystemethiopian.cpp:150
-#, fuzzy
-#| msgctxt "Ethiopian month 10 - ShortName"
-#| msgid "Sen"
-msgctxt "Ethiopian month 10 - KLocale::ShortName"
-msgid "Sen"
-msgstr "Sen"
-
-#: kcalendarsystemethiopian.cpp:152
-#, fuzzy
-#| msgctxt "Ethiopian month 11 - ShortName"
-#| msgid "Ham"
-msgctxt "Ethiopian month 11 - KLocale::ShortName"
-msgid "Ham"
-msgstr "Ham"
-
-#: kcalendarsystemethiopian.cpp:154
-#, fuzzy
-#| msgctxt "Ethiopian month 12 - ShortName"
-#| msgid "Neh"
-msgctxt "Ethiopian month 12 - KLocale::ShortName"
-msgid "Neh"
-msgstr "Neh"
-
-#: kcalendarsystemethiopian.cpp:156
-#, fuzzy
-#| msgctxt "Ethiopian month 13 - ShortName"
-#| msgid "Pag"
-msgctxt "Ethiopian month 13 - KLocale::ShortName"
-msgid "Pag"
-msgstr "Pag"
-
-#: kcalendarsystemethiopian.cpp:165
-#, fuzzy
-#| msgctxt "Ethiopian month 1 - LongNamePossessive"
-#| msgid "of Meskerem"
-msgctxt "Ethiopian month 1 - KLocale::LongName Possessive"
-msgid "of Meskerem"
-msgstr "od Meskerema"
-
-#: kcalendarsystemethiopian.cpp:167
-#, fuzzy
-#| msgctxt "Ethiopian month 2 - LongNamePossessive"
-#| msgid "of Tequemt"
-msgctxt "Ethiopian month 2 - KLocale::LongName Possessive"
-msgid "of Tequemt"
-msgstr "od Tequemta"
-
-#: kcalendarsystemethiopian.cpp:169
-#, fuzzy
-#| msgctxt "Ethiopian month 3 - LongNamePossessive"
-#| msgid "of Hedar"
-msgctxt "Ethiopian month 3 - KLocale::LongName Possessive"
-msgid "of Hedar"
-msgstr "od Hedara"
-
-#: kcalendarsystemethiopian.cpp:171
-#, fuzzy
-#| msgctxt "Ethiopian month 4 - LongNamePossessive"
-#| msgid "of Tahsas"
-msgctxt "Ethiopian month 4 - KLocale::LongName Possessive"
-msgid "of Tahsas"
-msgstr "od Tahsasa"
-
-#: kcalendarsystemethiopian.cpp:173
-#, fuzzy
-#| msgctxt "Ethiopian month 5 - ShortNamePossessive"
-#| msgid "of Ter"
-msgctxt "Ethiopian month 5 - KLocale::LongName Possessive"
-msgid "of Ter"
-msgstr "od Ter"
-
-#: kcalendarsystemethiopian.cpp:175
-#, fuzzy
-#| msgctxt "Ethiopian month 6 - LongNamePossessive"
-#| msgid "of Yakatit"
-msgctxt "Ethiopian month 6 - KLocale::LongName Possessive"
-msgid "of Yakatit"
-msgstr "od Yakatita"
-
-#: kcalendarsystemethiopian.cpp:177
-#, fuzzy
-#| msgctxt "Ethiopian month 7 - LongNamePossessive"
-#| msgid "of Magabit"
-msgctxt "Ethiopian month 7 - KLocale::LongName Possessive"
-msgid "of Magabit"
-msgstr "od Magabita"
-
-#: kcalendarsystemethiopian.cpp:179
-#, fuzzy
-#| msgctxt "Ethiopian month 8 - LongNamePossessive"
-#| msgid "of Miyazya"
-msgctxt "Ethiopian month 8 - KLocale::LongName Possessive"
-msgid "of Miyazya"
-msgstr "od Miyazya"
-
-#: kcalendarsystemethiopian.cpp:181
-#, fuzzy
-#| msgctxt "Ethiopian month 9 - LongNamePossessive"
-#| msgid "of Genbot"
-msgctxt "Ethiopian month 9 - KLocale::LongName Possessive"
-msgid "of Genbot"
-msgstr "od Genbota"
-
-#: kcalendarsystemethiopian.cpp:183
-#, fuzzy
-#| msgctxt "Ethiopian month 10 - LongNamePossessive"
-#| msgid "of Sene"
-msgctxt "Ethiopian month 10 - KLocale::LongName Possessive"
-msgid "of Sene"
-msgstr "od Sene"
-
-#: kcalendarsystemethiopian.cpp:185
-#, fuzzy
-#| msgctxt "Ethiopian month 11 - LongNamePossessive"
-#| msgid "of Hamle"
-msgctxt "Ethiopian month 11 - KLocale::LongName Possessive"
-msgid "of Hamle"
-msgstr "od Hamle"
-
-#: kcalendarsystemethiopian.cpp:187
-#, fuzzy
-#| msgctxt "Ethiopian month 12 - LongNamePossessive"
-#| msgid "of Nehase"
-msgctxt "Ethiopian month 12 - KLocale::LongName Possessive"
-msgid "of Nehase"
-msgstr "od Nehase"
-
-#: kcalendarsystemethiopian.cpp:189
-#, fuzzy
-#| msgctxt "Ethiopian month 13 - LongNamePossessive"
-#| msgid "of Pagumen"
-msgctxt "Ethiopian month 13 - KLocale::LongName Possessive"
-msgid "of Pagumen"
-msgstr "od Pagumena"
-
-#: kcalendarsystemethiopian.cpp:198
-#, fuzzy
-#| msgctxt "Ethiopian month 1 - LongName"
-#| msgid "Meskerem"
-msgctxt "Ethiopian month 1 - KLocale::LongName"
-msgid "Meskerem"
-msgstr "Meskerem"
-
-#: kcalendarsystemethiopian.cpp:200
-#, fuzzy
-#| msgctxt "Ethiopian month 2 - LongName"
-#| msgid "Tequemt"
-msgctxt "Ethiopian month 2 - KLocale::LongName"
-msgid "Tequemt"
-msgstr "Tequemt"
-
-#: kcalendarsystemethiopian.cpp:202
-#, fuzzy
-#| msgctxt "Ethiopian month 3 - LongName"
-#| msgid "Hedar"
-msgctxt "Ethiopian month 3 - KLocale::LongName"
-msgid "Hedar"
-msgstr "Hedar"
-
-#: kcalendarsystemethiopian.cpp:204
-#, fuzzy
-#| msgctxt "Ethiopian month 4 - LongName"
-#| msgid "Tahsas"
-msgctxt "Ethiopian month 4 - KLocale::LongName"
-msgid "Tahsas"
-msgstr "Tahsas"
-
-#: kcalendarsystemethiopian.cpp:206
-#, fuzzy
-#| msgctxt "Ethiopian month 5 - ShortName"
-#| msgid "Ter"
-msgctxt "Ethiopian month 5 - KLocale::LongName"
-msgid "Ter"
-msgstr "Ter"
-
-#: kcalendarsystemethiopian.cpp:208
-#, fuzzy
-#| msgctxt "Ethiopian month 6 - LongName"
-#| msgid "Yakatit"
-msgctxt "Ethiopian month 6 - KLocale::LongName"
-msgid "Yakatit"
-msgstr "Yakatit"
-
-#: kcalendarsystemethiopian.cpp:210
-#, fuzzy
-#| msgctxt "Ethiopian month 7 - LongName"
-#| msgid "Magabit"
-msgctxt "Ethiopian month 7 - KLocale::LongName"
-msgid "Magabit"
-msgstr "Magabit"
-
-#: kcalendarsystemethiopian.cpp:212
-#, fuzzy
-#| msgctxt "Ethiopian month 8 - LongName"
-#| msgid "Miyazya"
-msgctxt "Ethiopian month 8 - KLocale::LongName"
-msgid "Miyazya"
-msgstr "Miyazya"
-
-#: kcalendarsystemethiopian.cpp:214
-#, fuzzy
-#| msgctxt "Ethiopian month 9 - LongName"
-#| msgid "Genbot"
-msgctxt "Ethiopian month 9 - KLocale::LongName"
-msgid "Genbot"
-msgstr "Genbot"
-
-#: kcalendarsystemethiopian.cpp:216
-#, fuzzy
-#| msgctxt "Ethiopian month 10 - LongName"
-#| msgid "Sene"
-msgctxt "Ethiopian month 10 - KLocale::LongName"
-msgid "Sene"
-msgstr "Sene"
-
-#: kcalendarsystemethiopian.cpp:218
-#, fuzzy
-#| msgctxt "Ethiopian month 11 - LongName"
-#| msgid "Hamle"
-msgctxt "Ethiopian month 11 - KLocale::LongName"
-msgid "Hamle"
-msgstr "Hamle"
-
-#: kcalendarsystemethiopian.cpp:220
-#, fuzzy
-#| msgctxt "Ethiopian month 12 - LongName"
-#| msgid "Nehase"
-msgctxt "Ethiopian month 12 - KLocale::LongName"
-msgid "Nehase"
-msgstr "Nehase"
-
-#: kcalendarsystemethiopian.cpp:222
-#, fuzzy
-#| msgctxt "Ethiopian month 13 - LongName"
-#| msgid "Pagumen"
-msgctxt "Ethiopian month 13 - KLocale::LongName"
-msgid "Pagumen"
-msgstr "Pagumen"
-
-#: kcalendarsystemethiopian.cpp:236
-#, fuzzy
-#| msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat"
-#| msgid "SE"
-msgctxt "Ethiopian weekday 1 - KLocale::NarrowName "
-msgid "S"
-msgstr "SE"
-
-#: kcalendarsystemethiopian.cpp:238
-#, fuzzy
-#| msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat"
-#| msgid "AM"
-msgctxt "Ethiopian weekday 2 - KLocale::NarrowName "
-msgid "M"
-msgstr "AM"
-
-#: kcalendarsystemethiopian.cpp:240
-msgctxt "Ethiopian weekday 3 - KLocale::NarrowName "
-msgid "R"
-msgstr ""
-
-#: kcalendarsystemethiopian.cpp:242
-#, fuzzy
-#| msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat"
-#| msgid "AH"
-msgctxt "Ethiopian weekday 4 - KLocale::NarrowName "
-msgid "H"
-msgstr "AH"
-
-#: kcalendarsystemethiopian.cpp:244
-#, fuzzy
-#| msgid "Av"
-msgctxt "Ethiopian weekday 5 - KLocale::NarrowName "
-msgid "A"
-msgstr "Av"
-
-#: kcalendarsystemethiopian.cpp:246
-msgctxt "Ethiopian weekday 6 - KLocale::NarrowName "
-msgid "Q"
-msgstr ""
-
-#: kcalendarsystemethiopian.cpp:248
-#, fuzzy
-#| msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat"
-#| msgid "CE"
-msgctxt "Ethiopian weekday 7 - KLocale::NarrowName "
-msgid "E"
-msgstr "CE"
-
-#: kcalendarsystemethiopian.cpp:257
-#, fuzzy
-#| msgctxt "Ethiopian weekday 1 - ShortDayName"
-#| msgid "Seg"
-msgctxt "Ethiopian weekday 1 - KLocale::ShortName"
-msgid "Seg"
-msgstr "Seg"
-
-#: kcalendarsystemethiopian.cpp:259
-#, fuzzy
-#| msgctxt "Ethiopian weekday 2 - ShortDayName"
-#| msgid "Mak"
-msgctxt "Ethiopian weekday 2 - KLocale::ShortName"
-msgid "Mak"
-msgstr "Mak"
-
-#: kcalendarsystemethiopian.cpp:261
-#, fuzzy
-#| msgctxt "Ethiopian weekday 3 - ShortDayName"
-#| msgid "Rob"
-msgctxt "Ethiopian weekday 3 - KLocale::ShortName"
-msgid "Rob"
-msgstr "Rob"
-
-#: kcalendarsystemethiopian.cpp:263
-#, fuzzy
-#| msgctxt "Ethiopian month 11 - ShortName"
-#| msgid "Ham"
-msgctxt "Ethiopian weekday 4 - KLocale::ShortName"
-msgid "Ham"
-msgstr "Ham"
-
-#: kcalendarsystemethiopian.cpp:265
-#, fuzzy
-#| msgid "Arb"
-msgctxt "Ethiopian weekday 5 - KLocale::ShortName"
-msgid "Arb"
-msgstr "Arb"
-
-#: kcalendarsystemethiopian.cpp:267
-#, fuzzy
-#| msgctxt "Ethiopian weekday 6 - ShortDayName"
-#| msgid "Qed"
-msgctxt "Ethiopian weekday 6 - KLocale::ShortName"
-msgid "Qed"
-msgstr "Qed"
-
-#: kcalendarsystemethiopian.cpp:269
-#, fuzzy
-#| msgctxt "Ethiopian weekday 7 - ShortDayName"
-#| msgid "Ehu"
-msgctxt "Ethiopian weekday 7 - KLocale::ShortName"
-msgid "Ehu"
-msgstr "Ehu"
-
-#: kcalendarsystemethiopian.cpp:276
-#, fuzzy
-#| msgctxt "Ethiopian weekday 1 - LongDayName"
-#| msgid "Segno"
-msgctxt "Ethiopian weekday 1 - KLocale::LongName"
-msgid "Segno"
-msgstr "Segno"
-
-#: kcalendarsystemethiopian.cpp:278
-#, fuzzy
-#| msgctxt "Ethiopian weekday 2 - LongDayName"
-#| msgid "Maksegno"
-msgctxt "Ethiopian weekday 2 - KLocale::LongName"
-msgid "Maksegno"
-msgstr "Maksegno"
-
-#: kcalendarsystemethiopian.cpp:280
-#, fuzzy
-#| msgctxt "Ethiopian weekday 3 - ShortDayName"
-#| msgid "Rob"
-msgctxt "Ethiopian weekday 3 - KLocale::LongName"
-msgid "Rob"
-msgstr "Rob"
-
-#: kcalendarsystemethiopian.cpp:282
-#, fuzzy
-#| msgctxt "Ethiopian weekday 4 - LongDayName"
-#| msgid "Hamus"
-msgctxt "Ethiopian weekday 4 - KLocale::LongName"
-msgid "Hamus"
-msgstr "Hamus"
-
-#: kcalendarsystemethiopian.cpp:284
-#, fuzzy
-#| msgid "Arb"
-msgctxt "Ethiopian weekday 5 - KLocale::LongName"
-msgid "Arb"
-msgstr "Arb"
-
-#: kcalendarsystemethiopian.cpp:286
-#, fuzzy
-#| msgctxt "Ethiopian weekday 6 - LongDayName"
-#| msgid "Qedame"
-msgctxt "Ethiopian weekday 6 - KLocale::LongName"
-msgid "Qedame"
-msgstr "Qedame"
-
-#: kcalendarsystemethiopian.cpp:288
-#, fuzzy
-#| msgctxt "Ethiopian weekday 7 - LongDayName"
-#| msgid "Ehud"
-msgctxt "Ethiopian weekday 7 - KLocale::LongName"
-msgid "Ehud"
-msgstr "Ehud"
-
-#: kcalendarsystemgregorian.cpp:53
-msgctxt "Calendar Era: Gregorian Common Era, years < 0, LongFormat"
-msgid "Before Common Era"
-msgstr "Prije naše ere"
-
-#: kcalendarsystemgregorian.cpp:54
-msgctxt "Calendar Era: Gregorian Common Era, years < 0, ShortFormat"
-msgid "BCE"
-msgstr "BCE"
-
-#: kcalendarsystemgregorian.cpp:56
-msgctxt "Calendar Era: Gregorian Christian Era, years < 0, LongFormat"
-msgid "Before Christ"
-msgstr "Prije Krista"
-
-#: kcalendarsystemgregorian.cpp:57
-msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat"
-msgid "BC"
-msgstr "BC"
-
-#: kcalendarsystemgregorian.cpp:59
-#, c-format
-msgctxt ""
-"(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC"
-msgid "%Ey %EC"
-msgstr "%Ey %EC"
-
-#: kcalendarsystemgregorian.cpp:63
-msgctxt "Calendar Era: Gregorian Common Era, years > 0, LongFormat"
-msgid "Common Era"
-msgstr "Naša era"
-
-#: kcalendarsystemgregorian.cpp:64
-msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat"
-msgid "CE"
-msgstr "CE"
-
-#: kcalendarsystemgregorian.cpp:66 kcalendarsystemjapanese.cpp:57
-msgctxt "Calendar Era: Gregorian Christian Era, years > 0, LongFormat"
-msgid "Anno Domini"
-msgstr "Anno Domini"
-
-#: kcalendarsystemgregorian.cpp:67 kcalendarsystemjapanese.cpp:58
-msgctxt "Calendar Era: Gregorian Christian Era, years > 0, ShortFormat"
-msgid "AD"
-msgstr "AD"
-
-#: kcalendarsystemgregorian.cpp:69 kcalendarsystemjapanese.cpp:59
-#, c-format
-msgctxt ""
-"(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD"
-msgid "%Ey %EC"
-msgstr "%Ey %EC"
-
-#: kcalendarsystemgregorian.cpp:138
-msgctxt "Gregorian month 1 - KLocale::NarrowName"
-msgid "J"
-msgstr "S"
-
-#: kcalendarsystemgregorian.cpp:140
-msgctxt "Gregorian month 2 - KLocale::NarrowName"
-msgid "F"
-msgstr "V"
-
-#: kcalendarsystemgregorian.cpp:142
-msgctxt "Gregorian month 3 - KLocale::NarrowName"
-msgid "M"
-msgstr "O"
-
-#: kcalendarsystemgregorian.cpp:144
-msgctxt "Gregorian month 4 - KLocale::NarrowName"
-msgid "A"
-msgstr "T"
-
-#: kcalendarsystemgregorian.cpp:146
-msgctxt "Gregorian month 5 - KLocale::NarrowName"
-msgid "M"
-msgstr "S"
-
-#: kcalendarsystemgregorian.cpp:148
-msgctxt "Gregorian month 6 - KLocale::NarrowName"
-msgid "J"
-msgstr "L"
-
-#: kcalendarsystemgregorian.cpp:150
-msgctxt "Gregorian month 7 - KLocale::NarrowName"
-msgid "J"
-msgstr "S"
-
-#: kcalendarsystemgregorian.cpp:152
-msgctxt "Gregorian month 8 - KLocale::NarrowName"
-msgid "A"
-msgstr "K"
-
-#: kcalendarsystemgregorian.cpp:154
-msgctxt "Gregorian month 9 - KLocale::NarrowName"
-msgid "S"
-msgstr "R"
-
-#: kcalendarsystemgregorian.cpp:156
-msgctxt "Gregorian month 10 - KLocale::NarrowName"
-msgid "O"
-msgstr "L"
-
-#: kcalendarsystemgregorian.cpp:158
-msgctxt "Gregorian month 11 - KLocale::NarrowName"
-msgid "N"
-msgstr "S"
-
-#: kcalendarsystemgregorian.cpp:160
-msgctxt "Gregorian month 12 - KLocale::NarrowName"
-msgid "D"
-msgstr "P"
-
-#: kcalendarsystemgregorian.cpp:169
-msgctxt "Gregorian month 1 - KLocale::ShortName Possessive"
-msgid "of Jan"
-msgstr "siječnja"
-
-#: kcalendarsystemgregorian.cpp:171
-msgctxt "Gregorian month 2 - KLocale::ShortName Possessive"
-msgid "of Feb"
-msgstr "veljače"
-
-#: kcalendarsystemgregorian.cpp:173
-msgctxt "Gregorian month 3 - KLocale::ShortName Possessive"
-msgid "of Mar"
-msgstr "ožujka"
-
-#: kcalendarsystemgregorian.cpp:175
-msgctxt "Gregorian month 4 - KLocale::ShortName Possessive"
-msgid "of Apr"
-msgstr "travnja"
-
-#: kcalendarsystemgregorian.cpp:177
-msgctxt "Gregorian month 5 - KLocale::ShortName Possessive"
-msgid "of May"
-msgstr "svibnja"
-
-#: kcalendarsystemgregorian.cpp:179
-msgctxt "Gregorian month 6 - KLocale::ShortName Possessive"
-msgid "of Jun"
-msgstr "lipnja"
-
-#: kcalendarsystemgregorian.cpp:181
-msgctxt "Gregorian month 7 - KLocale::ShortName Possessive"
-msgid "of Jul"
-msgstr "srpnja"
-
-#: kcalendarsystemgregorian.cpp:183
-msgctxt "Gregorian month 8 - KLocale::ShortName Possessive"
-msgid "of Aug"
-msgstr "kolovoza"
-
-#: kcalendarsystemgregorian.cpp:185
-msgctxt "Gregorian month 9 - KLocale::ShortName Possessive"
-msgid "of Sep"
-msgstr "rujna"
-
-#: kcalendarsystemgregorian.cpp:187
-msgctxt "Gregorian month 10 - KLocale::ShortName Possessive"
-msgid "of Oct"
-msgstr "listopada"
-
-#: kcalendarsystemgregorian.cpp:189
-msgctxt "Gregorian month 11 - KLocale::ShortName Possessive"
-msgid "of Nov"
-msgstr "studenog"
-
-#: kcalendarsystemgregorian.cpp:191
-msgctxt "Gregorian month 12 - KLocale::ShortName Possessive"
-msgid "of Dec"
-msgstr "prosinca"
-
-#: kcalendarsystemgregorian.cpp:200
-msgctxt "Gregorian month 1 - KLocale::ShortName"
-msgid "Jan"
-msgstr "Sij"
-
-#: kcalendarsystemgregorian.cpp:202
-msgctxt "Gregorian month 2 - KLocale::ShortName"
-msgid "Feb"
-msgstr "Velj"
-
-#: kcalendarsystemgregorian.cpp:204
-msgctxt "Gregorian month 3 - KLocale::ShortName"
-msgid "Mar"
-msgstr "Ožu"
-
-#: kcalendarsystemgregorian.cpp:206
-msgctxt "Gregorian month 4 - KLocale::ShortName"
-msgid "Apr"
-msgstr "Tra"
-
-#: kcalendarsystemgregorian.cpp:208
-msgctxt "Gregorian month 5 - KLocale::ShortName"
-msgid "May"
-msgstr "Svi"
-
-#: kcalendarsystemgregorian.cpp:210
-msgctxt "Gregorian month 6 - KLocale::ShortName"
-msgid "Jun"
-msgstr "Lip"
-
-#: kcalendarsystemgregorian.cpp:212
-msgctxt "Gregorian month 7 - KLocale::ShortName"
-msgid "Jul"
-msgstr "Srp"
-
-#: kcalendarsystemgregorian.cpp:214
-msgctxt "Gregorian month 8 - KLocale::ShortName"
-msgid "Aug"
-msgstr "Kol"
-
-#: kcalendarsystemgregorian.cpp:216
-msgctxt "Gregorian month 9 - KLocale::ShortName"
-msgid "Sep"
-msgstr "Ruj"
-
-#: kcalendarsystemgregorian.cpp:218
-msgctxt "Gregorian month 10 - KLocale::ShortName"
-msgid "Oct"
-msgstr "Lis"
-
-#: kcalendarsystemgregorian.cpp:220
-msgctxt "Gregorian month 11 - KLocale::ShortName"
-msgid "Nov"
-msgstr "Stu"
-
-#: kcalendarsystemgregorian.cpp:222
-msgctxt "Gregorian month 12 - KLocale::ShortName"
-msgid "Dec"
-msgstr "Pro"
-
-#: kcalendarsystemgregorian.cpp:231
-msgctxt "Gregorian month 1 - KLocale::LongName Possessive"
-msgid "of January"
-msgstr "siječnja"
-
-#: kcalendarsystemgregorian.cpp:233
-msgctxt "Gregorian month 2 - KLocale::LongName Possessive"
-msgid "of February"
-msgstr "veljače"
-
-#: kcalendarsystemgregorian.cpp:235
-msgctxt "Gregorian month 3 - KLocale::LongName Possessive"
-msgid "of March"
-msgstr "ožujka"
-
-#: kcalendarsystemgregorian.cpp:237
-msgctxt "Gregorian month 4 - KLocale::LongName Possessive"
-msgid "of April"
-msgstr "travnja"
-
-#: kcalendarsystemgregorian.cpp:239
-msgctxt "Gregorian month 5 - KLocale::LongName Possessive"
-msgid "of May"
-msgstr "svibnja"
-
-#: kcalendarsystemgregorian.cpp:241
-msgctxt "Gregorian month 6 - KLocale::LongName Possessive"
-msgid "of June"
-msgstr "lipnja"
-
-#: kcalendarsystemgregorian.cpp:243
-msgctxt "Gregorian month 7 - KLocale::LongName Possessive"
-msgid "of July"
-msgstr "srpnja"
-
-#: kcalendarsystemgregorian.cpp:245
-msgctxt "Gregorian month 8 - KLocale::LongName Possessive"
-msgid "of August"
-msgstr "kolovoza"
-
-#: kcalendarsystemgregorian.cpp:247
-msgctxt "Gregorian month 9 - KLocale::LongName Possessive"
-msgid "of September"
-msgstr "rujna"
-
-#: kcalendarsystemgregorian.cpp:249
-msgctxt "Gregorian month 10 - KLocale::LongName Possessive"
-msgid "of October"
-msgstr "listopada"
-
-#: kcalendarsystemgregorian.cpp:251
-msgctxt "Gregorian month 11 - KLocale::LongName Possessive"
-msgid "of November"
-msgstr "studenog"
-
-#: kcalendarsystemgregorian.cpp:253
-msgctxt "Gregorian month 12 - KLocale::LongName Possessive"
-msgid "of December"
-msgstr "prosinca"
-
-#: kcalendarsystemgregorian.cpp:262
-msgctxt "Gregorian month 1 - KLocale::LongName"
-msgid "January"
-msgstr "Siječanj"
-
-#: kcalendarsystemgregorian.cpp:264
-msgctxt "Gregorian month 2 - KLocale::LongName"
-msgid "February"
-msgstr "Veljača"
-
-#: kcalendarsystemgregorian.cpp:266
-msgctxt "Gregorian month 3 - KLocale::LongName"
-msgid "March"
-msgstr "Ožujak"
-
-#: kcalendarsystemgregorian.cpp:268
-msgctxt "Gregorian month 4 - KLocale::LongName"
-msgid "April"
-msgstr "Travanj"
-
-#: kcalendarsystemgregorian.cpp:270
-msgctxt "Gregorian month 5 - KLocale::LongName"
-msgid "May"
-msgstr "Svibanj"
-
-#: kcalendarsystemgregorian.cpp:272
-msgctxt "Gregorian month 6 - KLocale::LongName"
-msgid "June"
-msgstr "Lipanj"
-
-#: kcalendarsystemgregorian.cpp:274
-msgctxt "Gregorian month 7 - KLocale::LongName"
-msgid "July"
-msgstr "Srpanj"
-
-#: kcalendarsystemgregorian.cpp:276
-msgctxt "Gregorian month 8 - KLocale::LongName"
-msgid "August"
-msgstr "Kolovoz"
-
-#: kcalendarsystemgregorian.cpp:278
-msgctxt "Gregorian month 9 - KLocale::LongName"
-msgid "September"
-msgstr "Rujan"
-
-#: kcalendarsystemgregorian.cpp:280
-msgctxt "Gregorian month 10 - KLocale::LongName"
-msgid "October"
-msgstr "Listopad"
-
-#: kcalendarsystemgregorian.cpp:282
-msgctxt "Gregorian month 11 - KLocale::LongName"
-msgid "November"
-msgstr "Studeni"
-
-#: kcalendarsystemgregorian.cpp:284
-msgctxt "Gregorian month 12 - KLocale::LongName"
-msgid "December"
-msgstr "Prosinac"
-
-#: kcalendarsystemgregorian.cpp:297 kcalendarsystemhebrew.cpp:807
-msgctxt "Gregorian weekday 1 - KLocale::NarrowName "
-msgid "M"
-msgstr "P"
-
-#: kcalendarsystemgregorian.cpp:299 kcalendarsystemhebrew.cpp:809
-msgctxt "Gregorian weekday 2 - KLocale::NarrowName "
-msgid "T"
-msgstr "U"
-
-#: kcalendarsystemgregorian.cpp:301 kcalendarsystemhebrew.cpp:811
-msgctxt "Gregorian weekday 3 - KLocale::NarrowName "
-msgid "W"
-msgstr "S"
-
-#: kcalendarsystemgregorian.cpp:303 kcalendarsystemhebrew.cpp:813
-msgctxt "Gregorian weekday 4 - KLocale::NarrowName "
-msgid "T"
-msgstr "Č"
-
-#: kcalendarsystemgregorian.cpp:305 kcalendarsystemhebrew.cpp:815
-msgctxt "Gregorian weekday 5 - KLocale::NarrowName "
-msgid "F"
-msgstr "P"
-
-#: kcalendarsystemgregorian.cpp:307 kcalendarsystemhebrew.cpp:817
-msgctxt "Gregorian weekday 6 - KLocale::NarrowName "
-msgid "S"
-msgstr "S"
-
-#: kcalendarsystemgregorian.cpp:309 kcalendarsystemhebrew.cpp:819
-msgctxt "Gregorian weekday 7 - KLocale::NarrowName "
-msgid "S"
-msgstr "N"
-
-#: kcalendarsystemgregorian.cpp:318 kcalendarsystemhebrew.cpp:828
-msgctxt "Gregorian weekday 1 - KLocale::ShortName"
-msgid "Mon"
-msgstr "Pon"
-
-#: kcalendarsystemgregorian.cpp:320 kcalendarsystemhebrew.cpp:830
-msgctxt "Gregorian weekday 2 - KLocale::ShortName"
-msgid "Tue"
-msgstr "Uto"
-
-#: kcalendarsystemgregorian.cpp:322 kcalendarsystemhebrew.cpp:832
-msgctxt "Gregorian weekday 3 - KLocale::ShortName"
-msgid "Wed"
-msgstr "Sri"
-
-#: kcalendarsystemgregorian.cpp:324 kcalendarsystemhebrew.cpp:834
-msgctxt "Gregorian weekday 4 - KLocale::ShortName"
-msgid "Thu"
-msgstr "Čet"
-
-#: kcalendarsystemgregorian.cpp:326 kcalendarsystemhebrew.cpp:836
-msgctxt "Gregorian weekday 5 - KLocale::ShortName"
-msgid "Fri"
-msgstr "Pet"
-
-#: kcalendarsystemgregorian.cpp:328 kcalendarsystemhebrew.cpp:838
-msgctxt "Gregorian weekday 6 - KLocale::ShortName"
-msgid "Sat"
-msgstr "Sub"
-
-#: kcalendarsystemgregorian.cpp:330 kcalendarsystemhebrew.cpp:840
-msgctxt "Gregorian weekday 7 - KLocale::ShortName"
-msgid "Sun"
-msgstr "Ned"
-
-#: kcalendarsystemgregorian.cpp:337 kcalendarsystemhebrew.cpp:847
-msgctxt "Gregorian weekday 1 - KLocale::LongName"
-msgid "Monday"
-msgstr "Ponedjeljak"
-
-#: kcalendarsystemgregorian.cpp:339 kcalendarsystemhebrew.cpp:849
-msgctxt "Gregorian weekday 2 - KLocale::LongName"
-msgid "Tuesday"
-msgstr "Utorak"
-
-#: kcalendarsystemgregorian.cpp:341 kcalendarsystemhebrew.cpp:851
-msgctxt "Gregorian weekday 3 - KLocale::LongName"
-msgid "Wednesday"
-msgstr "Srijeda"
-
-#: kcalendarsystemgregorian.cpp:343 kcalendarsystemhebrew.cpp:853
-msgctxt "Gregorian weekday 4 - KLocale::LongName"
-msgid "Thursday"
-msgstr "Četvrtak"
-
-#: kcalendarsystemgregorian.cpp:345 kcalendarsystemhebrew.cpp:855
-msgctxt "Gregorian weekday 5 - KLocale::LongName"
-msgid "Friday"
-msgstr "Petak"
-
-#: kcalendarsystemgregorian.cpp:347 kcalendarsystemhebrew.cpp:857
-msgctxt "Gregorian weekday 6 - KLocale::LongName"
-msgid "Saturday"
-msgstr "Subota"
-
-#: kcalendarsystemgregorian.cpp:349 kcalendarsystemhebrew.cpp:859
-msgctxt "Gregorian weekday 7 - KLocale::LongName"
-msgid "Sunday"
-msgstr "Nedjelja"
-
-#: kcalendarsystemhebrew.cpp:281
-msgctxt "Calendar Era: Hebrew Era, years > 0, LongFormat"
-msgid "Anno Mundi"
-msgstr "Anno Mundi"
-
-#: kcalendarsystemhebrew.cpp:282
-msgctxt "Calendar Era: Hebrew Era, years > 0, ShortFormat"
-msgid "AM"
-msgstr "AM"
-
-#: kcalendarsystemhebrew.cpp:283
-#, c-format
-msgctxt ""
-"(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM"
-msgid "%Ey %EC"
-msgstr "%Ey %EC"
-
-#: kcalendarsystemhebrew.cpp:625
-msgctxt "Hebrew month 1 - KLocale::NarrowName"
-msgid "T"
-msgstr ""
-
-#: kcalendarsystemhebrew.cpp:627
-#, fuzzy
-#| msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat"
-#| msgid "AH"
-msgctxt "Hebrew month 2 - KLocale::NarrowName"
-msgid "H"
-msgstr "AH"
-
-#: kcalendarsystemhebrew.cpp:629
-msgctxt "Hebrew month 3 - KLocale::NarrowName"
-msgid "K"
-msgstr ""
-
-#: kcalendarsystemhebrew.cpp:631
-msgctxt "Hebrew month 4 - KLocale::NarrowName"
-msgid "T"
-msgstr ""
-
-#: kcalendarsystemhebrew.cpp:633
-#, fuzzy
-#| msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat"
-#| msgid "SE"
-msgctxt "Hebrew month 5 - KLocale::NarrowName"
-msgid "S"
-msgstr "SE"
-
-#: kcalendarsystemhebrew.cpp:635
-#, fuzzy
-#| msgid "Av"
-msgctxt "Hebrew month 6 - KLocale::NarrowName"
-msgid "A"
-msgstr "Av"
-
-#: kcalendarsystemhebrew.cpp:637
-msgctxt "Hebrew month 7 - KLocale::NarrowName"
-msgid "N"
-msgstr ""
-
-#: kcalendarsystemhebrew.cpp:639
-msgctxt "Hebrew month 8 - KLocale::NarrowName"
-msgid "I"
-msgstr ""
-
-#: kcalendarsystemhebrew.cpp:641
-#, fuzzy
-#| msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat"
-#| msgid "SE"
-msgctxt "Hebrew month 9 - KLocale::NarrowName"
-msgid "S"
-msgstr "SE"
-
-#: kcalendarsystemhebrew.cpp:643
-msgctxt "Hebrew month 10 - KLocale::NarrowName"
-msgid "T"
-msgstr ""
-
-#: kcalendarsystemhebrew.cpp:645
-#, fuzzy
-#| msgid "Av"
-msgctxt "Hebrew month 11 - KLocale::NarrowName"
-msgid "A"
-msgstr "Av"
-
-#: kcalendarsystemhebrew.cpp:647
-#, fuzzy
-#| msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat"
-#| msgid "CE"
-msgctxt "Hebrew month 12 - KLocale::NarrowName"
-msgid "E"
-msgstr "CE"
-
-#: kcalendarsystemhebrew.cpp:649
-#, fuzzy
-#| msgid "Av"
-msgctxt "Hebrew month 13 - KLocale::NarrowName"
-msgid "A"
-msgstr "Av"
-
-#: kcalendarsystemhebrew.cpp:651
-#, fuzzy
-#| msgid "Av"
-msgctxt "Hebrew month 14 - KLocale::NarrowName"
-msgid "A"
-msgstr "Av"
-
-#: kcalendarsystemhebrew.cpp:660
-#, fuzzy
-#| msgctxt "of Tir short"
-#| msgid "of Tir"
-msgctxt "Hebrew month 1 - KLocale::ShortName Possessive"
-msgid "of Tis"
-msgstr "od Tir"
-
-#: kcalendarsystemhebrew.cpp:662
-#, fuzzy
-#| msgctxt "Coptic month 6 - ShortNamePossessive"
-#| msgid "of Mes"
-msgctxt "Hebrew month 2 - KLocale::ShortName Possessive"
-msgid "of Hes"
-msgstr "od Mes"
-
-#: kcalendarsystemhebrew.cpp:664
-#, fuzzy
-#| msgctxt "Coptic month 4 - ShortNamePossessive"
-#| msgid "of Kia"
-msgctxt "Hebrew month 3 - KLocale::ShortName Possessive"
-msgid "of Kis"
-msgstr "od Kia"
-
-#: kcalendarsystemhebrew.cpp:666
-#, fuzzy
-#| msgid "of Tevet"
-msgctxt "Hebrew month 4 - KLocale::ShortName Possessive"
-msgid "of Tev"
-msgstr "od Teveta"
-
-#: kcalendarsystemhebrew.cpp:668
-#, fuzzy
-#| msgid "of Shvat"
-msgctxt "Hebrew month 5 - KLocale::ShortName Possessive"
-msgid "of Shv"
-msgstr "od Shvata"
-
-#: kcalendarsystemhebrew.cpp:670
-#, fuzzy
-#| msgid "of Adar"
-msgctxt "Hebrew month 6 - KLocale::ShortName Possessive"
-msgid "of Ada"
-msgstr "od Adara"
-
-#: kcalendarsystemhebrew.cpp:672
-#, fuzzy
-#| msgid "of Nisan"
-msgctxt "Hebrew month 7 - KLocale::ShortName Possessive"
-msgid "of Nis"
-msgstr "od Nisana"
-
-#: kcalendarsystemhebrew.cpp:674
-#, fuzzy
-#| msgid "of Iyar"
-msgctxt "Hebrew month 8 - KLocale::ShortName Possessive"
-msgid "of Iya"
-msgstr "od lyara"
-
-#: kcalendarsystemhebrew.cpp:676
-#, fuzzy
-#| msgid "of Sivan"
-msgctxt "Hebrew month 9 - KLocale::ShortName Possessive"
-msgid "of Siv"
-msgstr "od Sivana"
-
-#: kcalendarsystemhebrew.cpp:678
-#, fuzzy
-#| msgid "of Tamuz"
-msgctxt "Hebrew month 10 - KLocale::ShortName Possessive"
-msgid "of Tam"
-msgstr "od Tamuza"
-
-#: kcalendarsystemhebrew.cpp:680
-#, fuzzy
-#| msgid "of Av"
-msgctxt "Hebrew month 11 - KLocale::ShortName Possessive"
-msgid "of Av"
-msgstr "od Ava"
-
-#: kcalendarsystemhebrew.cpp:682
-#, fuzzy
-#| msgid "of Elul"
-msgctxt "Hebrew month 12 - KLocale::ShortName Possessive"
-msgid "of Elu"
-msgstr "od Elula"
-
-#: kcalendarsystemhebrew.cpp:684
-#, fuzzy
-#| msgid "of Adar"
-msgctxt "Hebrew month 13 - KLocale::ShortName Possessive"
-msgid "of Ad1"
-msgstr "od Adara"
-
-#: kcalendarsystemhebrew.cpp:686
-#, fuzzy
-#| msgid "of Adar"
-msgctxt "Hebrew month 14 - KLocale::ShortName Possessive"
-msgid "of Ad2"
-msgstr "od Adara"
-
-#: kcalendarsystemhebrew.cpp:695
-#, fuzzy
-#| msgctxt "Tir short"
-#| msgid "Tir"
-msgctxt "Hebrew month 1 - KLocale::ShortName"
-msgid "Tis"
-msgstr "Tir"
-
-#: kcalendarsystemhebrew.cpp:697
-#, fuzzy
-#| msgctxt "Coptic month 6 - ShortName"
-#| msgid "Mes"
-msgctxt "Hebrew month 2 - KLocale::ShortName"
-msgid "Hes"
-msgstr "Mes"
-
-#: kcalendarsystemhebrew.cpp:699
-#, fuzzy
-#| msgid "Kislev"
-msgctxt "Hebrew month 3 - KLocale::ShortName"
-msgid "Kis"
-msgstr "Kislev"
-
-#: kcalendarsystemhebrew.cpp:701
-#, fuzzy
-#| msgid "Tevet"
-msgctxt "Hebrew month 4 - KLocale::ShortName"
-msgid "Tev"
-msgstr "Tevet"
-
-#: kcalendarsystemhebrew.cpp:703
-#, fuzzy
-#| msgid "Shvat"
-msgctxt "Hebrew month 5 - KLocale::ShortName"
-msgid "Shv"
-msgstr "Shvat"
-
-#: kcalendarsystemhebrew.cpp:705
-#, fuzzy
-#| msgid "Adar"
-msgctxt "Hebrew month 6 - KLocale::ShortName"
-msgid "Ada"
-msgstr "Adar"
-
-#: kcalendarsystemhebrew.cpp:707
-#, fuzzy
-#| msgid "Nisan"
-msgctxt "Hebrew month 7 - KLocale::ShortName"
-msgid "Nis"
-msgstr "Nisan"
-
-#: kcalendarsystemhebrew.cpp:709
-#, fuzzy
-#| msgid "Iyar"
-msgctxt "Hebrew month 8 - KLocale::ShortName"
-msgid "Iya"
-msgstr "Iyar"
-
-#: kcalendarsystemhebrew.cpp:711
-#, fuzzy
-#| msgid "Sivan"
-msgctxt "Hebrew month 9 - KLocale::ShortName"
-msgid "Siv"
-msgstr "Sivan"
-
-#: kcalendarsystemhebrew.cpp:713
-#, fuzzy
-#| msgid "Tamuz"
-msgctxt "Hebrew month 10 - KLocale::ShortName"
-msgid "Tam"
-msgstr "Tamuz"
-
-#: kcalendarsystemhebrew.cpp:715
-#, fuzzy
-#| msgid "Av"
-msgctxt "Hebrew month 11 - KLocale::ShortName"
-msgid "Av"
-msgstr "Av"
-
-#: kcalendarsystemhebrew.cpp:717
-#, fuzzy
-#| msgid "Elul"
-msgctxt "Hebrew month 12 - KLocale::ShortName"
-msgid "Elu"
-msgstr "Elul"
-
-#: kcalendarsystemhebrew.cpp:719
-#, fuzzy
-#| msgid "Ahd"
-msgctxt "Hebrew month 13 - KLocale::ShortName"
-msgid "Ad1"
-msgstr "Ahd"
-
-#: kcalendarsystemhebrew.cpp:721
-#, fuzzy
-#| msgid "Ahd"
-msgctxt "Hebrew month 14 - KLocale::ShortName"
-msgid "Ad2"
-msgstr "Ahd"
-
-#: kcalendarsystemhebrew.cpp:730
-#, fuzzy
-#| msgid "of Tishrey"
-msgctxt "Hebrew month 1 - KLocale::LongName Possessive"
-msgid "of Tishrey"
-msgstr "od Tishreya"
-
-#: kcalendarsystemhebrew.cpp:732
-#, fuzzy
-#| msgid "of Heshvan"
-msgctxt "Hebrew month 2 - KLocale::LongName Possessive"
-msgid "of Heshvan"
-msgstr "od Heshvana"
-
-#: kcalendarsystemhebrew.cpp:734
-#, fuzzy
-#| msgid "of Kislev"
-msgctxt "Hebrew month 3 - KLocale::LongName Possessive"
-msgid "of Kislev"
-msgstr "od Kisleva"
-
-#: kcalendarsystemhebrew.cpp:736
-#, fuzzy
-#| msgid "of Tevet"
-msgctxt "Hebrew month 4 - KLocale::LongName Possessive"
-msgid "of Tevet"
-msgstr "od Teveta"
-
-#: kcalendarsystemhebrew.cpp:738
-#, fuzzy
-#| msgid "of Shvat"
-msgctxt "Hebrew month 5 - KLocale::LongName Possessive"
-msgid "of Shvat"
-msgstr "od Shvata"
-
-#: kcalendarsystemhebrew.cpp:740
-#, fuzzy
-#| msgid "of Adar"
-msgctxt "Hebrew month 6 - KLocale::LongName Possessive"
-msgid "of Adar"
-msgstr "od Adara"
-
-#: kcalendarsystemhebrew.cpp:742
-#, fuzzy
-#| msgid "of Nisan"
-msgctxt "Hebrew month 7 - KLocale::LongName Possessive"
-msgid "of Nisan"
-msgstr "od Nisana"
-
-#: kcalendarsystemhebrew.cpp:744
-#, fuzzy
-#| msgid "of Iyar"
-msgctxt "Hebrew month 8 - KLocale::LongName Possessive"
-msgid "of Iyar"
-msgstr "od lyara"
-
-#: kcalendarsystemhebrew.cpp:746
-#, fuzzy
-#| msgid "of Sivan"
-msgctxt "Hebrew month 9 - KLocale::LongName Possessive"
-msgid "of Sivan"
-msgstr "od Sivana"
-
-#: kcalendarsystemhebrew.cpp:748
-#, fuzzy
-#| msgid "of Tamuz"
-msgctxt "Hebrew month 10 - KLocale::LongName Possessive"
-msgid "of Tamuz"
-msgstr "od Tamuza"
-
-#: kcalendarsystemhebrew.cpp:750
-#, fuzzy
-#| msgid "of Av"
-msgctxt "Hebrew month 11 - KLocale::LongName Possessive"
-msgid "of Av"
-msgstr "od Ava"
-
-#: kcalendarsystemhebrew.cpp:752
-#, fuzzy
-#| msgid "of Elul"
-msgctxt "Hebrew month 12 - KLocale::LongName Possessive"
-msgid "of Elul"
-msgstr "od Elula"
-
-#: kcalendarsystemhebrew.cpp:754
-#, fuzzy
-#| msgid "of Adar I"
-msgctxt "Hebrew month 13 - KLocale::LongName Possessive"
-msgid "of Adar I"
-msgstr "od Adara I"
-
-#: kcalendarsystemhebrew.cpp:756
-#, fuzzy
-#| msgid "of Adar II"
-msgctxt "Hebrew month 14 - KLocale::LongName Possessive"
-msgid "of Adar II"
-msgstr "od Adara II"
-
-#: kcalendarsystemhebrew.cpp:765
-#, fuzzy
-#| msgid "Tishrey"
-msgctxt "Hebrew month 1 - KLocale::LongName"
-msgid "Tishrey"
-msgstr "Tishrey"
-
-#: kcalendarsystemhebrew.cpp:767
-#, fuzzy
-#| msgid "Heshvan"
-msgctxt "Hebrew month 2 - KLocale::LongName"
-msgid "Heshvan"
-msgstr "Heshvan"
-
-#: kcalendarsystemhebrew.cpp:769
-#, fuzzy
-#| msgid "Kislev"
-msgctxt "Hebrew month 3 - KLocale::LongName"
-msgid "Kislev"
-msgstr "Kislev"
-
-#: kcalendarsystemhebrew.cpp:771
-#, fuzzy
-#| msgid "Tevet"
-msgctxt "Hebrew month 4 - KLocale::LongName"
-msgid "Tevet"
-msgstr "Tevet"
-
-#: kcalendarsystemhebrew.cpp:773
-#, fuzzy
-#| msgid "Shvat"
-msgctxt "Hebrew month 5 - KLocale::LongName"
-msgid "Shvat"
-msgstr "Shvat"
-
-#: kcalendarsystemhebrew.cpp:775
-#, fuzzy
-#| msgid "Adar"
-msgctxt "Hebrew month 6 - KLocale::LongName"
-msgid "Adar"
-msgstr "Adar"
-
-#: kcalendarsystemhebrew.cpp:777
-#, fuzzy
-#| msgid "Nisan"
-msgctxt "Hebrew month 7 - KLocale::LongName"
-msgid "Nisan"
-msgstr "Nisan"
-
-#: kcalendarsystemhebrew.cpp:779
-#, fuzzy
-#| msgid "Iyar"
-msgctxt "Hebrew month 8 - KLocale::LongName"
-msgid "Iyar"
-msgstr "Iyar"
-
-#: kcalendarsystemhebrew.cpp:781
-#, fuzzy
-#| msgid "Sivan"
-msgctxt "Hebrew month 9 - KLocale::LongName"
-msgid "Sivan"
-msgstr "Sivan"
-
-#: kcalendarsystemhebrew.cpp:783
-#, fuzzy
-#| msgid "Tamuz"
-msgctxt "Hebrew month 10 - KLocale::LongName"
-msgid "Tamuz"
-msgstr "Tamuz"
-
-#: kcalendarsystemhebrew.cpp:785
-#, fuzzy
-#| msgid "Av"
-msgctxt "Hebrew month 11 - KLocale::LongName"
-msgid "Av"
-msgstr "Av"
-
-#: kcalendarsystemhebrew.cpp:787
-#, fuzzy
-#| msgid "Elul"
-msgctxt "Hebrew month 12 - KLocale::LongName"
-msgid "Elul"
-msgstr "Elul"
-
-#: kcalendarsystemhebrew.cpp:789
-#, fuzzy
-#| msgid "Adar I"
-msgctxt "Hebrew month 13 - KLocale::LongName"
-msgid "Adar I"
-msgstr "Adar I"
-
-#: kcalendarsystemhebrew.cpp:791
-#, fuzzy
-#| msgid "Adar II"
-msgctxt "Hebrew month 14 - KLocale::LongName"
-msgid "Adar II"
-msgstr "Adar II"
-
-#: kcalendarsystemindiannational.cpp:66
-msgctxt "Calendar Era: Indian National Saka Era, years > 0, LongFormat"
-msgid "Saka Era"
-msgstr "Saka Era"
-
-#: kcalendarsystemindiannational.cpp:67
-msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat"
-msgid "SE"
-msgstr "SE"
-
-#: kcalendarsystemindiannational.cpp:68
-#, c-format
-msgctxt ""
-"(kdedt-format) Indian National, SE, full era year format used for %EY, e.g. "
-"2000 SE"
-msgid "%Ey %EC"
-msgstr "%Ey %EC"
-
-#: kcalendarsystemindiannational.cpp:158
-#, fuzzy
-#| msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat"
-#| msgid "BC"
-msgctxt "Indian National month 1 - KLocale::NarrowName"
-msgid "C"
-msgstr "BC"
-
-#: kcalendarsystemindiannational.cpp:160
-msgctxt "Indian National month 2 - KLocale::NarrowName"
-msgid "V"
-msgstr ""
-
-#: kcalendarsystemindiannational.cpp:162
-msgctxt "Indian National month 3 - KLocale::NarrowName"
-msgid "J"
-msgstr ""
-
-#: kcalendarsystemindiannational.cpp:164
-#, fuzzy
-#| msgctxt "Indian National month 4 - ShortName"
-#| msgid "Āsh"
-msgctxt "Indian National month 4 - KLocale::NarrowName"
-msgid "Ā"
-msgstr "Āsh"
-
-#: kcalendarsystemindiannational.cpp:166
-#, fuzzy
-#| msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat"
-#| msgid "SE"
-msgctxt "Indian National month 5 - KLocale::NarrowName"
-msgid "S"
-msgstr "SE"
-
-#: kcalendarsystemindiannational.cpp:168
-#, fuzzy
-#| msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat"
-#| msgid "BC"
-msgctxt "Indian National month 6 - KLocale::NarrowName"
-msgid "B"
-msgstr "BC"
-
-#: kcalendarsystemindiannational.cpp:170
-#, fuzzy
-#| msgctxt "Indian National month 4 - ShortName"
-#| msgid "Āsh"
-msgctxt "Indian National month 7 - KLocale::NarrowName"
-msgid "Ā"
-msgstr "Āsh"
-
-#: kcalendarsystemindiannational.cpp:172
-msgctxt "Indian National month 8 - KLocale::NarrowName"
-msgid "K"
-msgstr ""
-
-#: kcalendarsystemindiannational.cpp:174
-#, fuzzy
-#| msgid "Av"
-msgctxt "Indian National month 9 - KLocale::NarrowName"
-msgid "A"
-msgstr "Av"
-
-#: kcalendarsystemindiannational.cpp:176
-#, fuzzy
-#| msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat"
-#| msgid "AP"
-msgctxt "Indian National month 10 - KLocale::NarrowName"
-msgid "P"
-msgstr "AP"
-
-#: kcalendarsystemindiannational.cpp:178
-#, fuzzy
-#| msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat"
-#| msgid "AM"
-msgctxt "Indian National month 11 - KLocale::NarrowName"
-msgid "M"
-msgstr "AM"
-
-#: kcalendarsystemindiannational.cpp:180
-#, fuzzy
-#| msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat"
-#| msgid "AP"
-msgctxt "Indian National month 12 - KLocale::NarrowName"
-msgid "P"
-msgstr "AP"
-
-#: kcalendarsystemindiannational.cpp:189
-#, fuzzy
-#| msgctxt "Indian National month 1 - ShortNamePossessive"
-#| msgid "of Cha"
-msgctxt "Indian National month 1 - KLocale::ShortName Possessive"
-msgid "of Cha"
-msgstr "od Cha"
-
-#: kcalendarsystemindiannational.cpp:191
-#, fuzzy
-#| msgctxt "Indian National month 2 - ShortNamePossessive"
-#| msgid "of Vai"
-msgctxt "Indian National month 2 - KLocale::ShortName Possessive"
-msgid "of Vai"
-msgstr "od Vai"
-
-#: kcalendarsystemindiannational.cpp:193
-#, fuzzy
-#| msgctxt "Indian National month 3 - ShortNamePossessive"
-#| msgid "of Jya"
-msgctxt "Indian National month 3 - KLocale::ShortName Possessive"
-msgid "of Jya"
-msgstr "od Jya"
-
-#: kcalendarsystemindiannational.cpp:195
-#, fuzzy
-#| msgctxt "Indian National month 4 - ShortNamePossessive"
-#| msgid "of Āsh"
-msgctxt "Indian National month 4 - KLocale::ShortName Possessive"
-msgid "of Āsh"
-msgstr "od Āsh"
-
-#: kcalendarsystemindiannational.cpp:197
-#, fuzzy
-#| msgctxt "Indian National month 5 - ShortNamePossessive"
-#| msgid "of Shr"
-msgctxt "Indian National month 5 - KLocale::ShortName Possessive"
-msgid "of Shr"
-msgstr "od Shr"
-
-#: kcalendarsystemindiannational.cpp:199
-#, fuzzy
-#| msgctxt "Indian National month 6 - ShortNamePossessive"
-#| msgid "of Bhā"
-msgctxt "Indian National month 6 - KLocale::ShortName Possessive"
-msgid "of Bhā"
-msgstr "od Bhā"
-
-#: kcalendarsystemindiannational.cpp:201
-#, fuzzy
-#| msgctxt "Indian National month 7 - ShortNamePossessive"
-#| msgid "of Āsw"
-msgctxt "Indian National month 7 - KLocale::ShortName Possessive"
-msgid "of Āsw"
-msgstr "od Āsw"
-
-#: kcalendarsystemindiannational.cpp:203
-#, fuzzy
-#| msgctxt "Indian National month 8 - ShortNamePossessive"
-#| msgid "of Kār"
-msgctxt "Indian National month 8 - KLocale::ShortName Possessive"
-msgid "of Kār"
-msgstr "od Kār"
-
-#: kcalendarsystemindiannational.cpp:205
-#, fuzzy
-#| msgctxt "Indian National month 9 - ShortNamePossessive"
-#| msgid "of Agr"
-msgctxt "Indian National month 9 - KLocale::ShortName Possessive"
-msgid "of Agr"
-msgstr "od Agr"
-
-#: kcalendarsystemindiannational.cpp:207
-#, fuzzy
-#| msgctxt "Indian National month 10 - ShortNamePossessive"
-#| msgid "of Pau"
-msgctxt "Indian National month 10 - KLocale::ShortName Possessive"
-msgid "of Pau"
-msgstr "od Pau"
-
-#: kcalendarsystemindiannational.cpp:209
-#, fuzzy
-#| msgctxt "Indian National month 11 - ShortNamePossessive"
-#| msgid "of Māg"
-msgctxt "Indian National month 11 - KLocale::ShortName Possessive"
-msgid "of Māg"
-msgstr "od Māg"
-
-#: kcalendarsystemindiannational.cpp:211
-#, fuzzy
-#| msgctxt "Indian National month 12 - ShortNamePossessive"
-#| msgid "of Phā"
-msgctxt "Indian National month 12 - KLocale::ShortName Possessive"
-msgid "of Phā"
-msgstr "od Phā"
-
-#: kcalendarsystemindiannational.cpp:220
-#, fuzzy
-#| msgctxt "Indian National month 1 - ShortName"
-#| msgid "Cha"
-msgctxt "Indian National month 1 - KLocale::ShortName"
-msgid "Cha"
-msgstr "Cha"
-
-#: kcalendarsystemindiannational.cpp:222
-#, fuzzy
-#| msgctxt "Indian National month 2 - ShortName"
-#| msgid "Vai"
-msgctxt "Indian National month 2 - KLocale::ShortName"
-msgid "Vai"
-msgstr "Vai"
-
-#: kcalendarsystemindiannational.cpp:224
-#, fuzzy
-#| msgctxt "Indian National month 3 - ShortName"
-#| msgid "Jya"
-msgctxt "Indian National month 3 - KLocale::ShortName"
-msgid "Jya"
-msgstr "Jya"
-
-#: kcalendarsystemindiannational.cpp:226
-#, fuzzy
-#| msgctxt "Indian National month 4 - ShortName"
-#| msgid "Āsh"
-msgctxt "Indian National month 4 - KLocale::ShortName"
-msgid "Āsh"
-msgstr "Āsh"
-
-#: kcalendarsystemindiannational.cpp:228
-#, fuzzy
-#| msgctxt "Indian National month 5 - ShortName"
-#| msgid "Shr"
-msgctxt "Indian National month 5 - KLocale::ShortName"
-msgid "Shr"
-msgstr "Shr"
-
-#: kcalendarsystemindiannational.cpp:230
-#, fuzzy
-#| msgctxt "Indian National month 6 - ShortName"
-#| msgid "Bhā"
-msgctxt "Indian National month 6 - KLocale::ShortName"
-msgid "Bhā"
-msgstr "Bhā"
-
-#: kcalendarsystemindiannational.cpp:232
-#, fuzzy
-#| msgctxt "Indian National month 7 - ShortName"
-#| msgid "Āsw"
-msgctxt "Indian National month 7 - KLocale::ShortName"
-msgid "Āsw"
-msgstr "Āsw"
-
-#: kcalendarsystemindiannational.cpp:234
-#, fuzzy
-#| msgctxt "Indian National month 8 - ShortName"
-#| msgid "Kār"
-msgctxt "Indian National month 8 - KLocale::ShortName"
-msgid "Kār"
-msgstr "Kār"
-
-#: kcalendarsystemindiannational.cpp:236
-#, fuzzy
-#| msgctxt "Indian National month 9 - ShortName"
-#| msgid "Agr"
-msgctxt "Indian National month 9 - KLocale::ShortName"
-msgid "Agr"
-msgstr "Agr"
-
-#: kcalendarsystemindiannational.cpp:238
-#, fuzzy
-#| msgctxt "Indian National month 10 - ShortName"
-#| msgid "Pau"
-msgctxt "Indian National month 10 - KLocale::ShortName"
-msgid "Pau"
-msgstr "Pau"
-
-#: kcalendarsystemindiannational.cpp:240
-#, fuzzy
-#| msgctxt "Indian National month 11 - ShortName"
-#| msgid "Māg"
-msgctxt "Indian National month 11 - KLocale::ShortName"
-msgid "Māg"
-msgstr "Māg"
-
-#: kcalendarsystemindiannational.cpp:242
-#, fuzzy
-#| msgctxt "Indian National month 12 - ShortName"
-#| msgid "Phā"
-msgctxt "Indian National month 12 - KLocale::ShortName"
-msgid "Phā"
-msgstr "Phā"
-
-#: kcalendarsystemindiannational.cpp:251
-#, fuzzy
-#| msgctxt "Indian National month 1 - LongNamePossessive"
-#| msgid "of Chaitra"
-msgctxt "Indian National month 1 - KLocale::LongName Possessive"
-msgid "of Chaitra"
-msgstr "od Chaitra"
-
-#: kcalendarsystemindiannational.cpp:253
-#, fuzzy
-#| msgctxt "Indian National month 2 - LongNamePossessive"
-#| msgid "of Vaishākh"
-msgctxt "Indian National month 2 - KLocale::LongName Possessive"
-msgid "of Vaishākh"
-msgstr "od Vaishākha"
-
-#: kcalendarsystemindiannational.cpp:255
-#, fuzzy
-#| msgctxt "Indian National month 3 - LongNamePossessive"
-#| msgid "of Jyaishtha"
-msgctxt "Indian National month 3 - KLocale::LongName Possessive"
-msgid "of Jyaishtha"
-msgstr "od Jyaishtha"
-
-#: kcalendarsystemindiannational.cpp:257
-#, fuzzy
-#| msgctxt "Indian National month 4 - LongNamePossessive"
-#| msgid "of Āshādha"
-msgctxt "Indian National month 4 - KLocale::LongName Possessive"
-msgid "of Āshādha"
-msgstr "od Āshādha"
-
-#: kcalendarsystemindiannational.cpp:259
-#, fuzzy
-#| msgctxt "Indian National month 5 - LongNamePossessive"
-#| msgid "of Shrāvana"
-msgctxt "Indian National month 5 - KLocale::LongName Possessive"
-msgid "of Shrāvana"
-msgstr "od Shrāvana"
-
-#: kcalendarsystemindiannational.cpp:261
-#, fuzzy
-#| msgctxt "Indian National month 6 - LongNamePossessive"
-#| msgid "of Bhādrapad"
-msgctxt "Indian National month 6 - KLocale::LongName Possessive"
-msgid "of Bhādrapad"
-msgstr "od Bhādrapad"
-
-#: kcalendarsystemindiannational.cpp:263
-#, fuzzy
-#| msgctxt "Indian National month 7 - LongNamePossessive"
-#| msgid "of Āshwin"
-msgctxt "Indian National month 7 - KLocale::LongName Possessive"
-msgid "of Āshwin"
-msgstr "od Āshwina"
-
-#: kcalendarsystemindiannational.cpp:265
-#, fuzzy
-#| msgctxt "Indian National month 8 - LongNamePossessive"
-#| msgid "of Kārtik"
-msgctxt "Indian National month 8 - KLocale::LongName Possessive"
-msgid "of Kārtik"
-msgstr "od Kārtika"
-
-#: kcalendarsystemindiannational.cpp:267
-#, fuzzy
-#| msgctxt "Indian National month 9 - LongNamePossessive"
-#| msgid "of Agrahayana"
-msgctxt "Indian National month 9 - KLocale::LongName Possessive"
-msgid "of Agrahayana"
-msgstr "od Agrahayana"
-
-#: kcalendarsystemindiannational.cpp:269
-#, fuzzy
-#| msgctxt "Indian National month 10 - LongNamePossessive"
-#| msgid "of Paush"
-msgctxt "Indian National month 10 - KLocale::LongName Possessive"
-msgid "of Paush"
-msgstr "od Pausha"
-
-#: kcalendarsystemindiannational.cpp:271
-#, fuzzy
-#| msgctxt "Indian National month 11 - LongNamePossessive"
-#| msgid "of Māgh"
-msgctxt "Indian National month 11 - KLocale::LongName Possessive"
-msgid "of Māgh"
-msgstr "od Māgha"
-
-#: kcalendarsystemindiannational.cpp:273
-#, fuzzy
-#| msgctxt "Indian National month 12 - LongNamePossessive"
-#| msgid "of Phālgun"
-msgctxt "Indian National month 12 - KLocale::LongName Possessive"
-msgid "of Phālgun"
-msgstr "od Phālguna"
-
-#: kcalendarsystemindiannational.cpp:282
-#, fuzzy
-#| msgctxt "Indian National month 1 - LongName"
-#| msgid "Chaitra"
-msgctxt "Indian National month 1 - KLocale::LongName"
-msgid "Chaitra"
-msgstr "Chaitra"
-
-#: kcalendarsystemindiannational.cpp:284
-#, fuzzy
-#| msgctxt "Indian National month 2 - LongName"
-#| msgid "Vaishākh"
-msgctxt "Indian National month 2 - KLocale::LongName"
-msgid "Vaishākh"
-msgstr "Vaishākh"
-
-#: kcalendarsystemindiannational.cpp:286
-#, fuzzy
-#| msgctxt "Indian National month 3 - LongName"
-#| msgid "Jyaishtha"
-msgctxt "Indian National month 3 - KLocale::LongName"
-msgid "Jyaishtha"
-msgstr "Jyaishtha"
-
-#: kcalendarsystemindiannational.cpp:288
-#, fuzzy
-#| msgctxt "Indian National month 4 - LongName"
-#| msgid "Āshādha"
-msgctxt "Indian National month 4 - KLocale::LongName"
-msgid "Āshādha"
-msgstr "Āshādha"
-
-#: kcalendarsystemindiannational.cpp:290
-#, fuzzy
-#| msgctxt "Indian National month 5 - LongName"
-#| msgid "Shrāvana"
-msgctxt "Indian National month 5 - KLocale::LongName"
-msgid "Shrāvana"
-msgstr "Shrāvana"
-
-#: kcalendarsystemindiannational.cpp:292
-#, fuzzy
-#| msgctxt "Indian National month 6 - LongName"
-#| msgid "Bhādrapad"
-msgctxt "Indian National month 6 - KLocale::LongName"
-msgid "Bhādrapad"
-msgstr "Bhādrapad"
-
-#: kcalendarsystemindiannational.cpp:294
-#, fuzzy
-#| msgctxt "Indian National month 7 - LongName"
-#| msgid "Āshwin"
-msgctxt "Indian National month 7 - KLocale::LongName"
-msgid "Āshwin"
-msgstr "Āshwin"
-
-#: kcalendarsystemindiannational.cpp:296
-#, fuzzy
-#| msgctxt "Indian National month 8 - LongName"
-#| msgid "Kārtik"
-msgctxt "Indian National month 8 - KLocale::LongName"
-msgid "Kārtik"
-msgstr "Kārtik"
-
-#: kcalendarsystemindiannational.cpp:298
-#, fuzzy
-#| msgctxt "Indian National month 9 - LongName"
-#| msgid "Agrahayana"
-msgctxt "Indian National month 9 - KLocale::LongName"
-msgid "Agrahayana"
-msgstr "Agrahayana"
-
-#: kcalendarsystemindiannational.cpp:300
-#, fuzzy
-#| msgctxt "Indian National month 10 - LongName"
-#| msgid "Paush"
-msgctxt "Indian National month 10 - KLocale::LongName"
-msgid "Paush"
-msgstr "Paush"
-
-#: kcalendarsystemindiannational.cpp:302
-#, fuzzy
-#| msgctxt "Indian National month 11 - LongName"
-#| msgid "Māgh"
-msgctxt "Indian National month 11 - KLocale::LongName"
-msgid "Māgh"
-msgstr "Māgh"
-
-#: kcalendarsystemindiannational.cpp:304
-#, fuzzy
-#| msgctxt "Indian National month 12 - LongName"
-#| msgid "Phālgun"
-msgctxt "Indian National month 12 - KLocale::LongName"
-msgid "Phālgun"
-msgstr "Phālgun"
-
-#: kcalendarsystemindiannational.cpp:317
-#, fuzzy
-#| msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat"
-#| msgid "SE"
-msgctxt "Indian National weekday 1 - KLocale::NarrowName "
-msgid "S"
-msgstr "SE"
-
-#: kcalendarsystemindiannational.cpp:319
-#, fuzzy
-#| msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat"
-#| msgid "AM"
-msgctxt "Indian National weekday 2 - KLocale::NarrowName "
-msgid "M"
-msgstr "AM"
-
-#: kcalendarsystemindiannational.cpp:321
-#, fuzzy
-#| msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat"
-#| msgid "BC"
-msgctxt "Indian National weekday 3 - KLocale::NarrowName "
-msgid "B"
-msgstr "BC"
-
-#: kcalendarsystemindiannational.cpp:323
-msgctxt "Indian National weekday 4 - KLocale::NarrowName "
-msgid "G"
-msgstr ""
-
-#: kcalendarsystemindiannational.cpp:325
-#, fuzzy
-#| msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat"
-#| msgid "SE"
-msgctxt "Indian National weekday 5 - KLocale::NarrowName "
-msgid "S"
-msgstr "SE"
-
-#: kcalendarsystemindiannational.cpp:327
-#, fuzzy
-#| msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat"
-#| msgid "SE"
-msgctxt "Indian National weekday 6 - KLocale::NarrowName "
-msgid "S"
-msgstr "SE"
-
-#: kcalendarsystemindiannational.cpp:329
-msgctxt "Indian National weekday 7 - KLocale::NarrowName "
-msgid "R"
-msgstr ""
-
-#: kcalendarsystemindiannational.cpp:338
-#, fuzzy
-#| msgctxt "Indian National weekday 1 - ShortDayName"
-#| msgid "Som"
-msgctxt "Indian National weekday 1 - KLocale::ShortName"
-msgid "Som"
-msgstr "Som"
-
-#: kcalendarsystemindiannational.cpp:340
-#, fuzzy
-#| msgctxt "Indian National weekday 2 - ShortDayName"
-#| msgid "Mañ"
-msgctxt "Indian National weekday 2 - KLocale::ShortName"
-msgid "Mañ"
-msgstr "Mañ"
-
-#: kcalendarsystemindiannational.cpp:342
-#, fuzzy
-#| msgctxt "Indian National weekday 3 - ShortDayName"
-#| msgid "Bud"
-msgctxt "Indian National weekday 3 - KLocale::ShortName"
-msgid "Bud"
-msgstr "Bud"
-
-#: kcalendarsystemindiannational.cpp:344
-#, fuzzy
-#| msgctxt "Indian National weekday 4 - ShortDayName"
-#| msgid "Gur"
-msgctxt "Indian National weekday 4 - KLocale::ShortName"
-msgid "Gur"
-msgstr "Gur"
-
-#: kcalendarsystemindiannational.cpp:346
-#, fuzzy
-#| msgctxt "Indian National weekday 5 - ShortDayName"
-#| msgid "Suk"
-msgctxt "Indian National weekday 5 - KLocale::ShortName"
-msgid "Suk"
-msgstr "Suk"
-
-#: kcalendarsystemindiannational.cpp:348
-#, fuzzy
-#| msgctxt "Indian National weekday 6 - ShortDayName"
-#| msgid "San"
-msgctxt "Indian National weekday 6 - KLocale::ShortName"
-msgid "San"
-msgstr "San"
-
-#: kcalendarsystemindiannational.cpp:350
-#, fuzzy
-#| msgctxt "Indian National weekday 7 - ShortDayName"
-#| msgid "Rav"
-msgctxt "Indian National weekday 7 - KLocale::ShortName"
-msgid "Rav"
-msgstr "Rav"
-
-#: kcalendarsystemindiannational.cpp:357
-#, fuzzy
-#| msgctxt "Indian National weekday 1 - LongDayName"
-#| msgid "Somavãra"
-msgctxt "Indian National weekday 1 - KLocale::LongName"
-msgid "Somavãra"
-msgstr "Somavãra"
-
-#: kcalendarsystemindiannational.cpp:359
-#, fuzzy
-#| msgctxt "Indian National weekday 2 - LongDayName"
-#| msgid "Mañgalvã"
-msgctxt "Indian National weekday 2 - KLocale::LongName"
-msgid "Mañgalvã"
-msgstr "Mañgalvã"
-
-#: kcalendarsystemindiannational.cpp:361
-#, fuzzy
-#| msgctxt "Indian National weekday 3 - LongDayName"
-#| msgid "Budhavãra"
-msgctxt "Indian National weekday 3 - KLocale::LongName"
-msgid "Budhavãra"
-msgstr "Budhavãra"
-
-#: kcalendarsystemindiannational.cpp:363
-#, fuzzy
-#| msgctxt "Indian National weekday 4 - LongDayName"
-#| msgid "Guruvãra"
-msgctxt "Indian National weekday 4 - KLocale::LongName"
-msgid "Guruvãra"
-msgstr "Guruvãra"
-
-#: kcalendarsystemindiannational.cpp:365
-#, fuzzy
-#| msgctxt "Indian National weekday 5 - LongDayName"
-#| msgid "Sukravãra"
-msgctxt "Indian National weekday 5 - KLocale::LongName"
-msgid "Sukravãra"
-msgstr "Sukravãra"
-
-#: kcalendarsystemindiannational.cpp:367
-#, fuzzy
-#| msgctxt "Indian National weekday 6 - LongDayName"
-#| msgid "Sanivãra"
-msgctxt "Indian National weekday 6 - KLocale::LongName"
-msgid "Sanivãra"
-msgstr "Sanivãra"
-
-#: kcalendarsystemindiannational.cpp:369
-#, fuzzy
-#| msgctxt "Indian National weekday 7 - LongDayName"
-#| msgid "Raviãra"
-msgctxt "Indian National weekday 7 - KLocale::LongName"
-msgid "Raviãra"
-msgstr "Raviãra"
-
-#: kcalendarsystemislamiccivil.cpp:66
-msgctxt "Calendar Era: Hijri Islamic Era, years > 0, LongFormat"
-msgid "Anno Hegirae"
-msgstr "Anno Hegirae"
-
-#: kcalendarsystemislamiccivil.cpp:67
-msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat"
-msgid "AH"
-msgstr "AH"
-
-#: kcalendarsystemislamiccivil.cpp:68
-#, c-format
-msgctxt ""
-"(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH"
-msgid "%Ey %EC"
-msgstr "%Ey %EC"
-
-#: kcalendarsystemislamiccivil.cpp:166
-#, fuzzy
-#| msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat"
-#| msgid "AM"
-msgctxt "Hijri month 1 - KLocale::NarrowName"
-msgid "M"
-msgstr "AM"
-
-#: kcalendarsystemislamiccivil.cpp:168
-#, fuzzy
-#| msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat"
-#| msgid "SE"
-msgctxt "Hijri month 2 - KLocale::NarrowName"
-msgid "S"
-msgstr "SE"
-
-#: kcalendarsystemislamiccivil.cpp:170
-#, fuzzy
-#| msgid "Av"
-msgctxt "Hijri month 3 - KLocale::NarrowName"
-msgid "A"
-msgstr "Av"
-
-#: kcalendarsystemislamiccivil.cpp:172
-msgctxt "Hijri month 4 - KLocale::NarrowName"
-msgid "T"
-msgstr ""
-
-#: kcalendarsystemislamiccivil.cpp:174
-#, fuzzy
-#| msgid "Av"
-msgctxt "Hijri month 5 - KLocale::NarrowName"
-msgid "A"
-msgstr "Av"
-
-#: kcalendarsystemislamiccivil.cpp:176
-msgctxt "Hijri month 6 - KLocale::NarrowName"
-msgid "T"
-msgstr ""
-
-#: kcalendarsystemislamiccivil.cpp:178
-msgctxt "Hijri month 7 - KLocale::NarrowName"
-msgid "R"
-msgstr ""
-
-#: kcalendarsystemislamiccivil.cpp:180
-#, fuzzy
-#| msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat"
-#| msgid "SE"
-msgctxt "Hijri month 8 - KLocale::NarrowName"
-msgid "S"
-msgstr "SE"
-
-#: kcalendarsystemislamiccivil.cpp:182
-msgctxt "Hijri month 9 - KLocale::NarrowName"
-msgid "R"
-msgstr ""
-
-#: kcalendarsystemislamiccivil.cpp:184
-#, fuzzy
-#| msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat"
-#| msgid "SE"
-msgctxt "Hijri month 10 - KLocale::NarrowName"
-msgid "S"
-msgstr "SE"
-
-#: kcalendarsystemislamiccivil.cpp:186
-msgctxt "Hijri month 11 - KLocale::NarrowName"
-msgid "Q"
-msgstr ""
-
-#: kcalendarsystemislamiccivil.cpp:188
-#, fuzzy
-#| msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat"
-#| msgid "AH"
-msgctxt "Hijri month 12 - KLocale::NarrowName"
-msgid "H"
-msgstr "AH"
-
-#: kcalendarsystemislamiccivil.cpp:197
-#, fuzzy
-#| msgctxt "of Mehr short"
-#| msgid "of Meh"
-msgctxt "Hijri month 1 - KLocale::ShortName Possessive"
-msgid "of Muh"
-msgstr "od Meh"
-
-#: kcalendarsystemislamiccivil.cpp:199
-#, fuzzy
-#| msgid "of Safar"
-msgctxt "Hijri month 2 - KLocale::ShortName Possessive"
-msgid "of Saf"
-msgstr "od Safara"
-
-#: kcalendarsystemislamiccivil.cpp:201
-#, fuzzy
-#| msgid "of R. Awal"
-msgctxt "Hijri month 3 - KLocale::ShortName Possessive"
-msgid "of R.A"
-msgstr "od R. Awala"
-
-#: kcalendarsystemislamiccivil.cpp:203
-#, fuzzy
-#| msgid "of R. Thaani"
-msgctxt "Hijri month 4 - KLocale::ShortName Possessive"
-msgid "of R.T"
-msgstr "od R. Thaania"
-
-#: kcalendarsystemislamiccivil.cpp:205
-#, fuzzy
-#| msgid "of J. Awal"
-msgctxt "Hijri month 5 - KLocale::ShortName Possessive"
-msgid "of J.A"
-msgstr "od J. Awala"
-
-#: kcalendarsystemislamiccivil.cpp:207
-#, fuzzy
-#| msgid "of J. Thaani"
-msgctxt "Hijri month 6 - KLocale::ShortName Possessive"
-msgid "of J.T"
-msgstr "od J. Thaania"
-
-#: kcalendarsystemislamiccivil.cpp:209
-#, fuzzy
-#| msgid "of Rajab"
-msgctxt "Hijri month 7 - KLocale::ShortName Possessive"
-msgid "of Raj"
-msgstr "od Rajaba"
-
-#: kcalendarsystemislamiccivil.cpp:211
-#, fuzzy
-#| msgctxt "of Shahrivar short"
-#| msgid "of Sha"
-msgctxt "Hijri month 8 - KLocale::ShortName Possessive"
-msgid "of Sha"
-msgstr "od Sha"
-
-#: kcalendarsystemislamiccivil.cpp:213
-#, fuzzy
-#| msgctxt "Coptic month 8 - ShortNamePossessive"
-#| msgid "of Pam"
-msgctxt "Hijri month 9 - KLocale::ShortName Possessive"
-msgid "of Ram"
-msgstr "od Pam"
-
-#: kcalendarsystemislamiccivil.cpp:215
-#, fuzzy
-#| msgctxt "of Shahrivar short"
-#| msgid "of Sha"
-msgctxt "Hijri month 10 - KLocale::ShortName Possessive"
-msgid "of Shw"
-msgstr "od Sha"
-
-#: kcalendarsystemislamiccivil.cpp:217
-#, fuzzy
-#| msgid "of Qi`dah"
-msgctxt "Hijri month 11 - KLocale::ShortName Possessive"
-msgid "of Qid"
-msgstr "od Qi`daha"
-
-#: kcalendarsystemislamiccivil.cpp:219
-#, fuzzy
-#| msgid "of Hijjah"
-msgctxt "Hijri month 12 - KLocale::ShortName Possessive"
-msgid "of Hij"
-msgstr "od Hijjaha"
-
-#: kcalendarsystemislamiccivil.cpp:228
-#, fuzzy
-#| msgctxt "Mehr short"
-#| msgid "Meh"
-msgctxt "Hijri month 1 - KLocale::ShortName"
-msgid "Muh"
-msgstr "Meh"
-
-#: kcalendarsystemislamiccivil.cpp:230
-#, fuzzy
-#| msgid "Safar"
-msgctxt "Hijri month 2 - KLocale::ShortName"
-msgid "Saf"
-msgstr "Safar"
-
-#: kcalendarsystemislamiccivil.cpp:232
-#, fuzzy
-#| msgid "R. Awal"
-msgctxt "Hijri month 3 - KLocale::ShortName"
-msgid "R.A"
-msgstr "R. Awal"
-
-#: kcalendarsystemislamiccivil.cpp:234
-msgctxt "Hijri month 4 - KLocale::ShortName"
-msgid "R.T"
-msgstr ""
-
-#: kcalendarsystemislamiccivil.cpp:236
-#, fuzzy
-#| msgid "J. Awal"
-msgctxt "Hijri month 5 - KLocale::ShortName"
-msgid "J.A"
-msgstr "J. Awal"
-
-#: kcalendarsystemislamiccivil.cpp:238
-msgctxt "Hijri month 6 - KLocale::ShortName"
-msgid "J.T"
-msgstr ""
-
-#: kcalendarsystemislamiccivil.cpp:240
-#, fuzzy
-#| msgid "Rajab"
-msgctxt "Hijri month 7 - KLocale::ShortName"
-msgid "Raj"
-msgstr "Rajab"
-
-#: kcalendarsystemislamiccivil.cpp:242
-#, fuzzy
-#| msgctxt "Shahrivar short"
-#| msgid "Sha"
-msgctxt "Hijri month 8 - KLocale::ShortName"
-msgid "Sha"
-msgstr "Sha"
-
-#: kcalendarsystemislamiccivil.cpp:244
-#, fuzzy
-#| msgctxt "Coptic month 8 - ShortName"
-#| msgid "Pam"
-msgctxt "Hijri month 9 - KLocale::ShortName"
-msgid "Ram"
-msgstr "Pam"
-
-#: kcalendarsystemislamiccivil.cpp:246
-#, fuzzy
-#| msgctxt "Shahrivar short"
-#| msgid "Sha"
-msgctxt "Hijri month 10 - KLocale::ShortName"
-msgid "Shw"
-msgstr "Sha"
-
-#: kcalendarsystemislamiccivil.cpp:248
-#, fuzzy
-#| msgid "Qi`dah"
-msgctxt "Hijri month 11 - KLocale::ShortName"
-msgid "Qid"
-msgstr "Qi`dah"
-
-#: kcalendarsystemislamiccivil.cpp:250
-#, fuzzy
-#| msgctxt "@item Calendar system"
-#| msgid "Hijri"
-msgctxt "Hijri month 12 - KLocale::ShortName"
-msgid "Hij"
-msgstr "Hijri"
-
-#: kcalendarsystemislamiccivil.cpp:259
-#, fuzzy
-#| msgid "of Muharram"
-msgctxt "Hijri month 1 - KLocale::LongName Possessive"
-msgid "of Muharram"
-msgstr "od Muharrama"
-
-#: kcalendarsystemislamiccivil.cpp:261
-#, fuzzy
-#| msgid "of Safar"
-msgctxt "Hijri month 2 - KLocale::LongName Possessive"
-msgid "of Safar"
-msgstr "od Safara"
-
-#: kcalendarsystemislamiccivil.cpp:263
-#, fuzzy
-#| msgid "of Rabi` al-Awal"
-msgctxt "Hijri month 3 - KLocale::LongName Possessive"
-msgid "of Rabi` al-Awal"
-msgstr "od Rabi` al-Awala"
-
-#: kcalendarsystemislamiccivil.cpp:265
-#, fuzzy
-#| msgid "of Rabi` al-Thaani"
-msgctxt "Hijri month 4 - KLocale::LongName Possessive"
-msgid "of Rabi` al-Thaani"
-msgstr "od Rabi` al-Thaania"
-
-#: kcalendarsystemislamiccivil.cpp:267
-#, fuzzy
-#| msgid "of Jumaada al-Awal"
-msgctxt "Hijri month 5 - KLocale::LongName Possessive"
-msgid "of Jumaada al-Awal"
-msgstr "od Jumaada al-Awala"
-
-#: kcalendarsystemislamiccivil.cpp:269
-#, fuzzy
-#| msgid "of Jumaada al-Thaani"
-msgctxt "Hijri month 6 - KLocale::LongName Possessive"
-msgid "of Jumaada al-Thaani"
-msgstr "od Jumaada al-Thaania"
-
-#: kcalendarsystemislamiccivil.cpp:271
-#, fuzzy
-#| msgid "of Rajab"
-msgctxt "Hijri month 7 - KLocale::LongName Possessive"
-msgid "of Rajab"
-msgstr "od Rajaba"
-
-#: kcalendarsystemislamiccivil.cpp:273
-#, fuzzy
-#| msgid "of Sha`ban"
-msgctxt "Hijri month 8 - KLocale::LongName Possessive"
-msgid "of Sha`ban"
-msgstr "od Sha`bana"
-
-#: kcalendarsystemislamiccivil.cpp:275
-#, fuzzy
-#| msgid "of Ramadan"
-msgctxt "Hijri month 9 - KLocale::LongName Possessive"
-msgid "of Ramadan"
-msgstr "od Ramadana"
-
-#: kcalendarsystemislamiccivil.cpp:277
-#, fuzzy
-#| msgid "of Shawwal"
-msgctxt "Hijri month 10 - KLocale::LongName Possessive"
-msgid "of Shawwal"
-msgstr "od Shawwala"
-
-#: kcalendarsystemislamiccivil.cpp:279
-#, fuzzy
-#| msgid "of Thu al-Qi`dah"
-msgctxt "Hijri month 11 - KLocale::LongName Possessive"
-msgid "of Thu al-Qi`dah"
-msgstr "od Thu al-Qi`daha"
-
-#: kcalendarsystemislamiccivil.cpp:281
-#, fuzzy
-#| msgid "of Thu al-Hijjah"
-msgctxt "Hijri month 12 - KLocale::LongName Possessive"
-msgid "of Thu al-Hijjah"
-msgstr "od Thu al-Hijjaha"
-
-#: kcalendarsystemislamiccivil.cpp:290
-#, fuzzy
-#| msgid "Muharram"
-msgctxt "Hijri month 1 - KLocale::LongName"
-msgid "Muharram"
-msgstr "Muharram"
-
-#: kcalendarsystemislamiccivil.cpp:292
-#, fuzzy
-#| msgid "Safar"
-msgctxt "Hijri month 2 - KLocale::LongName"
-msgid "Safar"
-msgstr "Safar"
-
-#: kcalendarsystemislamiccivil.cpp:294
-#, fuzzy
-#| msgid "Rabi` al-Awal"
-msgctxt "Hijri month 3 - KLocale::LongName"
-msgid "Rabi` al-Awal"
-msgstr "Rabi` al-Awal"
-
-#: kcalendarsystemislamiccivil.cpp:296
-#, fuzzy
-#| msgid "Rabi` al-Thaani"
-msgctxt "Hijri month 4 - KLocale::LongName"
-msgid "Rabi` al-Thaani"
-msgstr "Rabi` al-Thaani"
-
-#: kcalendarsystemislamiccivil.cpp:298
-#, fuzzy
-#| msgid "Jumaada al-Awal"
-msgctxt "Hijri month 5 - KLocale::LongName"
-msgid "Jumaada al-Awal"
-msgstr "Jumaada al-Awal"
-
-#: kcalendarsystemislamiccivil.cpp:300
-#, fuzzy
-#| msgid "Jumaada al-Thaani"
-msgctxt "Hijri month 6 - KLocale::LongName"
-msgid "Jumaada al-Thaani"
-msgstr "Jumaada al-Thaani"
-
-#: kcalendarsystemislamiccivil.cpp:302
-#, fuzzy
-#| msgid "Rajab"
-msgctxt "Hijri month 7 - KLocale::LongName"
-msgid "Rajab"
-msgstr "Rajab"
-
-#: kcalendarsystemislamiccivil.cpp:304
-#, fuzzy
-#| msgid "Sha`ban"
-msgctxt "Hijri month 8 - KLocale::LongName"
-msgid "Sha`ban"
-msgstr "Sha`ban"
-
-#: kcalendarsystemislamiccivil.cpp:306
-#, fuzzy
-#| msgid "Ramadan"
-msgctxt "Hijri month 9 - KLocale::LongName"
-msgid "Ramadan"
-msgstr "Ramadan"
-
-#: kcalendarsystemislamiccivil.cpp:308
-#, fuzzy
-#| msgid "Shawwal"
-msgctxt "Hijri month 10 - KLocale::LongName"
-msgid "Shawwal"
-msgstr "Sha`ban"
-
-#: kcalendarsystemislamiccivil.cpp:310
-#, fuzzy
-#| msgid "Thu al-Qi`dah"
-msgctxt "Hijri month 11 - KLocale::LongName"
-msgid "Thu al-Qi`dah"
-msgstr "Thu al-Qi`dah"
-
-#: kcalendarsystemislamiccivil.cpp:312
-#, fuzzy
-#| msgid "Thu al-Hijjah"
-msgctxt "Hijri month 12 - KLocale::LongName"
-msgid "Thu al-Hijjah"
-msgstr "Thu al-Hijjah"
-
-#: kcalendarsystemislamiccivil.cpp:325
-msgctxt "Hijri weekday 1 - KLocale::NarrowName "
-msgid "I"
-msgstr ""
-
-#: kcalendarsystemislamiccivil.cpp:327
-msgctxt "Hijri weekday 2 - KLocale::NarrowName "
-msgid "T"
-msgstr ""
-
-#: kcalendarsystemislamiccivil.cpp:329
-#, fuzzy
-#| msgid "Av"
-msgctxt "Hijri weekday 3 - KLocale::NarrowName "
-msgid "A"
-msgstr "Av"
-
-#: kcalendarsystemislamiccivil.cpp:331
-msgctxt "Hijri weekday 4 - KLocale::NarrowName "
-msgid "K"
-msgstr ""
-
-#: kcalendarsystemislamiccivil.cpp:333
-msgctxt "Hijri weekday 5 - KLocale::NarrowName "
-msgid "J"
-msgstr ""
-
-#: kcalendarsystemislamiccivil.cpp:335
-#, fuzzy
-#| msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat"
-#| msgid "SE"
-msgctxt "Hijri weekday 6 - KLocale::NarrowName "
-msgid "S"
-msgstr "SE"
-
-#: kcalendarsystemislamiccivil.cpp:337
-#, fuzzy
-#| msgid "Av"
-msgctxt "Hijri weekday 7 - KLocale::NarrowName "
-msgid "A"
-msgstr "Av"
-
-#: kcalendarsystemislamiccivil.cpp:346
-#, fuzzy
-#| msgid "Ith"
-msgctxt "Hijri weekday 1 - KLocale::ShortName"
-msgid "Ith"
-msgstr "Ith"
-
-#: kcalendarsystemislamiccivil.cpp:348
-#, fuzzy
-#| msgid "Thl"
-msgctxt "Hijri weekday 2 - KLocale::ShortName"
-msgid "Thl"
-msgstr "Thl"
-
-#: kcalendarsystemislamiccivil.cpp:350
-#, fuzzy
-#| msgid "Arb"
-msgctxt "Hijri weekday 3 - KLocale::ShortName"
-msgid "Arb"
-msgstr "Arb"
-
-#: kcalendarsystemislamiccivil.cpp:352
-#, fuzzy
-#| msgid "Kha"
-msgctxt "Hijri weekday 4 - KLocale::ShortName"
-msgid "Kha"
-msgstr "Kha"
-
-#: kcalendarsystemislamiccivil.cpp:354
-#, fuzzy
-#| msgid "Jum"
-msgctxt "Hijri weekday 5 - KLocale::ShortName"
-msgid "Jum"
-msgstr "Jum"
-
-#: kcalendarsystemislamiccivil.cpp:356
-#, fuzzy
-#| msgid "Sab"
-msgctxt "Hijri weekday 6 - KLocale::ShortName"
-msgid "Sab"
-msgstr "Sab"
-
-#: kcalendarsystemislamiccivil.cpp:358
-#, fuzzy
-#| msgid "Ahd"
-msgctxt "Hijri weekday 7 - KLocale::ShortName"
-msgid "Ahd"
-msgstr "Ahd"
-
-#: kcalendarsystemislamiccivil.cpp:365
-#, fuzzy
-#| msgid "Yaum al-Ithnain"
-msgctxt "Hijri weekday 1 - KLocale::LongName"
-msgid "Yaum al-Ithnain"
-msgstr "Yaum al-Ithnain"
-
-#: kcalendarsystemislamiccivil.cpp:367
-#, fuzzy
-#| msgid "Yau al-Thulatha"
-msgctxt "Hijri weekday 2 - KLocale::LongName"
-msgid "Yau al-Thulatha"
-msgstr "Yau al-Thulatha"
-
-#: kcalendarsystemislamiccivil.cpp:369
-#, fuzzy
-#| msgid "Yaum al-Arbi'a"
-msgctxt "Hijri weekday 3 - KLocale::LongName"
-msgid "Yaum al-Arbi'a"
-msgstr "Yaum al-Arbi'a"
-
-#: kcalendarsystemislamiccivil.cpp:371
-#, fuzzy
-#| msgid "Yaum al-Khamees"
-msgctxt "Hijri weekday 4 - KLocale::LongName"
-msgid "Yaum al-Khamees"
-msgstr "Yaum al-Khamees"
-
-#: kcalendarsystemislamiccivil.cpp:373
-#, fuzzy
-#| msgid "Yaum al-Jumma"
-msgctxt "Hijri weekday 5 - KLocale::LongName"
-msgid "Yaum al-Jumma"
-msgstr "Yaum al-Jumma"
-
-#: kcalendarsystemislamiccivil.cpp:375
-#, fuzzy
-#| msgid "Yaum al-Sabt"
-msgctxt "Hijri weekday 6 - KLocale::LongName"
-msgid "Yaum al-Sabt"
-msgstr "Yaum al-Sabt"
-
-#: kcalendarsystemislamiccivil.cpp:377
-#, fuzzy
-#| msgid "Yaum al-Ahad"
-msgctxt "Hijri weekday 7 - KLocale::LongName"
-msgid "Yaum al-Ahad"
-msgstr "Yaum al-Ahad"
-
-#: kcalendarsystemjalali.cpp:74
-msgctxt "Calendar Era: Jalali Islamic Era, years > 0, LongFormat"
-msgid "Anno Persico"
-msgstr "Anno Persico"
-
-#: kcalendarsystemjalali.cpp:75
-msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat"
-msgid "AP"
-msgstr "AP"
-
-#: kcalendarsystemjalali.cpp:76
-#, c-format
-msgctxt ""
-"(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP"
-msgid "%Ey %EC"
-msgstr "%Ey %EC"
-
-#: kcalendarsystemjalali.cpp:172
-msgctxt "Jalali month 1 - KLocale::NarrowName"
-msgid "F"
-msgstr ""
-
-#: kcalendarsystemjalali.cpp:174
-msgctxt "Jalali month 2 - KLocale::NarrowName"
-msgid "O"
-msgstr ""
-
-#: kcalendarsystemjalali.cpp:176
-msgctxt "Jalali month 3 - KLocale::NarrowName"
-msgid "K"
-msgstr ""
-
-#: kcalendarsystemjalali.cpp:178
-msgctxt "Jalali month 4 - KLocale::NarrowName"
-msgid "T"
-msgstr ""
-
-#: kcalendarsystemjalali.cpp:180
-#, fuzzy
-#| msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat"
-#| msgid "AM"
-msgctxt "Jalali month 5 - KLocale::NarrowName"
-msgid "M"
-msgstr "AM"
-
-#: kcalendarsystemjalali.cpp:182
-#, fuzzy
-#| msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat"
-#| msgid "SE"
-msgctxt "Jalali month 6 - KLocale::NarrowName"
-msgid "S"
-msgstr "SE"
-
-#: kcalendarsystemjalali.cpp:184
-#, fuzzy
-#| msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat"
-#| msgid "AM"
-msgctxt "Jalali month 7 - KLocale::NarrowName"
-msgid "M"
-msgstr "AM"
-
-#: kcalendarsystemjalali.cpp:186
-#, fuzzy
-#| msgid "Av"
-msgctxt "Jalali month 8 - KLocale::NarrowName"
-msgid "A"
-msgstr "Av"
-
-#: kcalendarsystemjalali.cpp:188
-#, fuzzy
-#| msgid "Av"
-msgctxt "Jalali month 9 - KLocale::NarrowName"
-msgid "A"
-msgstr "Av"
-
-#: kcalendarsystemjalali.cpp:190
-#, fuzzy
-#| msgctxt "Calendar Era: Gregorian Christian Era, years > 0, ShortFormat"
-#| msgid "AD"
-msgctxt "Jalali month 10 - KLocale::NarrowName"
-msgid "D"
-msgstr "AD"
-
-#: kcalendarsystemjalali.cpp:192
-#, fuzzy
-#| msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat"
-#| msgid "BC"
-msgctxt "Jalali month 11 - KLocale::NarrowName"
-msgid "B"
-msgstr "BC"
-
-#: kcalendarsystemjalali.cpp:194
-#, fuzzy
-#| msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat"
-#| msgid "CE"
-msgctxt "Jalali month 12 - KLocale::NarrowName"
-msgid "E"
-msgstr "CE"
-
-#: kcalendarsystemjalali.cpp:203
-#, fuzzy
-#| msgctxt "of Farvardin short"
-#| msgid "of Far"
-msgctxt "Jalali month 1 - KLocale::ShortName Possessive"
-msgid "of Far"
-msgstr "od Far"
-
-#: kcalendarsystemjalali.cpp:205
-#, fuzzy
-#| msgctxt "of Ordibehesht short"
-#| msgid "of Ord"
-msgctxt "Jalali month 2 - KLocale::ShortName Possessive"
-msgid "of Ord"
-msgstr "od Ord"
-
-#: kcalendarsystemjalali.cpp:207
-#, fuzzy
-#| msgctxt "of Khordad short"
-#| msgid "of Kho"
-msgctxt "Jalali month 3 - KLocale::ShortName Possessive"
-msgid "of Kho"
-msgstr "od Kho"
-
-#: kcalendarsystemjalali.cpp:209
-#, fuzzy
-#| msgctxt "of Tir short"
-#| msgid "of Tir"
-msgctxt "Jalali month 4 - KLocale::ShortName Possessive"
-msgid "of Tir"
-msgstr "od Tir"
-
-#: kcalendarsystemjalali.cpp:211
-#, fuzzy
-#| msgctxt "of Mordad short"
-#| msgid "of Mor"
-msgctxt "Jalali month 5 - KLocale::ShortName Possessive"
-msgid "of Mor"
-msgstr "od Mor"
-
-#: kcalendarsystemjalali.cpp:213
-#, fuzzy
-#| msgctxt "of Shahrivar short"
-#| msgid "of Sha"
-msgctxt "Jalali month 6 - KLocale::ShortName Possessive"
-msgid "of Sha"
-msgstr "od Sha"
-
-#: kcalendarsystemjalali.cpp:215
-#, fuzzy
-#| msgctxt "of Mehr short"
-#| msgid "of Meh"
-msgctxt "Jalali month 7 - KLocale::ShortName Possessive"
-msgid "of Meh"
-msgstr "od Meh"
-
-#: kcalendarsystemjalali.cpp:217
-#, fuzzy
-#| msgctxt "of Aban short"
-#| msgid "of Aba"
-msgctxt "Jalali month 8 - KLocale::ShortName Possessive"
-msgid "of Aba"
-msgstr "od Aba"
-
-#: kcalendarsystemjalali.cpp:219
-#, fuzzy
-#| msgctxt "of Azar short"
-#| msgid "of Aza"
-msgctxt "Jalali month 9 - KLocale::ShortName Possessive"
-msgid "of Aza"
-msgstr "od Aza"
-
-#: kcalendarsystemjalali.cpp:221
-#, fuzzy
-#| msgctxt "of Dei short"
-#| msgid "of Dei"
-msgctxt "Jalali month 10 - KLocale::ShortName Possessive"
-msgid "of Dei"
-msgstr "od Dei"
-
-#: kcalendarsystemjalali.cpp:223
-#, fuzzy
-#| msgctxt "of Bahman short"
-#| msgid "of Bah"
-msgctxt "Jalali month 11 - KLocale::ShortName Possessive"
-msgid "of Bah"
-msgstr "od Bah"
-
-#: kcalendarsystemjalali.cpp:225
-#, fuzzy
-#| msgctxt "of Esfand short"
-#| msgid "of Esf"
-msgctxt "Jalali month 12 - KLocale::ShortName Possessive"
-msgid "of Esf"
-msgstr "od Esf"
-
-#: kcalendarsystemjalali.cpp:234
-#, fuzzy
-#| msgctxt "Farvardin short"
-#| msgid "Far"
-msgctxt "Jalali month 1 - KLocale::ShortName"
-msgid "Far"
-msgstr "Far"
-
-#: kcalendarsystemjalali.cpp:236
-#, fuzzy
-#| msgctxt "Ordibehesht short"
-#| msgid "Ord"
-msgctxt "Jalali month 2 - KLocale::ShortName"
-msgid "Ord"
-msgstr "Ord"
-
-#: kcalendarsystemjalali.cpp:238
-#, fuzzy
-#| msgctxt "Khordad short"
-#| msgid "Kho"
-msgctxt "Jalali month 3 - KLocale::ShortName"
-msgid "Kho"
-msgstr "Kho"
-
-#: kcalendarsystemjalali.cpp:240
-#, fuzzy
-#| msgctxt "Tir short"
-#| msgid "Tir"
-msgctxt "Jalali month 4 - KLocale::ShortName"
-msgid "Tir"
-msgstr "Tir"
-
-#: kcalendarsystemjalali.cpp:242
-#, fuzzy
-#| msgctxt "Mordad short"
-#| msgid "Mor"
-msgctxt "Jalali month 5 - KLocale::ShortName"
-msgid "Mor"
-msgstr "Mor"
-
-#: kcalendarsystemjalali.cpp:244
-#, fuzzy
-#| msgctxt "Shahrivar short"
-#| msgid "Sha"
-msgctxt "Jalali month 6 - KLocale::ShortName"
-msgid "Sha"
-msgstr "Sha"
-
-#: kcalendarsystemjalali.cpp:246
-#, fuzzy
-#| msgctxt "Mehr short"
-#| msgid "Meh"
-msgctxt "Jalali month 7 - KLocale::ShortName"
-msgid "Meh"
-msgstr "Meh"
-
-#: kcalendarsystemjalali.cpp:248
-#, fuzzy
-#| msgctxt "Aban short"
-#| msgid "Aba"
-msgctxt "Jalali month 8 - KLocale::ShortName"
-msgid "Aba"
-msgstr "Aba"
-
-#: kcalendarsystemjalali.cpp:250
-#, fuzzy
-#| msgctxt "Azar short"
-#| msgid "Aza"
-msgctxt "Jalali month 9 - KLocale::ShortName"
-msgid "Aza"
-msgstr "Aza"
-
-#: kcalendarsystemjalali.cpp:252
-#, fuzzy
-#| msgctxt "Dei short"
-#| msgid "Dei"
-msgctxt "Jalali month 10 - KLocale::ShortName"
-msgid "Dei"
-msgstr "Dei"
-
-#: kcalendarsystemjalali.cpp:254
-#, fuzzy
-#| msgctxt "Bahman short"
-#| msgid "Bah"
-msgctxt "Jalali month 11 - KLocale::ShortName"
-msgid "Bah"
-msgstr "Bah"
-
-#: kcalendarsystemjalali.cpp:256
-#, fuzzy
-#| msgctxt "Esfand"
-#| msgid "Esf"
-msgctxt "Jalali month 12 - KLocale::ShortName"
-msgid "Esf"
-msgstr "Esf"
-
-#: kcalendarsystemjalali.cpp:265
-#, fuzzy
-#| msgid "of Farvardin"
-msgctxt "Jalali month 1 - KLocale::LongName Possessive"
-msgid "of Farvardin"
-msgstr "od Farvardina"
-
-#: kcalendarsystemjalali.cpp:267
-#, fuzzy
-#| msgid "of Ordibehesht"
-msgctxt "Jalali month 2 - KLocale::LongName Possessive"
-msgid "of Ordibehesht"
-msgstr "od Ordibeheshta"
-
-#: kcalendarsystemjalali.cpp:269
-#, fuzzy
-#| msgid "of Khordad"
-msgctxt "Jalali month 3 - KLocale::LongName Possessive"
-msgid "of Khordad"
-msgstr "od Khordada"
-
-#: kcalendarsystemjalali.cpp:271
-#, fuzzy
-#| msgctxt "of Tir short"
-#| msgid "of Tir"
-msgctxt "Jalali month 4 - KLocale::LongName Possessive"
-msgid "of Tir"
-msgstr "od Tir"
-
-#: kcalendarsystemjalali.cpp:273
-#, fuzzy
-#| msgid "of Mordad"
-msgctxt "Jalali month 5 - KLocale::LongName Possessive"
-msgid "of Mordad"
-msgstr "od Mordada"
-
-#: kcalendarsystemjalali.cpp:275
-#, fuzzy
-#| msgid "of Shahrivar"
-msgctxt "Jalali month 6 - KLocale::LongName Possessive"
-msgid "of Shahrivar"
-msgstr "od Shahrivara"
-
-#: kcalendarsystemjalali.cpp:277
-#, fuzzy
-#| msgid "of Mehr"
-msgctxt "Jalali month 7 - KLocale::LongName Possessive"
-msgid "of Mehr"
-msgstr "od Mehra"
-
-#: kcalendarsystemjalali.cpp:279
-#, fuzzy
-#| msgid "of Aban"
-msgctxt "Jalali month 8 - KLocale::LongName Possessive"
-msgid "of Aban"
-msgstr "od Abana"
-
-#: kcalendarsystemjalali.cpp:281
-#, fuzzy
-#| msgid "of Azar"
-msgctxt "Jalali month 9 - KLocale::LongName Possessive"
-msgid "of Azar"
-msgstr "od Azara"
-
-#: kcalendarsystemjalali.cpp:283
-#, fuzzy
-#| msgctxt "of Dei short"
-#| msgid "of Dei"
-msgctxt "Jalali month 10 - KLocale::LongName Possessive"
-msgid "of Dei"
-msgstr "od Dei"
-
-#: kcalendarsystemjalali.cpp:285
-#, fuzzy
-#| msgid "of Bahman"
-msgctxt "Jalali month 11 - KLocale::LongName Possessive"
-msgid "of Bahman"
-msgstr "od Bahmana"
-
-#: kcalendarsystemjalali.cpp:287
-#, fuzzy
-#| msgid "of Esfand"
-msgctxt "Jalali month 12 - KLocale::LongName Possessive"
-msgid "of Esfand"
-msgstr "od Esfanda"
-
-#: kcalendarsystemjalali.cpp:296
-#, fuzzy
-#| msgid "Farvardin"
-msgctxt "Jalali month 1 - KLocale::LongName"
-msgid "Farvardin"
-msgstr "Farvardin"
-
-#: kcalendarsystemjalali.cpp:298
-#, fuzzy
-#| msgid "Ordibehesht"
-msgctxt "Jalali month 2 - KLocale::LongName"
-msgid "Ordibehesht"
-msgstr "Ordibehesht"
-
-#: kcalendarsystemjalali.cpp:300
-#, fuzzy
-#| msgid "Khordad"
-msgctxt "Jalali month 3 - KLocale::LongName"
-msgid "Khordad"
-msgstr "Khordad"
-
-#: kcalendarsystemjalali.cpp:302
-#, fuzzy
-#| msgctxt "Tir short"
-#| msgid "Tir"
-msgctxt "Jalali month 4 - KLocale::LongName"
-msgid "Tir"
-msgstr "Tir"
-
-#: kcalendarsystemjalali.cpp:304
-#, fuzzy
-#| msgid "Mordad"
-msgctxt "Jalali month 5 - KLocale::LongName"
-msgid "Mordad"
-msgstr "Mordad"
-
-#: kcalendarsystemjalali.cpp:306
-#, fuzzy
-#| msgid "Shahrivar"
-msgctxt "Jalali month 6 - KLocale::LongName"
-msgid "Shahrivar"
-msgstr "Shahrivar"
-
-#: kcalendarsystemjalali.cpp:308
-#, fuzzy
-#| msgid "Mehr"
-msgctxt "Jalali month 7 - KLocale::LongName"
-msgid "Mehr"
-msgstr "Mehr"
-
-#: kcalendarsystemjalali.cpp:310
-#, fuzzy
-#| msgid "Aban"
-msgctxt "Jalali month 8 - KLocale::LongName"
-msgid "Aban"
-msgstr "Aban"
-
-#: kcalendarsystemjalali.cpp:312
-#, fuzzy
-#| msgid "Azar"
-msgctxt "Jalali month 9 - KLocale::LongName"
-msgid "Azar"
-msgstr "Azar"
-
-#: kcalendarsystemjalali.cpp:314
-#, fuzzy
-#| msgctxt "Dei short"
-#| msgid "Dei"
-msgctxt "Jalali month 10 - KLocale::LongName"
-msgid "Dei"
-msgstr "Dei"
-
-#: kcalendarsystemjalali.cpp:316
-#, fuzzy
-#| msgid "Bahman"
-msgctxt "Jalali month 11 - KLocale::LongName"
-msgid "Bahman"
-msgstr "Bahman"
-
-#: kcalendarsystemjalali.cpp:318
-#, fuzzy
-#| msgid "Esfand"
-msgctxt "Jalali month 12 - KLocale::LongName"
-msgid "Esfand"
-msgstr "Esfand"
-
-#: kcalendarsystemjalali.cpp:331
-msgctxt "Jalali weekday 1 - KLocale::NarrowName "
-msgid "2"
-msgstr ""
-
-#: kcalendarsystemjalali.cpp:333
-msgctxt "Jalali weekday 2 - KLocale::NarrowName "
-msgid "3"
-msgstr ""
-
-#: kcalendarsystemjalali.cpp:335
-msgctxt "Jalali weekday 3 - KLocale::NarrowName "
-msgid "4"
-msgstr ""
-
-#: kcalendarsystemjalali.cpp:337
-msgctxt "Jalali weekday 4 - KLocale::NarrowName "
-msgid "5"
-msgstr ""
-
-#: kcalendarsystemjalali.cpp:339
-msgctxt "Jalali weekday 5 - KLocale::NarrowName "
-msgid "J"
-msgstr ""
-
-#: kcalendarsystemjalali.cpp:341
-#, fuzzy
-#| msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat"
-#| msgid "SE"
-msgctxt "Jalali weekday 6 - KLocale::NarrowName "
-msgid "S"
-msgstr "SE"
-
-#: kcalendarsystemjalali.cpp:343
-msgctxt "Jalali weekday 7 - KLocale::NarrowName "
-msgid "1"
-msgstr ""
-
-#: kcalendarsystemjalali.cpp:352
-#, fuzzy
-#| msgctxt "Do shanbe short"
-#| msgid "2sh"
-msgctxt "Jalali weekday 1 - KLocale::ShortName"
-msgid "2sh"
-msgstr "2sh"
-
-#: kcalendarsystemjalali.cpp:354
-#, fuzzy
-#| msgctxt "Se shanbe short"
-#| msgid "3sh"
-msgctxt "Jalali weekday 2 - KLocale::ShortName"
-msgid "3sh"
-msgstr "3sh"
-
-#: kcalendarsystemjalali.cpp:356
-#, fuzzy
-#| msgctxt "Chahar shanbe short"
-#| msgid "4sh"
-msgctxt "Jalali weekday 3 - KLocale::ShortName"
-msgid "4sh"
-msgstr "4sh"
-
-#: kcalendarsystemjalali.cpp:358
-#, fuzzy
-#| msgctxt "Panj shanbe short"
-#| msgid "5sh"
-msgctxt "Jalali weekday 4 - KLocale::ShortName"
-msgid "5sh"
-msgstr "5sh"
-
-#: kcalendarsystemjalali.cpp:360
-#, fuzzy
-#| msgctxt "Jumee short"
-#| msgid "Jom"
-msgctxt "Jalali weekday 5 - KLocale::ShortName"
-msgid "Jom"
-msgstr "Jom"
-
-#: kcalendarsystemjalali.cpp:362
-#, fuzzy
-#| msgid "Shanbe"
-msgctxt "Jalali weekday 6 - KLocale::ShortName"
-msgid "Shn"
-msgstr "Shanbe"
-
-#: kcalendarsystemjalali.cpp:364
-#, fuzzy
-#| msgctxt "Yek-shanbe short"
-#| msgid "1sh"
-msgctxt "Jalali weekday 7 - KLocale::ShortName"
-msgid "1sh"
-msgstr "1sh"
-
-#: kcalendarsystemjalali.cpp:371
-#, fuzzy
-#| msgid "Do shanbe"
-msgctxt "Jalali weekday 1 - KLocale::LongName"
-msgid "Do shanbe"
-msgstr "Do shanbe"
-
-#: kcalendarsystemjalali.cpp:373
-#, fuzzy
-#| msgid "Se shanbe"
-msgctxt "Jalali weekday 2 - KLocale::LongName"
-msgid "Se shanbe"
-msgstr "Se shanbe"
-
-#: kcalendarsystemjalali.cpp:375
-#, fuzzy
-#| msgid "Chahar shanbe"
-msgctxt "Jalali weekday 3 - KLocale::LongName"
-msgid "Chahar shanbe"
-msgstr "Chahar shanbe"
-
-#: kcalendarsystemjalali.cpp:377
-#, fuzzy
-#| msgid "Panj shanbe"
-msgctxt "Jalali weekday 4 - KLocale::LongName"
-msgid "Panj shanbe"
-msgstr "Panj shanbe"
-
-#: kcalendarsystemjalali.cpp:379
-#, fuzzy
-#| msgid "Jumee"
-msgctxt "Jalali weekday 5 - KLocale::LongName"
-msgid "Jumee"
-msgstr "Jumee"
-
-#: kcalendarsystemjalali.cpp:381
-#, fuzzy
-#| msgid "Shanbe"
-msgctxt "Jalali weekday 6 - KLocale::LongName"
-msgid "Shanbe"
-msgstr "Shanbe"
-
-#: kcalendarsystemjalali.cpp:383
-#, fuzzy
-#| msgid "Yek-shanbe"
-msgctxt "Jalali weekday 7 - KLocale::LongName"
-msgid "Yek-shanbe"
-msgstr "Yek-shanbe"
-
-#: kcalendarsystemjapanese.cpp:62
-msgctxt "Calendar Era: Japanese Nengō, Meiji Era, LongFormat"
-msgid "Meiji"
-msgstr "Meiji"
-
-#: kcalendarsystemjapanese.cpp:64
-#, c-format
-msgctxt ""
-"(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1, "
-"e.g. Meiji 1"
-msgid "%EC Gannen"
-msgstr "%EC Gannen"
-
-#: kcalendarsystemjapanese.cpp:66
-#, c-format
-msgctxt ""
-"(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1, "
-"e.g. Meiji 22"
-msgid "%EC %Ey"
-msgstr "%EC %Ey"
-
-#: kcalendarsystemjapanese.cpp:69
-msgctxt "Calendar Era: Japanese Nengō, Taishō Era, LongFormat"
-msgid "Taishō"
-msgstr "Taishō"
-
-#: kcalendarsystemjapanese.cpp:71
-#, c-format
-msgctxt ""
-"(kdedt-format) Japanese, Taishō, full era year format used for %EY, year = "
-"1, e.g. Taishō 1"
-msgid "%EC Gannen"
-msgstr "%EC Gannen"
-
-#: kcalendarsystemjapanese.cpp:73
-#, c-format
-msgctxt ""
-"(kdedt-format) Japanese, Taishō, full era year format used for %EY, year > "
-"1, e.g. Taishō 22"
-msgid "%EC %Ey"
-msgstr "%EC %Ey"
-
-#: kcalendarsystemjapanese.cpp:76
-msgctxt "Calendar Era: Japanese Nengō, Shōwa Era, LongFormat"
-msgid "Shōwa"
-msgstr "Shōwa"
-
-#: kcalendarsystemjapanese.cpp:78
-#, c-format
-msgctxt ""
-"(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year = 1, "
-"e.g. Shōwa 1"
-msgid "%EC Gannen"
-msgstr "%EC Gannen"
-
-#: kcalendarsystemjapanese.cpp:80
-#, c-format
-msgctxt ""
-"(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year > 1, "
-"e.g. Shōwa 22"
-msgid "%EC %Ey"
-msgstr "%EC %Ey"
-
-#: kcalendarsystemjapanese.cpp:83
-msgctxt "Calendar Era: Japanese Nengō, Heisei Era, LongFormat"
-msgid "Heisei"
-msgstr "Heisei"
-
-#: kcalendarsystemjapanese.cpp:85
-#, c-format
-msgctxt ""
-"(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = "
-"1, e.g. Heisei 1"
-msgid "%EC Gannen"
-msgstr "%EC Gannen"
-
-#: kcalendarsystemjapanese.cpp:87
-#, c-format
-msgctxt ""
-"(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > "
-"1, e.g. Heisei 22"
-msgid "%EC %Ey"
-msgstr "%EC %Ey"
-
-#: kcalendarsystemjapanese.cpp:164
-msgctxt "Japanese year 1 of era"
-msgid "Gannen"
-msgstr "Gannen"
-
-#: kcalendarsystemjulian.cpp:73
-msgctxt "Calendar Era: Julian Common Era, years < 0, LongFormat"
-msgid "Before Common Era"
-msgstr "Prije naše ere"
-
-#: kcalendarsystemjulian.cpp:74
-msgctxt "Calendar Era: Julian Common Era, years < 0, ShortFormat"
-msgid "BCE"
-msgstr "BCE"
-
-#: kcalendarsystemjulian.cpp:76
-msgctxt "Calendar Era: Julian Christian Era, years < 0, LongFormat"
-msgid "Before Christ"
-msgstr "Prije Krista"
-
-#: kcalendarsystemjulian.cpp:77
-msgctxt "Calendar Era: Julian Christian Era, years < 0, ShortFormat"
-msgid "BC"
-msgstr "BC"
-
-#: kcalendarsystemjulian.cpp:79
-#, c-format
-msgctxt ""
-"(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC"
-msgid "%Ey %EC"
-msgstr "%Ey %EC"
-
-#: kcalendarsystemjulian.cpp:83
-msgctxt "Calendar Era: Julian Common Era, years > 0, LongFormat"
-msgid "Common Era"
-msgstr "Naša era"
-
-#: kcalendarsystemjulian.cpp:84
-msgctxt "Calendar Era: Julian Common Era, years > 0, ShortFormat"
-msgid "CE"
-msgstr "CE"
-
-#: kcalendarsystemjulian.cpp:86
-msgctxt "Calendar Era: Julian Christian Era, years > 0, LongFormat"
-msgid "Anno Domini"
-msgstr "Anno Domini"
-
-#: kcalendarsystemjulian.cpp:87
-msgctxt "Calendar Era: Julian Christian Era, years > 0, ShortFormat"
-msgid "AD"
-msgstr "AD"
-
-#: kcalendarsystemjulian.cpp:89
-#, c-format
-msgctxt ""
-"(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD"
-msgid "%Ey %EC"
-msgstr "%Ey %EC"
-
-#: kcalendarsystemjulian.cpp:172
-msgctxt "Julian month 1 - KLocale::NarrowName"
-msgid "J"
-msgstr "S"
-
-#: kcalendarsystemjulian.cpp:174
-msgctxt "Julian month 2 - KLocale::NarrowName"
-msgid "F"
-msgstr "V"
-
-#: kcalendarsystemjulian.cpp:176
-msgctxt "Julian month 3 - KLocale::NarrowName"
-msgid "M"
-msgstr "O"
-
-#: kcalendarsystemjulian.cpp:178
-msgctxt "Julian month 4 - KLocale::NarrowName"
-msgid "A"
-msgstr "T"
-
-#: kcalendarsystemjulian.cpp:180
-msgctxt "Julian month 5 - KLocale::NarrowName"
-msgid "M"
-msgstr "S"
-
-#: kcalendarsystemjulian.cpp:182
-msgctxt "Julian month 6 - KLocale::NarrowName"
-msgid "J"
-msgstr "L"
-
-#: kcalendarsystemjulian.cpp:184
-msgctxt "Julian month 7 - KLocale::NarrowName"
-msgid "J"
-msgstr "S"
-
-#: kcalendarsystemjulian.cpp:186
-msgctxt "Julian month 8 - KLocale::NarrowName"
-msgid "A"
-msgstr "K"
-
-#: kcalendarsystemjulian.cpp:188
-msgctxt "Julian month 9 - KLocale::NarrowName"
-msgid "S"
-msgstr "R"
-
-#: kcalendarsystemjulian.cpp:190
-msgctxt "Julian month 10 - KLocale::NarrowName"
-msgid "O"
-msgstr "L"
-
-#: kcalendarsystemjulian.cpp:192
-msgctxt "Julian month 11 - KLocale::NarrowName"
-msgid "N"
-msgstr "S"
-
-#: kcalendarsystemjulian.cpp:194
-msgctxt "Julian month 12 - KLocale::NarrowName"
-msgid "D"
-msgstr "P"
-
-#: kcalendarsystemjulian.cpp:203
-msgctxt "Julian month 1 - KLocale::ShortName Possessive"
-msgid "of Jan"
-msgstr "siječnja"
-
-#: kcalendarsystemjulian.cpp:205
-msgctxt "Julian month 2 - KLocale::ShortName Possessive"
-msgid "of Feb"
-msgstr "veljače"
-
-#: kcalendarsystemjulian.cpp:207
-msgctxt "Julian month 3 - KLocale::ShortName Possessive"
-msgid "of Mar"
-msgstr "ožujka"
-
-#: kcalendarsystemjulian.cpp:209
-msgctxt "Julian month 4 - KLocale::ShortName Possessive"
-msgid "of Apr"
-msgstr "travnja"
-
-#: kcalendarsystemjulian.cpp:211
-msgctxt "Julian month 5 - KLocale::ShortName Possessive"
-msgid "of May"
-msgstr "svibnja"
-
-#: kcalendarsystemjulian.cpp:213
-msgctxt "Julian month 6 - KLocale::ShortName Possessive"
-msgid "of Jun"
-msgstr "lipnja"
-
-#: kcalendarsystemjulian.cpp:215
-msgctxt "Julian month 7 - KLocale::ShortName Possessive"
-msgid "of Jul"
-msgstr "srpnja"
-
-#: kcalendarsystemjulian.cpp:217
-msgctxt "Julian month 8 - KLocale::ShortName Possessive"
-msgid "of Aug"
-msgstr "kolovoza"
-
-#: kcalendarsystemjulian.cpp:219
-msgctxt "Julian month 9 - KLocale::ShortName Possessive"
-msgid "of Sep"
-msgstr "rujna"
-
-#: kcalendarsystemjulian.cpp:221
-msgctxt "Julian month 10 - KLocale::ShortName Possessive"
-msgid "of Oct"
-msgstr "listopada"
-
-#: kcalendarsystemjulian.cpp:223
-msgctxt "Julian month 11 - KLocale::ShortName Possessive"
-msgid "of Nov"
-msgstr "studenog"
-
-#: kcalendarsystemjulian.cpp:225
-msgctxt "Julian month 12 - KLocale::ShortName Possessive"
-msgid "of Dec"
-msgstr "prosinca"
-
-#: kcalendarsystemjulian.cpp:234
-msgctxt "Julian month 1 - KLocale::ShortName"
-msgid "Jan"
-msgstr "Sij"
-
-#: kcalendarsystemjulian.cpp:236
-msgctxt "Julian month 2 - KLocale::ShortName"
-msgid "Feb"
-msgstr "Velj"
-
-#: kcalendarsystemjulian.cpp:238
-msgctxt "Julian month 3 - KLocale::ShortName"
-msgid "Mar"
-msgstr "Ožu"
-
-#: kcalendarsystemjulian.cpp:240
-msgctxt "Julian month 4 - KLocale::ShortName"
-msgid "Apr"
-msgstr "Tra"
-
-#: kcalendarsystemjulian.cpp:242
-msgctxt "Julian month 5 - KLocale::ShortName"
-msgid "May"
-msgstr "Svi"
-
-#: kcalendarsystemjulian.cpp:244
-msgctxt "Julian month 6 - KLocale::ShortName"
-msgid "Jun"
-msgstr "Lip"
-
-#: kcalendarsystemjulian.cpp:246
-msgctxt "Julian month 7 - KLocale::ShortName"
-msgid "Jul"
-msgstr "Srp"
-
-#: kcalendarsystemjulian.cpp:248
-msgctxt "Julian month 8 - KLocale::ShortName"
-msgid "Aug"
-msgstr "Kol"
-
-#: kcalendarsystemjulian.cpp:250
-msgctxt "Julian month 9 - KLocale::ShortName"
-msgid "Sep"
-msgstr "Ruj"
-
-#: kcalendarsystemjulian.cpp:252
-msgctxt "Julian month 10 - KLocale::ShortName"
-msgid "Oct"
-msgstr "Lis"
-
-#: kcalendarsystemjulian.cpp:254
-msgctxt "Julian month 11 - KLocale::ShortName"
-msgid "Nov"
-msgstr "Stu"
-
-#: kcalendarsystemjulian.cpp:256
-msgctxt "Julian month 12 - KLocale::ShortName"
-msgid "Dec"
-msgstr "Pro"
-
-#: kcalendarsystemjulian.cpp:265
-msgctxt "Julian month 1 - KLocale::LongName Possessive"
-msgid "of January"
-msgstr "siječnja"
-
-#: kcalendarsystemjulian.cpp:267
-msgctxt "Julian month 2 - KLocale::LongName Possessive"
-msgid "of February"
-msgstr "veljače"
-
-#: kcalendarsystemjulian.cpp:269
-msgctxt "Julian month 3 - KLocale::LongName Possessive"
-msgid "of March"
-msgstr "ožujka"
-
-#: kcalendarsystemjulian.cpp:271
-msgctxt "Julian month 4 - KLocale::LongName Possessive"
-msgid "of April"
-msgstr "travnja"
-
-#: kcalendarsystemjulian.cpp:273
-msgctxt "Julian month 5 - KLocale::LongName Possessive"
-msgid "of May"
-msgstr "svibnja"
-
-#: kcalendarsystemjulian.cpp:275
-msgctxt "Julian month 6 - KLocale::LongName Possessive"
-msgid "of June"
-msgstr "lipnja"
-
-#: kcalendarsystemjulian.cpp:277
-msgctxt "Julian month 7 - KLocale::LongName Possessive"
-msgid "of July"
-msgstr "srpnja"
-
-#: kcalendarsystemjulian.cpp:279
-msgctxt "Julian month 8 - KLocale::LongName Possessive"
-msgid "of August"
-msgstr "kolovoza"
-
-#: kcalendarsystemjulian.cpp:281
-msgctxt "Julian month 9 - KLocale::LongName Possessive"
-msgid "of September"
-msgstr "rujna"
-
-#: kcalendarsystemjulian.cpp:283
-msgctxt "Julian month 10 - KLocale::LongName Possessive"
-msgid "of October"
-msgstr "listopada"
-
-#: kcalendarsystemjulian.cpp:285
-msgctxt "Julian month 11 - KLocale::LongName Possessive"
-msgid "of November"
-msgstr "studenog"
-
-#: kcalendarsystemjulian.cpp:287
-msgctxt "Julian month 12 - KLocale::LongName Possessive"
-msgid "of December"
-msgstr "prosinca"
-
-#: kcalendarsystemjulian.cpp:296
-msgctxt "Julian month 1 - KLocale::LongName"
-msgid "January"
-msgstr "Siječanj"
-
-#: kcalendarsystemjulian.cpp:298
-msgctxt "Julian month 2 - KLocale::LongName"
-msgid "February"
-msgstr "Veljača"
-
-#: kcalendarsystemjulian.cpp:300
-msgctxt "Julian month 3 - KLocale::LongName"
-msgid "March"
-msgstr "Ožujak"
-
-#: kcalendarsystemjulian.cpp:302
-msgctxt "Julian month 4 - KLocale::LongName"
-msgid "April"
-msgstr "Travanj"
-
-#: kcalendarsystemjulian.cpp:304
-msgctxt "Julian month 5 - KLocale::LongName"
-msgid "May"
-msgstr "Svibanj"
-
-#: kcalendarsystemjulian.cpp:306
-msgctxt "Julian month 6 - KLocale::LongName"
-msgid "June"
-msgstr "Lipanj"
-
-#: kcalendarsystemjulian.cpp:308
-msgctxt "Julian month 7 - KLocale::LongName"
-msgid "July"
-msgstr "Srpanj"
-
-#: kcalendarsystemjulian.cpp:310
-msgctxt "Julian month 8 - KLocale::LongName"
-msgid "August"
-msgstr "Kolovoz"
-
-#: kcalendarsystemjulian.cpp:312
-msgctxt "Julian month 9 - KLocale::LongName"
-msgid "September"
-msgstr "Rujan"
-
-#: kcalendarsystemjulian.cpp:314
-msgctxt "Julian month 10 - KLocale::LongName"
-msgid "October"
-msgstr "Listopad"
-
-#: kcalendarsystemjulian.cpp:316
-msgctxt "Julian month 11 - KLocale::LongName"
-msgid "November"
-msgstr "Studeni"
-
-#: kcalendarsystemjulian.cpp:318
-msgctxt "Julian month 12 - KLocale::LongName"
-msgid "December"
-msgstr "Prosinac"
-
-#: kcalendarsystemjulian.cpp:331
-msgctxt "Julian weekday 1 - KLocale::NarrowName "
-msgid "M"
-msgstr "P"
-
-#: kcalendarsystemjulian.cpp:333
-msgctxt "Julian weekday 2 - KLocale::NarrowName "
-msgid "T"
-msgstr "U"
-
-#: kcalendarsystemjulian.cpp:335
-msgctxt "Julian weekday 3 - KLocale::NarrowName "
-msgid "W"
-msgstr "S"
-
-#: kcalendarsystemjulian.cpp:337
-msgctxt "Julian weekday 4 - KLocale::NarrowName "
-msgid "T"
-msgstr "Č"
-
-#: kcalendarsystemjulian.cpp:339
-msgctxt "Julian weekday 5 - KLocale::NarrowName "
-msgid "F"
-msgstr "P"
-
-#: kcalendarsystemjulian.cpp:341
-msgctxt "Julian weekday 6 - KLocale::NarrowName "
-msgid "S"
-msgstr "S"
-
-#: kcalendarsystemjulian.cpp:343
-msgctxt "Julian weekday 7 - KLocale::NarrowName "
-msgid "S"
-msgstr "S"
-
-#: kcalendarsystemjulian.cpp:352
-msgctxt "Julian weekday 1 - KLocale::ShortName"
-msgid "Mon"
-msgstr "Pon"
-
-#: kcalendarsystemjulian.cpp:354
-msgctxt "Julian weekday 2 - KLocale::ShortName"
-msgid "Tue"
-msgstr "Uto"
-
-#: kcalendarsystemjulian.cpp:356
-msgctxt "Julian weekday 3 - KLocale::ShortName"
-msgid "Wed"
-msgstr "Sri"
-
-#: kcalendarsystemjulian.cpp:358
-msgctxt "Julian weekday 4 - KLocale::ShortName"
-msgid "Thu"
-msgstr "Čet"
-
-#: kcalendarsystemjulian.cpp:360
-msgctxt "Julian weekday 5 - KLocale::ShortName"
-msgid "Fri"
-msgstr "Pet"
-
-#: kcalendarsystemjulian.cpp:362
-msgctxt "Julian weekday 6 - KLocale::ShortName"
-msgid "Sat"
-msgstr "Sub"
-
-#: kcalendarsystemjulian.cpp:364
-msgctxt "Julian weekday 7 - KLocale::ShortName"
-msgid "Sun"
-msgstr "Ned"
-
-#: kcalendarsystemjulian.cpp:371
-msgctxt "Julian weekday 1 - KLocale::LongName"
-msgid "Monday"
-msgstr "Ponedjeljak"
-
-#: kcalendarsystemjulian.cpp:373
-msgctxt "Julian weekday 2 - KLocale::LongName"
-msgid "Tuesday"
-msgstr "Utorak"
-
-#: kcalendarsystemjulian.cpp:375
-msgctxt "Julian weekday 3 - KLocale::LongName"
-msgid "Wednesday"
-msgstr "Srijeda"
-
-#: kcalendarsystemjulian.cpp:377
-msgctxt "Julian weekday 4 - KLocale::LongName"
-msgid "Thursday"
-msgstr "Četvrtak"
-
-#: kcalendarsystemjulian.cpp:379
-msgctxt "Julian weekday 5 - KLocale::LongName"
-msgid "Friday"
-msgstr "Petak"
-
-#: kcalendarsystemjulian.cpp:381
-msgctxt "Julian weekday 6 - KLocale::LongName"
-msgid "Saturday"
-msgstr "Subota"
-
-#: kcalendarsystemjulian.cpp:383
-msgctxt "Julian weekday 7 - KLocale::LongName"
-msgid "Sunday"
-msgstr "Nedjelja"
-
-#: kcalendarsystemminguo.cpp:57
-msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, LongFormat"
-msgid "Republic of China Era"
-msgstr "Era Republike Kine"
-
-#: kcalendarsystemminguo.cpp:58
-msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, ShortFormat"
-msgid "ROC"
-msgstr "ROC"
-
-#: kcalendarsystemminguo.cpp:59
-#, c-format
-msgctxt ""
-"(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99"
-msgid "%EC %Ey"
-msgstr "%EC %Ey"
-
-#: kcalendarsystemthai.cpp:58
-msgctxt "Calendar Era: Thai Buddhist Era, years > 0, LongFormat"
-msgid "Buddhist Era"
-msgstr "Buddhist Era"
-
-#: kcalendarsystemthai.cpp:59
-msgctxt "Calendar Era: Thai Buddhist Era, years > 0, ShortFormat"
-msgid "BE"
-msgstr "BE"
-
-#: kcalendarsystemthai.cpp:60
-#, c-format
-msgctxt ""
-"(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE"
-msgid "%Ey %EC"
-msgstr "%Ey %EC"
-
-#~ msgctxt "@item Calendar system"
-#~ msgid "Gregorian (Proleptic)"
-#~ msgstr "Gregorijanski (Proleptski)"
-
-#~ msgctxt "Ethiopian month 1 - ShortNamePossessive"
-#~ msgid "of Mes"
-#~ msgstr "od Mes"
-
-#~ msgctxt "Ethiopian month 5 - LongNamePossessive"
-#~ msgid "of Ter"
-#~ msgstr "od Tera"
-
-#~ msgctxt "Ethiopian month 1 - ShortName"
-#~ msgid "Mes"
-#~ msgstr "Mes"
-
-#~ msgctxt "Ethiopian month 5 - LongName"
-#~ msgid "Ter"
-#~ msgstr "Ter"
-
-#~ msgctxt "Ethiopian weekday 4 - ShortDayName"
-#~ msgid "Ham"
-#~ msgstr "Ham"
-
-#~ msgctxt "Ethiopian weekday 5 - ShortDayName"
-#~ msgid "Arb"
-#~ msgstr "Arb"
-
-#~ msgctxt "Ethiopian weekday 3 - LongDayName"
-#~ msgid "Rob"
-#~ msgstr "Rob"
-
-#~ msgctxt "Ethiopian weekday 5 - LongDayName"
-#~ msgid "Arb"
-#~ msgstr "Arb"
-
-#~ msgctxt "of May long"
-#~ msgid "of May"
-#~ msgstr "svibnja"
-
-#~ msgctxt "May long"
-#~ msgid "May"
-#~ msgstr "svibanj"
-
-#~ msgid "R. Thaani"
-#~ msgstr "R. Thaani"
-
-#~ msgid "J. Thaani"
-#~ msgstr "J. Thaani"
-
-#~ msgid "Hijjah"
-#~ msgstr "Hijjah"
-
-#~ msgctxt "of Tir long"
-#~ msgid "of Tir"
-#~ msgstr "od Tira"
-
-#~ msgctxt "of Dei long"
-#~ msgid "of Dei"
-#~ msgstr "od Deia"
-
-#~ msgctxt "Tir long"
-#~ msgid "Tir"
-#~ msgstr "od Tira"
-
-#~ msgctxt "Dei long"
-#~ msgid "Dei"
-#~ msgstr "od Deia"
-
-#~ msgctxt "Shanbe short"
-#~ msgid "shn"
-#~ msgstr "shn"
diff -Nru kde-l10n-hr-4.12.97/messages/frameworks/kdelibs_colors4.po kde-l10n-hr-4.13.0/messages/frameworks/kdelibs_colors4.po
--- kde-l10n-hr-4.12.97/messages/frameworks/kdelibs_colors4.po 2014-01-25 21:41:22.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/frameworks/kdelibs_colors4.po 1970-01-01 00:00:00.000000000 +0000
@@ -1,2286 +0,0 @@
-# Translation of kdelibs_colors4 to Croatian
-#
-# Andrej Dundović , 2009.
-msgid ""
-msgstr ""
-"Project-Id-Version: kdelibs_colors44.po\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2014-01-24 18:50+0000\n"
-"PO-Revision-Date: 2009-06-30 14:34+0200\n"
-"Last-Translator: Andrej Dundović \n"
-"Language-Team: Croatian \n"
-"Language: hr\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n"
-"%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"X-Generator: Lokalize 0.3\n"
-"X-Environment: kde\n"
-"X-Accelerator-Marker: &\n"
-"X-Text-Markup: kde4\n"
-
-#: colors.cpp:1
-msgctxt "color"
-msgid "AliceBlue"
-msgstr "Plavkasta"
-
-#: colors.cpp:2
-msgctxt "color"
-msgid "AntiqueWhite"
-msgstr "Antikna bijela"
-
-#: colors.cpp:3
-msgctxt "color"
-msgid "AntiqueWhite1"
-msgstr "Antikna bijela 1"
-
-#: colors.cpp:4
-msgctxt "color"
-msgid "AntiqueWhite2"
-msgstr "Antikna bijela 2"
-
-#: colors.cpp:5
-msgctxt "color"
-msgid "AntiqueWhite3"
-msgstr "Antikna bijela 3"
-
-#: colors.cpp:6
-msgctxt "color"
-msgid "AntiqueWhite4"
-msgstr "Antikna bijela 4"
-
-#: colors.cpp:7
-msgctxt "color"
-msgid "BlanchedAlmond"
-msgstr "Blijedi badem"
-
-#: colors.cpp:8
-msgctxt "color"
-msgid "BlueViolet"
-msgstr "Plavoljubičasta"
-
-#: colors.cpp:9
-msgctxt "color"
-msgid "CadetBlue"
-msgstr "Kadetsko plava"
-
-#: colors.cpp:10
-msgctxt "color"
-msgid "CadetBlue1"
-msgstr "Kadetsko plava 1"
-
-#: colors.cpp:11
-msgctxt "color"
-msgid "CadetBlue2"
-msgstr "Kadetsko plava 2"
-
-#: colors.cpp:12
-msgctxt "color"
-msgid "CadetBlue3"
-msgstr "Kadetsko plava 3"
-
-#: colors.cpp:13
-msgctxt "color"
-msgid "CadetBlue4"
-msgstr "Kadetsko plava 4"
-
-#: colors.cpp:14
-msgctxt "color"
-msgid "CornflowerBlue"
-msgstr "Različkasto plava"
-
-#: colors.cpp:15
-msgctxt "color"
-msgid "DarkBlue"
-msgstr "Tamno plava"
-
-#: colors.cpp:16
-msgctxt "color"
-msgid "DarkCyan"
-msgstr "Tamni cijan"
-
-#: colors.cpp:17
-msgctxt "color"
-msgid "DarkGoldenrod"
-msgstr "Tamna kudjelja"
-
-#: colors.cpp:18
-msgctxt "color"
-msgid "DarkGoldenrod1"
-msgstr "Tamna kudjelja 1"
-
-#: colors.cpp:19
-msgctxt "color"
-msgid "DarkGoldenrod2"
-msgstr "Tamna kudjelja 2"
-
-#: colors.cpp:20
-msgctxt "color"
-msgid "DarkGoldenrod3"
-msgstr "Tamna kudjelja 3"
-
-#: colors.cpp:21
-msgctxt "color"
-msgid "DarkGoldenrod4"
-msgstr "Tamna kudjelja 4"
-
-#: colors.cpp:22
-msgctxt "color"
-msgid "DarkGray"
-msgstr "Tamno siva"
-
-#: colors.cpp:23
-msgctxt "color"
-msgid "DarkGreen"
-msgstr "Tamnozelena"
-
-#: colors.cpp:24
-msgctxt "color"
-msgid "DarkGrey"
-msgstr "Tamno sijeda"
-
-#: colors.cpp:25
-msgctxt "color"
-msgid "DarkKhaki"
-msgstr "Tamna sivožuta"
-
-#: colors.cpp:26
-msgctxt "color"
-msgid "DarkMagenta"
-msgstr "Tamna magenta"
-
-#: colors.cpp:27
-msgctxt "color"
-msgid "DarkOliveGreen"
-msgstr "Tamna maslinastozelena"
-
-#: colors.cpp:28
-msgctxt "color"
-msgid "DarkOliveGreen1"
-msgstr "Tamna maslinastozelena 1"
-
-#: colors.cpp:29
-msgctxt "color"
-msgid "DarkOliveGreen2"
-msgstr "Tamna maslinastozelena 2"
-
-#: colors.cpp:30
-msgctxt "color"
-msgid "DarkOliveGreen3"
-msgstr "Tamna maslinastozelena 3"
-
-#: colors.cpp:31
-msgctxt "color"
-msgid "DarkOliveGreen4"
-msgstr "Tamna maslinastozelena 4"
-
-#: colors.cpp:32
-msgctxt "color"
-msgid "DarkOrange"
-msgstr "Tamno narančasta"
-
-#: colors.cpp:33
-msgctxt "color"
-msgid "DarkOrange1"
-msgstr "Tamno narančasta 1"
-
-#: colors.cpp:34
-msgctxt "color"
-msgid "DarkOrange2"
-msgstr "Tamno narančasta 2"
-
-#: colors.cpp:35
-msgctxt "color"
-msgid "DarkOrange3"
-msgstr "Tamno narančasta 3"
-
-#: colors.cpp:36
-msgctxt "color"
-msgid "DarkOrange4"
-msgstr "Tamno narančasta 4"
-
-#: colors.cpp:37
-msgctxt "color"
-msgid "DarkOrchid"
-msgstr "Tamna orhideja"
-
-#: colors.cpp:38
-msgctxt "color"
-msgid "DarkOrchid1"
-msgstr "Tamna orhideja 1"
-
-#: colors.cpp:39
-msgctxt "color"
-msgid "DarkOrchid2"
-msgstr "Tamna orhideja 2"
-
-#: colors.cpp:40
-msgctxt "color"
-msgid "DarkOrchid3"
-msgstr "Tamna orhideja 3"
-
-#: colors.cpp:41
-msgctxt "color"
-msgid "DarkOrchid4"
-msgstr "Tamna orhideja 4"
-
-#: colors.cpp:42
-msgctxt "color"
-msgid "DarkRed"
-msgstr "Tamnocrvena"
-
-#: colors.cpp:43
-msgctxt "color"
-msgid "DarkSalmon"
-msgstr "Tamni losos"
-
-#: colors.cpp:44
-msgctxt "color"
-msgid "DarkSeaGreen"
-msgstr "Morsko tamnozelena"
-
-#: colors.cpp:45
-msgctxt "color"
-msgid "DarkSeaGreen1"
-msgstr "Morsko tamnozelena 1"
-
-#: colors.cpp:46
-msgctxt "color"
-msgid "DarkSeaGreen2"
-msgstr "Morsko tamnozelena 2"
-
-#: colors.cpp:47
-msgctxt "color"
-msgid "DarkSeaGreen3"
-msgstr "Morsko tamnozelena 3"
-
-#: colors.cpp:48
-msgctxt "color"
-msgid "DarkSeaGreen4"
-msgstr "Morsko tamnozelena 4"
-
-#: colors.cpp:49
-msgctxt "color"
-msgid "DarkSlateBlue"
-msgstr "Tamno škriljevačko plava"
-
-#: colors.cpp:50
-msgctxt "color"
-msgid "DarkSlateGray"
-msgstr "Tamno škriljevačko siva"
-
-#: colors.cpp:51
-msgctxt "color"
-msgid "DarkSlateGray1"
-msgstr "Tamno škriljevačko siva 1"
-
-#: colors.cpp:52
-msgctxt "color"
-msgid "DarkSlateGray2"
-msgstr "Tamno škriljevačko siva 2"
-
-#: colors.cpp:53
-msgctxt "color"
-msgid "DarkSlateGray3"
-msgstr "Tamno škriljevačko siva 3"
-
-#: colors.cpp:54
-msgctxt "color"
-msgid "DarkSlateGray4"
-msgstr "Tamno škriljevačko siva 4"
-
-#: colors.cpp:55
-msgctxt "color"
-msgid "DarkSlateGrey"
-msgstr "Tamno škriljevačko sijeda"
-
-#: colors.cpp:56
-msgctxt "color"
-msgid "DarkTurquoise"
-msgstr "Tamno tirkizna"
-
-#: colors.cpp:57
-msgctxt "color"
-msgid "DarkViolet"
-msgstr "Tamnoljubičasta"
-
-#: colors.cpp:58
-msgctxt "color"
-msgid "DeepPink"
-msgstr "Dubinsko ružičasta"
-
-#: colors.cpp:59
-msgctxt "color"
-msgid "DeepPink1"
-msgstr "Dubinsko ružičasta 1"
-
-#: colors.cpp:60
-msgctxt "color"
-msgid "DeepPink2"
-msgstr "Dubinsko ružičasta 2"
-
-#: colors.cpp:61
-msgctxt "color"
-msgid "DeepPink3"
-msgstr "Dubinsko ružičasta 3"
-
-#: colors.cpp:62
-msgctxt "color"
-msgid "DeepPink4"
-msgstr "Dubinsko ružičasta 4"
-
-#: colors.cpp:63
-msgctxt "color"
-msgid "DeepSkyBlue"
-msgstr "Dubinski nebesko plava"
-
-#: colors.cpp:64
-msgctxt "color"
-msgid "DeepSkyBlue1"
-msgstr "Dubinski nebesko plava 1"
-
-#: colors.cpp:65
-msgctxt "color"
-msgid "DeepSkyBlue2"
-msgstr "Dubinski nebesko plava 2"
-
-#: colors.cpp:66
-msgctxt "color"
-msgid "DeepSkyBlue3"
-msgstr "Dubinski nebesko plava 3"
-
-#: colors.cpp:67
-msgctxt "color"
-msgid "DeepSkyBlue4"
-msgstr "Dubinski nebesko plava 4"
-
-#: colors.cpp:68
-msgctxt "color"
-msgid "DimGray"
-msgstr "Zagasito siva"
-
-#: colors.cpp:69
-msgctxt "color"
-msgid "DimGrey"
-msgstr "Zagasito siva"
-
-#: colors.cpp:70
-msgctxt "color"
-msgid "DodgerBlue"
-msgstr "Dodger plava"
-
-#: colors.cpp:71
-msgctxt "color"
-msgid "DodgerBlue1"
-msgstr "Dodger plava 1"
-
-#: colors.cpp:72
-msgctxt "color"
-msgid "DodgerBlue2"
-msgstr "Dodger plava 2"
-
-#: colors.cpp:73
-msgctxt "color"
-msgid "DodgerBlue3"
-msgstr "Dodger plava 3"
-
-#: colors.cpp:74
-msgctxt "color"
-msgid "DodgerBlue4"
-msgstr "Dodger plava 4"
-
-#: colors.cpp:75
-msgctxt "color"
-msgid "FloralWhite"
-msgstr "Cvjetno bijela"
-
-#: colors.cpp:76
-msgctxt "color"
-msgid "ForestGreen"
-msgstr "Šumsko zelena"
-
-#: colors.cpp:77
-msgctxt "color"
-msgid "GhostWhite"
-msgstr "Sablasno bijela"
-
-#: colors.cpp:78
-msgctxt "color"
-msgid "GreenYellow"
-msgstr "Zelenožuta"
-
-#: colors.cpp:79
-msgctxt "color"
-msgid "HotPink"
-msgstr "Žarko ružičasta"
-
-#: colors.cpp:80
-msgctxt "color"
-msgid "HotPink1"
-msgstr "Žarko ružičasta 1"
-
-#: colors.cpp:81
-msgctxt "color"
-msgid "HotPink2"
-msgstr "Žarko ružičasta 2"
-
-#: colors.cpp:82
-msgctxt "color"
-msgid "HotPink3"
-msgstr "Žarko ružičasta 3"
-
-#: colors.cpp:83
-msgctxt "color"
-msgid "HotPink4"
-msgstr "Žarko ružičasta 4"
-
-#: colors.cpp:84
-msgctxt "color"
-msgid "IndianRed"
-msgstr "indijskocrvena"
-
-#: colors.cpp:85
-msgctxt "color"
-msgid "IndianRed1"
-msgstr "indijskocrvena 1"
-
-#: colors.cpp:86
-msgctxt "color"
-msgid "IndianRed2"
-msgstr "indijskocrvena 2"
-
-#: colors.cpp:87
-msgctxt "color"
-msgid "IndianRed3"
-msgstr "indijskocrvena 3"
-
-#: colors.cpp:88
-msgctxt "color"
-msgid "IndianRed4"
-msgstr "indijskocrvena 4"
-
-#: colors.cpp:89
-msgctxt "color"
-msgid "LavenderBlush"
-msgstr "Crvena lavanda"
-
-#: colors.cpp:90
-msgctxt "color"
-msgid "LavenderBlush1"
-msgstr "Crvena lavanda 1"
-
-#: colors.cpp:91
-msgctxt "color"
-msgid "LavenderBlush2"
-msgstr "Crvena lavanda 2"
-
-#: colors.cpp:92
-msgctxt "color"
-msgid "LavenderBlush3"
-msgstr "Crvena lavanda 3"
-
-#: colors.cpp:93
-msgctxt "color"
-msgid "LavenderBlush4"
-msgstr "Crvena lavanda 4"
-
-#: colors.cpp:94
-msgctxt "color"
-msgid "LawnGreen"
-msgstr "Livadno zelena"
-
-#: colors.cpp:95
-msgctxt "color"
-msgid "LemonChiffon"
-msgstr "Prozračno limunska"
-
-#: colors.cpp:96
-msgctxt "color"
-msgid "LemonChiffon1"
-msgstr "Prozračno limunska 1"
-
-#: colors.cpp:97
-msgctxt "color"
-msgid "LemonChiffon2"
-msgstr "Prozračno limunska 2"
-
-#: colors.cpp:98
-msgctxt "color"
-msgid "LemonChiffon3"
-msgstr "Prozračno limunska 3"
-
-#: colors.cpp:99
-msgctxt "color"
-msgid "LemonChiffon4"
-msgstr "Prozračno limunska 4"
-
-#: colors.cpp:100
-msgctxt "color"
-msgid "LightBlue"
-msgstr "Svijetloplava"
-
-#: colors.cpp:101
-msgctxt "color"
-msgid "LightBlue1"
-msgstr "Svijetloplava 1"
-
-#: colors.cpp:102
-msgctxt "color"
-msgid "LightBlue2"
-msgstr "Svijetloplava 2"
-
-#: colors.cpp:103
-msgctxt "color"
-msgid "LightBlue3"
-msgstr "Svijetloplava 3"
-
-#: colors.cpp:104
-msgctxt "color"
-msgid "LightBlue4"
-msgstr "Svijetloplava 4"
-
-#: colors.cpp:105
-msgctxt "color"
-msgid "LightCoral"
-msgstr "Svijetli koralj"
-
-#: colors.cpp:106
-msgctxt "color"
-msgid "LightCyan"
-msgstr "Svijetli cijan"
-
-#: colors.cpp:107
-msgctxt "color"
-msgid "LightCyan1"
-msgstr "Svijetli cijan 1"
-
-#: colors.cpp:108
-msgctxt "color"
-msgid "LightCyan2"
-msgstr "Svijetli cijan 2"
-
-#: colors.cpp:109
-msgctxt "color"
-msgid "LightCyan3"
-msgstr "Svijetli cijan 3"
-
-#: colors.cpp:110
-msgctxt "color"
-msgid "LightCyan4"
-msgstr "Svijetli cijan 4"
-
-#: colors.cpp:111
-msgctxt "color"
-msgid "LightGoldenrod"
-msgstr "Svijetla kudjelja"
-
-#: colors.cpp:112
-msgctxt "color"
-msgid "LightGoldenrod1"
-msgstr "Svijetla kudjelja 1"
-
-#: colors.cpp:113
-msgctxt "color"
-msgid "LightGoldenrod2"
-msgstr "Svijetla kudjelja 2"
-
-#: colors.cpp:114
-msgctxt "color"
-msgid "LightGoldenrod3"
-msgstr "Svijetla kudjelja 3"
-
-#: colors.cpp:115
-msgctxt "color"
-msgid "LightGoldenrod4"
-msgstr "Svijetla kudjelja 4"
-
-#: colors.cpp:116
-msgctxt "color"
-msgid "LightGoldenrodYellow"
-msgstr "Kudjeljasto svijetložuta"
-
-#: colors.cpp:117
-msgctxt "color"
-msgid "LightGray"
-msgstr "Svijetlosiva"
-
-#: colors.cpp:118
-msgctxt "color"
-msgid "LightGreen"
-msgstr "Svijetlozelena"
-
-#: colors.cpp:119
-msgctxt "color"
-msgid "LightGrey"
-msgstr "Svijetlo sijeda"
-
-#: colors.cpp:120
-msgctxt "color"
-msgid "LightPink"
-msgstr "Svijetloružičasta"
-
-#: colors.cpp:121
-msgctxt "color"
-msgid "LightPink1"
-msgstr "Svijetloružičasta 1"
-
-#: colors.cpp:122
-msgctxt "color"
-msgid "LightPink2"
-msgstr "Svijetloružičasta 2"
-
-#: colors.cpp:123
-msgctxt "color"
-msgid "LightPink3"
-msgstr "Svijetloružičasta 3"
-
-#: colors.cpp:124
-msgctxt "color"
-msgid "LightPink4"
-msgstr "Svijetloružičasta 4"
-
-#: colors.cpp:125
-msgctxt "color"
-msgid "LightSalmon"
-msgstr "Svijetli losos"
-
-#: colors.cpp:126
-msgctxt "color"
-msgid "LightSalmon1"
-msgstr "Svijetli losos 1"
-
-#: colors.cpp:127
-msgctxt "color"
-msgid "LightSalmon2"
-msgstr "Svijetli losos 2"
-
-#: colors.cpp:128
-msgctxt "color"
-msgid "LightSalmon3"
-msgstr "Svijetli losos 3"
-
-#: colors.cpp:129
-msgctxt "color"
-msgid "LightSalmon4"
-msgstr "Svijetli losos 4"
-
-#: colors.cpp:130
-msgctxt "color"
-msgid "LightSeaGreen"
-msgstr "Morsko svijetlozelena"
-
-#: colors.cpp:131
-msgctxt "color"
-msgid "LightSkyBlue"
-msgstr "Nebesko svijetloplava"
-
-#: colors.cpp:132
-msgctxt "color"
-msgid "LightSkyBlue1"
-msgstr "Nebesko svijetloplava 1"
-
-#: colors.cpp:133
-msgctxt "color"
-msgid "LightSkyBlue2"
-msgstr "Nebesko svijetloplava 2"
-
-#: colors.cpp:134
-msgctxt "color"
-msgid "LightSkyBlue3"
-msgstr "Nebesko svijetloplava 3"
-
-#: colors.cpp:135
-msgctxt "color"
-msgid "LightSkyBlue4"
-msgstr "Nebesko svijetloplava 4"
-
-#: colors.cpp:136
-msgctxt "color"
-msgid "LightSlateBlue"
-msgstr "Škriljevačko svijeloplava"
-
-#: colors.cpp:137
-msgctxt "color"
-msgid "LightSlateGray"
-msgstr "Škriljevačko svijelosiva"
-
-#: colors.cpp:138
-msgctxt "color"
-msgid "LightSlateGrey"
-msgstr "Škriljevačko svijelosiva"
-
-#: colors.cpp:139
-msgctxt "color"
-msgid "LightSteelBlue"
-msgstr "čelično svjetloplava"
-
-#: colors.cpp:140
-msgctxt "color"
-msgid "LightSteelBlue1"
-msgstr "čelično svjetloplava 1"
-
-#: colors.cpp:141
-msgctxt "color"
-msgid "LightSteelBlue2"
-msgstr "čelično svjetloplava 2"
-
-#: colors.cpp:142
-msgctxt "color"
-msgid "LightSteelBlue3"
-msgstr "čelično svjetloplava 3"
-
-#: colors.cpp:143
-msgctxt "color"
-msgid "LightSteelBlue4"
-msgstr "čelično svjetloplava 4"
-
-#: colors.cpp:144
-msgctxt "color"
-msgid "LightYellow"
-msgstr "Svijetložuta"
-
-#: colors.cpp:145
-msgctxt "color"
-msgid "LightYellow1"
-msgstr "Svijetložuta 1"
-
-#: colors.cpp:146
-msgctxt "color"
-msgid "LightYellow2"
-msgstr "Svijetložuta 2"
-
-#: colors.cpp:147
-msgctxt "color"
-msgid "LightYellow3"
-msgstr "Svijetložuta 3"
-
-#: colors.cpp:148
-msgctxt "color"
-msgid "LightYellow4"
-msgstr "Svijetložuta 4"
-
-#: colors.cpp:149
-msgctxt "color"
-msgid "LimeGreen"
-msgstr "Limun zelena"
-
-#: colors.cpp:150
-msgctxt "color"
-msgid "MediumAquamarine"
-msgstr "Umjerena akvamarin"
-
-#: colors.cpp:151
-msgctxt "color"
-msgid "MediumBlue"
-msgstr "Umjerena plava"
-
-#: colors.cpp:152
-msgctxt "color"
-msgid "MediumOrchid"
-msgstr "Umjerena orhideja"
-
-#: colors.cpp:153
-msgctxt "color"
-msgid "MediumOrchid1"
-msgstr "Umjerena orhideja 1"
-
-#: colors.cpp:154
-msgctxt "color"
-msgid "MediumOrchid2"
-msgstr "Umjerena orhideja 2"
-
-#: colors.cpp:155
-msgctxt "color"
-msgid "MediumOrchid3"
-msgstr "Umjerena orhideja 3"
-
-#: colors.cpp:156
-msgctxt "color"
-msgid "MediumOrchid4"
-msgstr "Umjerena orhideja 4"
-
-#: colors.cpp:157
-msgctxt "color"
-msgid "MediumPurple"
-msgstr "Umjerena ljubičasta"
-
-#: colors.cpp:158
-msgctxt "color"
-msgid "MediumPurple1"
-msgstr "Umjerena ljubičasta 1"
-
-#: colors.cpp:159
-msgctxt "color"
-msgid "MediumPurple2"
-msgstr "Umjerena ljubičasta 2"
-
-#: colors.cpp:160
-msgctxt "color"
-msgid "MediumPurple3"
-msgstr "Umjerena ljubičasta 3"
-
-#: colors.cpp:161
-msgctxt "color"
-msgid "MediumPurple4"
-msgstr "Umjerena ljubičasta 4"
-
-#: colors.cpp:162
-msgctxt "color"
-msgid "MediumSeaGreen"
-msgstr "Umjerena morsko zelena"
-
-#: colors.cpp:163
-msgctxt "color"
-msgid "MediumSlateBlue"
-msgstr "Umjereno škriljevačko plava"
-
-#: colors.cpp:164
-msgctxt "color"
-msgid "MediumSpringGreen"
-msgstr "Umjereno proljetno zelena"
-
-#: colors.cpp:165
-msgctxt "color"
-msgid "MediumTurquoise"
-msgstr "Umjereno tirkizna"
-
-#: colors.cpp:166
-msgctxt "color"
-msgid "MediumVioletRed"
-msgstr "Umjereno ljubičasto crvena"
-
-#: colors.cpp:167
-msgctxt "color"
-msgid "MidnightBlue"
-msgstr "Ponoćno plava"
-
-#: colors.cpp:168
-msgctxt "color"
-msgid "MintCream"
-msgstr "Menta"
-
-#: colors.cpp:169
-msgctxt "color"
-msgid "MistyRose"
-msgstr "Nejasna ruža"
-
-#: colors.cpp:170
-msgctxt "color"
-msgid "MistyRose1"
-msgstr "Nejasna ruža 1"
-
-#: colors.cpp:171
-msgctxt "color"
-msgid "MistyRose2"
-msgstr "Nejasna ruža 2"
-
-#: colors.cpp:172
-msgctxt "color"
-msgid "MistyRose3"
-msgstr "Nejasna ruža 3"
-
-#: colors.cpp:173
-msgctxt "color"
-msgid "MistyRose4"
-msgstr "Nejasna ruža 4"
-
-#: colors.cpp:174
-msgctxt "color"
-msgid "NavajoWhite"
-msgstr "Smeđkasto bijela"
-
-#: colors.cpp:175
-msgctxt "color"
-msgid "NavajoWhite1"
-msgstr "Smeđkasto bijela 1"
-
-#: colors.cpp:176
-msgctxt "color"
-msgid "NavajoWhite2"
-msgstr "Smeđkasto bijela 2"
-
-#: colors.cpp:177
-msgctxt "color"
-msgid "NavajoWhite3"
-msgstr "Smeđkasto bijela 3"
-
-#: colors.cpp:178
-msgctxt "color"
-msgid "NavajoWhite4"
-msgstr "Smeđkasto bijela 4"
-
-#: colors.cpp:179
-msgctxt "color"
-msgid "NavyBlue"
-msgstr "mornarsko plava"
-
-#: colors.cpp:180
-msgctxt "color"
-msgid "OldLace"
-msgstr "Stara čipka"
-
-#: colors.cpp:181
-msgctxt "color"
-msgid "OliveDrab"
-msgstr "prljavomaslinasta"
-
-#: colors.cpp:182
-msgctxt "color"
-msgid "OliveDrab1"
-msgstr "prljavomaslinasta 1"
-
-#: colors.cpp:183
-msgctxt "color"
-msgid "OliveDrab2"
-msgstr "prljavomaslinasta 2"
-
-#: colors.cpp:184
-msgctxt "color"
-msgid "OliveDrab3"
-msgstr "prljavomaslinasta 3"
-
-#: colors.cpp:185
-msgctxt "color"
-msgid "OliveDrab4"
-msgstr "prljavomaslinasta 4"
-
-#: colors.cpp:186
-msgctxt "color"
-msgid "OrangeRed"
-msgstr "Narančastocrvena"
-
-#: colors.cpp:187
-msgctxt "color"
-msgid "OrangeRed1"
-msgstr "Narančastocrvena 1"
-
-#: colors.cpp:188
-msgctxt "color"
-msgid "OrangeRed2"
-msgstr "Narančastocrvena 2"
-
-#: colors.cpp:189
-msgctxt "color"
-msgid "OrangeRed3"
-msgstr "Narančastocrvena 3"
-
-#: colors.cpp:190
-msgctxt "color"
-msgid "OrangeRed4"
-msgstr "Narančastocrvena 4"
-
-#: colors.cpp:191
-msgctxt "color"
-msgid "PaleGoldenrod"
-msgstr "Blijedo kudjeljasta"
-
-#: colors.cpp:192
-msgctxt "color"
-msgid "PaleGreen"
-msgstr "Blijedo zelena"
-
-#: colors.cpp:193
-msgctxt "color"
-msgid "PaleGreen1"
-msgstr "Blijedo zelena 1"
-
-#: colors.cpp:194
-msgctxt "color"
-msgid "PaleGreen2"
-msgstr "Blijedo zelena 2"
-
-#: colors.cpp:195
-msgctxt "color"
-msgid "PaleGreen3"
-msgstr "Blijedo zelena 3"
-
-#: colors.cpp:196
-msgctxt "color"
-msgid "PaleGreen4"
-msgstr "Blijedo zelena 4"
-
-#: colors.cpp:197
-msgctxt "color"
-msgid "PaleTurquoise"
-msgstr "Blijedo tirkizna"
-
-#: colors.cpp:198
-msgctxt "color"
-msgid "PaleTurquoise1"
-msgstr "Blijedo tirkizna 1"
-
-#: colors.cpp:199
-msgctxt "color"
-msgid "PaleTurquoise2"
-msgstr "Blijedo tirkizna 2"
-
-#: colors.cpp:200
-msgctxt "color"
-msgid "PaleTurquoise3"
-msgstr "Blijedo tirkizna 3"
-
-#: colors.cpp:201
-msgctxt "color"
-msgid "PaleTurquoise4"
-msgstr "Blijedo tirkizna 4"
-
-#: colors.cpp:202
-msgctxt "color"
-msgid "PaleVioletRed"
-msgstr "Blijeda ljubičastocrvena"
-
-#: colors.cpp:203
-msgctxt "color"
-msgid "PaleVioletRed1"
-msgstr "Blijeda ljubičastocrvena 1"
-
-#: colors.cpp:204
-msgctxt "color"
-msgid "PaleVioletRed2"
-msgstr "Blijeda ljubičastocrvena 2"
-
-#: colors.cpp:205
-msgctxt "color"
-msgid "PaleVioletRed3"
-msgstr "Blijeda ljubičastocrvena 3"
-
-#: colors.cpp:206
-msgctxt "color"
-msgid "PaleVioletRed4"
-msgstr "Blijeda ljubičastocrvena 4"
-
-#: colors.cpp:207
-msgctxt "color"
-msgid "PapayaWhip"
-msgstr "Papaja"
-
-#: colors.cpp:208
-msgctxt "color"
-msgid "PeachPuff"
-msgstr "Breskvasta"
-
-#: colors.cpp:209
-msgctxt "color"
-msgid "PeachPuff1"
-msgstr "Breskvasta 1"
-
-#: colors.cpp:210
-msgctxt "color"
-msgid "PeachPuff2"
-msgstr "Breskvasta 2"
-
-#: colors.cpp:211
-msgctxt "color"
-msgid "PeachPuff3"
-msgstr "Breskvasta 3"
-
-#: colors.cpp:212
-msgctxt "color"
-msgid "PeachPuff4"
-msgstr "Breskvasta 4"
-
-#: colors.cpp:213
-msgctxt "color"
-msgid "PowderBlue"
-msgstr "Plavi prah"
-
-#: colors.cpp:214
-msgctxt "color"
-msgid "RosyBrown"
-msgstr "Ružičastosmeđa"
-
-#: colors.cpp:215
-msgctxt "color"
-msgid "RosyBrown1"
-msgstr "Ružičastosmeđa 1"
-
-#: colors.cpp:216
-msgctxt "color"
-msgid "RosyBrown2"
-msgstr "Ružičastosmeđa 2"
-
-#: colors.cpp:217
-msgctxt "color"
-msgid "RosyBrown3"
-msgstr "Ružičastosmeđa 3"
-
-#: colors.cpp:218
-msgctxt "color"
-msgid "RosyBrown4"
-msgstr "Ružičastosmeđa 4"
-
-#: colors.cpp:219
-msgctxt "color"
-msgid "RoyalBlue"
-msgstr "Kraljevski plava"
-
-#: colors.cpp:220
-msgctxt "color"
-msgid "RoyalBlue1"
-msgstr "Kraljevski plava 1"
-
-#: colors.cpp:221
-msgctxt "color"
-msgid "RoyalBlue2"
-msgstr "Kraljevski plava 2"
-
-#: colors.cpp:222
-msgctxt "color"
-msgid "RoyalBlue3"
-msgstr "Kraljevski plava 3"
-
-#: colors.cpp:223
-msgctxt "color"
-msgid "RoyalBlue4"
-msgstr "Kraljevski plava 4"
-
-#: colors.cpp:224
-msgctxt "color"
-msgid "SaddleBrown"
-msgstr "Smeđe sedlo"
-
-#: colors.cpp:225
-msgctxt "color"
-msgid "SandyBrown"
-msgstr "Smeđi pijesak"
-
-#: colors.cpp:226
-msgctxt "color"
-msgid "SeaGreen"
-msgstr "Morsko zelena"
-
-#: colors.cpp:227
-msgctxt "color"
-msgid "SeaGreen1"
-msgstr "Morsko zelena 1"
-
-#: colors.cpp:228
-msgctxt "color"
-msgid "SeaGreen2"
-msgstr "Morsko zelena 2"
-
-#: colors.cpp:229
-msgctxt "color"
-msgid "SeaGreen3"
-msgstr "Morsko zelena 3"
-
-#: colors.cpp:230
-msgctxt "color"
-msgid "SeaGreen4"
-msgstr "Morsko zelena 4"
-
-#: colors.cpp:231
-msgctxt "color"
-msgid "SkyBlue"
-msgstr "Nebeski plava"
-
-#: colors.cpp:232
-msgctxt "color"
-msgid "SkyBlue1"
-msgstr "Nebeski plava 1"
-
-#: colors.cpp:233
-msgctxt "color"
-msgid "SkyBlue2"
-msgstr "Nebeski plava 2"
-
-#: colors.cpp:234
-msgctxt "color"
-msgid "SkyBlue3"
-msgstr "Nebeski plava 3"
-
-#: colors.cpp:235
-msgctxt "color"
-msgid "SkyBlue4"
-msgstr "Nebeski plava 4"
-
-#: colors.cpp:236
-msgctxt "color"
-msgid "SlateBlue"
-msgstr "Škriljevačko plava"
-
-#: colors.cpp:237
-msgctxt "color"
-msgid "SlateBlue1"
-msgstr "Škriljevačko plava 1"
-
-#: colors.cpp:238
-msgctxt "color"
-msgid "SlateBlue2"
-msgstr "Škriljevačko plava 2"
-
-#: colors.cpp:239
-msgctxt "color"
-msgid "SlateBlue3"
-msgstr "Škriljevačko plava 3"
-
-#: colors.cpp:240
-msgctxt "color"
-msgid "SlateBlue4"
-msgstr "Škriljevačko plava 4"
-
-#: colors.cpp:241
-msgctxt "color"
-msgid "SlateGray"
-msgstr "Škriljevačko siva"
-
-#: colors.cpp:242
-msgctxt "color"
-msgid "SlateGray1"
-msgstr "Škriljevačko siva 1"
-
-#: colors.cpp:243
-msgctxt "color"
-msgid "SlateGray2"
-msgstr "Škriljevačko siva 2"
-
-#: colors.cpp:244
-msgctxt "color"
-msgid "SlateGray3"
-msgstr "Škriljevačko siva 3"
-
-#: colors.cpp:245
-msgctxt "color"
-msgid "SlateGray4"
-msgstr "Škriljevačko siva 4"
-
-#: colors.cpp:246
-msgctxt "color"
-msgid "SlateGrey"
-msgstr "Škriljevačko sijeda"
-
-#: colors.cpp:247
-msgctxt "color"
-msgid "SpringGreen"
-msgstr "Proljetno zelena"
-
-#: colors.cpp:248
-msgctxt "color"
-msgid "SpringGreen1"
-msgstr "Proljetno zelena 1"
-
-#: colors.cpp:249
-msgctxt "color"
-msgid "SpringGreen2"
-msgstr "Proljetno zelena 2"
-
-#: colors.cpp:250
-msgctxt "color"
-msgid "SpringGreen3"
-msgstr "Proljetno zelena 3"
-
-#: colors.cpp:251
-msgctxt "color"
-msgid "SpringGreen4"
-msgstr "Proljetno zelena 4"
-
-#: colors.cpp:252
-msgctxt "color"
-msgid "SteelBlue"
-msgstr "čelično plava"
-
-#: colors.cpp:253
-msgctxt "color"
-msgid "SteelBlue1"
-msgstr "čelično plava 1"
-
-#: colors.cpp:254
-msgctxt "color"
-msgid "SteelBlue2"
-msgstr "čelično plava 2"
-
-#: colors.cpp:255
-msgctxt "color"
-msgid "SteelBlue3"
-msgstr "čelično plava 3"
-
-#: colors.cpp:256
-msgctxt "color"
-msgid "SteelBlue4"
-msgstr "čelično plava 4"
-
-#: colors.cpp:257
-msgctxt "color"
-msgid "VioletRed"
-msgstr "Ljubičastocrvena"
-
-#: colors.cpp:258
-msgctxt "color"
-msgid "VioletRed1"
-msgstr "Ljubičastocrvena 1"
-
-#: colors.cpp:259
-msgctxt "color"
-msgid "VioletRed2"
-msgstr "Ljubičastocrvena 2"
-
-#: colors.cpp:260
-msgctxt "color"
-msgid "VioletRed3"
-msgstr "Ljubičastocrvena 3"
-
-#: colors.cpp:261
-msgctxt "color"
-msgid "VioletRed4"
-msgstr "Ljubičastocrvena 4"
-
-#: colors.cpp:262
-msgctxt "color"
-msgid "WhiteSmoke"
-msgstr "dim"
-
-#: colors.cpp:263
-msgctxt "color"
-msgid "YellowGreen"
-msgstr "Žutozelena"
-
-#: colors.cpp:264
-msgctxt "color"
-msgid "aquamarine"
-msgstr "akvamarin"
-
-#: colors.cpp:265
-msgctxt "color"
-msgid "aquamarine1"
-msgstr "akvamarin 1"
-
-#: colors.cpp:266
-msgctxt "color"
-msgid "aquamarine2"
-msgstr "akvamarin 2"
-
-#: colors.cpp:267
-msgctxt "color"
-msgid "aquamarine3"
-msgstr "akvamarin 3"
-
-#: colors.cpp:268
-msgctxt "color"
-msgid "aquamarine4"
-msgstr "akvamarin 4"
-
-#: colors.cpp:269
-msgctxt "color"
-msgid "azure"
-msgstr "azurna"
-
-#: colors.cpp:270
-msgctxt "color"
-msgid "azure1"
-msgstr "azurna 1"
-
-#: colors.cpp:271
-msgctxt "color"
-msgid "azure2"
-msgstr "azurna 2"
-
-#: colors.cpp:272
-msgctxt "color"
-msgid "azure3"
-msgstr "azurna 3"
-
-#: colors.cpp:273
-msgctxt "color"
-msgid "azure4"
-msgstr "azurna 4"
-
-#: colors.cpp:274
-msgctxt "color"
-msgid "beige"
-msgstr "bež"
-
-#: colors.cpp:275
-msgctxt "color"
-msgid "bisque"
-msgstr "porculanska"
-
-#: colors.cpp:276
-msgctxt "color"
-msgid "bisque1"
-msgstr "porculanska 1"
-
-#: colors.cpp:277
-msgctxt "color"
-msgid "bisque2"
-msgstr "porculanska 2"
-
-#: colors.cpp:278
-msgctxt "color"
-msgid "bisque3"
-msgstr "porculanska 3"
-
-#: colors.cpp:279
-msgctxt "color"
-msgid "bisque4"
-msgstr "porculanska 4"
-
-#: colors.cpp:280
-msgctxt "color"
-msgid "black"
-msgstr "crna"
-
-#: colors.cpp:281
-msgctxt "color"
-msgid "blue"
-msgstr "plava"
-
-#: colors.cpp:282
-msgctxt "color"
-msgid "blue1"
-msgstr "plava 1"
-
-#: colors.cpp:283
-msgctxt "color"
-msgid "blue2"
-msgstr "plava 2"
-
-#: colors.cpp:284
-msgctxt "color"
-msgid "blue3"
-msgstr "plava 3"
-
-#: colors.cpp:285
-msgctxt "color"
-msgid "blue4"
-msgstr "plava 4"
-
-#: colors.cpp:286
-msgctxt "color"
-msgid "brown"
-msgstr "smeđa"
-
-#: colors.cpp:287
-msgctxt "color"
-msgid "brown1"
-msgstr "smeđa 1"
-
-#: colors.cpp:288
-msgctxt "color"
-msgid "brown2"
-msgstr "smeđa 2"
-
-#: colors.cpp:289
-msgctxt "color"
-msgid "brown3"
-msgstr "smeđa 3"
-
-#: colors.cpp:290
-msgctxt "color"
-msgid "brown4"
-msgstr "smeđa 4"
-
-#: colors.cpp:291
-msgctxt "color"
-msgid "burlywood"
-msgstr "Svijetlo drvo"
-
-#: colors.cpp:292
-msgctxt "color"
-msgid "burlywood1"
-msgstr "Svijetlo drvo 1"
-
-#: colors.cpp:293
-msgctxt "color"
-msgid "burlywood2"
-msgstr "Svijetlo drvo 2"
-
-#: colors.cpp:294
-msgctxt "color"
-msgid "burlywood3"
-msgstr "Svijetlo drvo 3"
-
-#: colors.cpp:295
-msgctxt "color"
-msgid "burlywood4"
-msgstr "Svijetlo drvo 4"
-
-#: colors.cpp:296
-msgctxt "color"
-msgid "chartreuse"
-msgstr "Zeleni liker"
-
-#: colors.cpp:297
-msgctxt "color"
-msgid "chartreuse1"
-msgstr "Zeleni liker 1"
-
-#: colors.cpp:298
-msgctxt "color"
-msgid "chartreuse2"
-msgstr "Zeleni liker 2"
-
-#: colors.cpp:299
-msgctxt "color"
-msgid "chartreuse3"
-msgstr "Zeleni liker 3"
-
-#: colors.cpp:300
-msgctxt "color"
-msgid "chartreuse4"
-msgstr "Zeleni liker 4"
-
-#: colors.cpp:301
-msgctxt "color"
-msgid "chocolate"
-msgstr "čokoladna"
-
-#: colors.cpp:302
-msgctxt "color"
-msgid "chocolate1"
-msgstr "čokoladna 1"
-
-#: colors.cpp:303
-msgctxt "color"
-msgid "chocolate2"
-msgstr "čokoladna 2"
-
-#: colors.cpp:304
-msgctxt "color"
-msgid "chocolate3"
-msgstr "čokoladna 3"
-
-#: colors.cpp:305
-msgctxt "color"
-msgid "chocolate4"
-msgstr "čokoladna 4"
-
-#: colors.cpp:306
-msgctxt "color"
-msgid "coral"
-msgstr "koraljna"
-
-#: colors.cpp:307
-msgctxt "color"
-msgid "coral1"
-msgstr "koraljna 1"
-
-#: colors.cpp:308
-msgctxt "color"
-msgid "coral2"
-msgstr "koraljna 2"
-
-#: colors.cpp:309
-msgctxt "color"
-msgid "coral3"
-msgstr "koraljna 3"
-
-#: colors.cpp:310
-msgctxt "color"
-msgid "coral4"
-msgstr "koraljna 4"
-
-#: colors.cpp:311
-msgctxt "color"
-msgid "cornsilk"
-msgstr "žutosvilena"
-
-#: colors.cpp:312
-msgctxt "color"
-msgid "cornsilk1"
-msgstr "žutosvilena 1"
-
-#: colors.cpp:313
-msgctxt "color"
-msgid "cornsilk2"
-msgstr "žutosvilena 2"
-
-#: colors.cpp:314
-msgctxt "color"
-msgid "cornsilk3"
-msgstr "žutosvilena 3"
-
-#: colors.cpp:315
-msgctxt "color"
-msgid "cornsilk4"
-msgstr "žutosvilena 4"
-
-#: colors.cpp:316
-msgctxt "color"
-msgid "cyan"
-msgstr "cijan"
-
-#: colors.cpp:317
-msgctxt "color"
-msgid "cyan1"
-msgstr "cijan 1"
-
-#: colors.cpp:318
-msgctxt "color"
-msgid "cyan2"
-msgstr "cijan 2"
-
-#: colors.cpp:319
-msgctxt "color"
-msgid "cyan3"
-msgstr "cijan 3"
-
-#: colors.cpp:320
-msgctxt "color"
-msgid "cyan4"
-msgstr "cijan 4"
-
-#: colors.cpp:321
-msgctxt "color"
-msgid "firebrick"
-msgstr "šamotna opeka"
-
-#: colors.cpp:322
-msgctxt "color"
-msgid "firebrick1"
-msgstr "šamotna opeka 1"
-
-#: colors.cpp:323
-msgctxt "color"
-msgid "firebrick2"
-msgstr "šamotna opeka 2"
-
-#: colors.cpp:324
-msgctxt "color"
-msgid "firebrick3"
-msgstr "šamotna opeka 3"
-
-#: colors.cpp:325
-msgctxt "color"
-msgid "firebrick4"
-msgstr "šamotna opeka 4"
-
-#: colors.cpp:326
-msgctxt "color"
-msgid "gainsboro"
-msgstr "Gainsboro"
-
-#: colors.cpp:327
-msgctxt "color"
-msgid "gold"
-msgstr "zlatna"
-
-#: colors.cpp:328
-msgctxt "color"
-msgid "gold1"
-msgstr "zlatna 1"
-
-#: colors.cpp:329
-msgctxt "color"
-msgid "gold2"
-msgstr "zlatna 2"
-
-#: colors.cpp:330
-msgctxt "color"
-msgid "gold3"
-msgstr "zlatna 3"
-
-#: colors.cpp:331
-msgctxt "color"
-msgid "gold4"
-msgstr "zlatna 4"
-
-#: colors.cpp:332
-msgctxt "color"
-msgid "goldenrod"
-msgstr "kudjelja"
-
-#: colors.cpp:333
-msgctxt "color"
-msgid "goldenrod1"
-msgstr "kudjelja 1"
-
-#: colors.cpp:334
-msgctxt "color"
-msgid "goldenrod2"
-msgstr "kudjelja 2"
-
-#: colors.cpp:335
-msgctxt "color"
-msgid "goldenrod3"
-msgstr "kudjelja 3"
-
-#: colors.cpp:336
-msgctxt "color"
-msgid "goldenrod4"
-msgstr "kudjelja 4"
-
-#: colors.cpp:337
-msgctxt "color"
-msgid "green"
-msgstr "zelena"
-
-#: colors.cpp:338
-msgctxt "color"
-msgid "green1"
-msgstr "zelena 1"
-
-#: colors.cpp:339
-msgctxt "color"
-msgid "green2"
-msgstr "zelena 2"
-
-#: colors.cpp:340
-msgctxt "color"
-msgid "green3"
-msgstr "zelena 3"
-
-#: colors.cpp:341
-msgctxt "color"
-msgid "green4"
-msgstr "zelena 4"
-
-#: colors.cpp:342
-msgctxt "color"
-msgid "honeydew"
-msgstr "medljika"
-
-#: colors.cpp:343
-msgctxt "color"
-msgid "honeydew1"
-msgstr "medljika 1"
-
-#: colors.cpp:344
-msgctxt "color"
-msgid "honeydew2"
-msgstr "medljika 2"
-
-#: colors.cpp:345
-msgctxt "color"
-msgid "honeydew3"
-msgstr "medljika 3"
-
-#: colors.cpp:346
-msgctxt "color"
-msgid "honeydew4"
-msgstr "medljika 4"
-
-#: colors.cpp:347
-msgctxt "color"
-msgid "ivory"
-msgstr "bjelokost"
-
-#: colors.cpp:348
-msgctxt "color"
-msgid "ivory1"
-msgstr "bjelokost 1"
-
-#: colors.cpp:349
-msgctxt "color"
-msgid "ivory2"
-msgstr "bjelokost 2"
-
-#: colors.cpp:350
-msgctxt "color"
-msgid "ivory3"
-msgstr "bjelokost 3"
-
-#: colors.cpp:351
-msgctxt "color"
-msgid "ivory4"
-msgstr "bjelokost 4"
-
-#: colors.cpp:352
-msgctxt "color"
-msgid "khaki"
-msgstr "sivožuta"
-
-#: colors.cpp:353
-msgctxt "color"
-msgid "khaki1"
-msgstr "sivožuta 1"
-
-#: colors.cpp:354
-msgctxt "color"
-msgid "khaki2"
-msgstr "sivožuta 2"
-
-#: colors.cpp:355
-msgctxt "color"
-msgid "khaki3"
-msgstr "sivožuta 3"
-
-#: colors.cpp:356
-msgctxt "color"
-msgid "khaki4"
-msgstr "sivožuta 4"
-
-#: colors.cpp:357
-msgctxt "color"
-msgid "lavender"
-msgstr "lavanda"
-
-#: colors.cpp:358
-msgctxt "color"
-msgid "linen"
-msgstr "lanena"
-
-#: colors.cpp:359
-msgctxt "color"
-msgid "magenta"
-msgstr "magenta"
-
-#: colors.cpp:360
-msgctxt "color"
-msgid "magenta1"
-msgstr "magenta 1"
-
-#: colors.cpp:361
-msgctxt "color"
-msgid "magenta2"
-msgstr "magenta 2"
-
-#: colors.cpp:362
-msgctxt "color"
-msgid "magenta3"
-msgstr "magenta 2"
-
-#: colors.cpp:363
-msgctxt "color"
-msgid "magenta4"
-msgstr "magenta 3"
-
-#: colors.cpp:364
-msgctxt "color"
-msgid "maroon"
-msgstr "Kestenjasta"
-
-#: colors.cpp:365
-msgctxt "color"
-msgid "maroon1"
-msgstr "Kestenjasta 1"
-
-#: colors.cpp:366
-msgctxt "color"
-msgid "maroon2"
-msgstr "Kestenjasta 2"
-
-#: colors.cpp:367
-msgctxt "color"
-msgid "maroon3"
-msgstr "Kestenjasta 3"
-
-#: colors.cpp:368
-msgctxt "color"
-msgid "maroon4"
-msgstr "Kestenjasta 4"
-
-#: colors.cpp:369
-msgctxt "color"
-msgid "moccasin"
-msgstr "jelenska koža"
-
-#: colors.cpp:370
-msgctxt "color"
-msgid "navy"
-msgstr "mornarska"
-
-#: colors.cpp:371
-msgctxt "color"
-msgid "orange"
-msgstr "narančasta"
-
-#: colors.cpp:372
-msgctxt "color"
-msgid "orange1"
-msgstr "narančasta 1"
-
-#: colors.cpp:373
-msgctxt "color"
-msgid "orange2"
-msgstr "narančasta 2"
-
-#: colors.cpp:374
-msgctxt "color"
-msgid "orange3"
-msgstr "narančasta 3"
-
-#: colors.cpp:375
-msgctxt "color"
-msgid "orange4"
-msgstr "narančasta 4"
-
-#: colors.cpp:376
-msgctxt "color"
-msgid "orchid"
-msgstr "orhideja"
-
-#: colors.cpp:377
-msgctxt "color"
-msgid "orchid1"
-msgstr "orhideja 1"
-
-#: colors.cpp:378
-msgctxt "color"
-msgid "orchid2"
-msgstr "orhideja 2"
-
-#: colors.cpp:379
-msgctxt "color"
-msgid "orchid3"
-msgstr "orhideja 3"
-
-#: colors.cpp:380
-msgctxt "color"
-msgid "orchid4"
-msgstr "orhideja 4"
-
-#: colors.cpp:381
-msgctxt "color"
-msgid "peru"
-msgstr "peru"
-
-#: colors.cpp:382
-msgctxt "color"
-msgid "pink"
-msgstr "ružičasta"
-
-#: colors.cpp:383
-msgctxt "color"
-msgid "pink1"
-msgstr "ružičasta"
-
-#: colors.cpp:384
-msgctxt "color"
-msgid "pink2"
-msgstr "ružičasta 2"
-
-#: colors.cpp:385
-msgctxt "color"
-msgid "pink3"
-msgstr "ružičasta 3"
-
-#: colors.cpp:386
-msgctxt "color"
-msgid "pink4"
-msgstr "ružičasta 4"
-
-#: colors.cpp:387
-msgctxt "color"
-msgid "plum"
-msgstr "šljiva"
-
-#: colors.cpp:388
-msgctxt "color"
-msgid "plum1"
-msgstr "šljiva 1"
-
-#: colors.cpp:389
-msgctxt "color"
-msgid "plum2"
-msgstr "šljiva 2"
-
-#: colors.cpp:390
-msgctxt "color"
-msgid "plum3"
-msgstr "šljiva 3"
-
-#: colors.cpp:391
-msgctxt "color"
-msgid "plum4"
-msgstr "šljiva 4"
-
-#: colors.cpp:392
-msgctxt "color"
-msgid "purple"
-msgstr "ljubičasta"
-
-#: colors.cpp:393
-msgctxt "color"
-msgid "purple1"
-msgstr "ljubičasta 1"
-
-#: colors.cpp:394
-msgctxt "color"
-msgid "purple2"
-msgstr "ljubičasta 2"
-
-#: colors.cpp:395
-msgctxt "color"
-msgid "purple3"
-msgstr "ljubičasta 3"
-
-#: colors.cpp:396
-msgctxt "color"
-msgid "purple4"
-msgstr "ljubičasta 4"
-
-#: colors.cpp:397
-msgctxt "color"
-msgid "red"
-msgstr "crvena"
-
-#: colors.cpp:398
-msgctxt "color"
-msgid "red1"
-msgstr "crvena 1"
-
-#: colors.cpp:399
-msgctxt "color"
-msgid "red2"
-msgstr "crvena 2"
-
-#: colors.cpp:400
-msgctxt "color"
-msgid "red3"
-msgstr "crvena 3"
-
-#: colors.cpp:401
-msgctxt "color"
-msgid "red4"
-msgstr "crvena 4"
-
-#: colors.cpp:402
-msgctxt "color"
-msgid "salmon"
-msgstr "losos"
-
-#: colors.cpp:403
-msgctxt "color"
-msgid "salmon1"
-msgstr "losos 1"
-
-#: colors.cpp:404
-msgctxt "color"
-msgid "salmon2"
-msgstr "losos 2"
-
-#: colors.cpp:405
-msgctxt "color"
-msgid "salmon3"
-msgstr "losos 3"
-
-#: colors.cpp:406
-msgctxt "color"
-msgid "salmon4"
-msgstr "losos 4"
-
-#: colors.cpp:407
-msgctxt "color"
-msgid "seashell"
-msgstr "školjka"
-
-#: colors.cpp:408
-msgctxt "color"
-msgid "seashell1"
-msgstr "školjka 1"
-
-#: colors.cpp:409
-msgctxt "color"
-msgid "seashell2"
-msgstr "školjka 2"
-
-#: colors.cpp:410
-msgctxt "color"
-msgid "seashell3"
-msgstr "školjka 3"
-
-#: colors.cpp:411
-msgctxt "color"
-msgid "seashell4"
-msgstr "školjka 4"
-
-#: colors.cpp:412
-msgctxt "color"
-msgid "sienna"
-msgstr "crvenosmeđa glina"
-
-#: colors.cpp:413
-msgctxt "color"
-msgid "sienna1"
-msgstr "crvenosmeđa glina 1"
-
-#: colors.cpp:414
-msgctxt "color"
-msgid "sienna2"
-msgstr "crvenosmeđa glina 2"
-
-#: colors.cpp:415
-msgctxt "color"
-msgid "sienna3"
-msgstr "crvenosmeđa glina 3"
-
-#: colors.cpp:416
-msgctxt "color"
-msgid "sienna4"
-msgstr "crvenosmeđa glina 4"
-
-#: colors.cpp:417
-msgctxt "color"
-msgid "snow"
-msgstr "snježna"
-
-#: colors.cpp:418
-msgctxt "color"
-msgid "snow1"
-msgstr "snježna 1"
-
-#: colors.cpp:419
-msgctxt "color"
-msgid "snow2"
-msgstr "snježna 2"
-
-#: colors.cpp:420
-msgctxt "color"
-msgid "snow3"
-msgstr "snježna 3"
-
-#: colors.cpp:421
-msgctxt "color"
-msgid "snow4"
-msgstr "snježna 4"
-
-#: colors.cpp:422
-msgctxt "color"
-msgid "tan"
-msgstr "brončana"
-
-#: colors.cpp:423
-msgctxt "color"
-msgid "tan1"
-msgstr "brončana 1"
-
-#: colors.cpp:424
-msgctxt "color"
-msgid "tan2"
-msgstr "brončana 2"
-
-#: colors.cpp:425
-msgctxt "color"
-msgid "tan3"
-msgstr "brončana 3"
-
-#: colors.cpp:426
-msgctxt "color"
-msgid "tan4"
-msgstr "brončana 4"
-
-#: colors.cpp:427
-msgctxt "color"
-msgid "thistle"
-msgstr "čičak"
-
-#: colors.cpp:428
-msgctxt "color"
-msgid "thistle1"
-msgstr "čičak 1"
-
-#: colors.cpp:429
-msgctxt "color"
-msgid "thistle2"
-msgstr "čičak 2"
-
-#: colors.cpp:430
-msgctxt "color"
-msgid "thistle3"
-msgstr "čičak 3"
-
-#: colors.cpp:431
-msgctxt "color"
-msgid "thistle4"
-msgstr "čičak 4"
-
-#: colors.cpp:432
-msgctxt "color"
-msgid "tomato"
-msgstr "rajčica"
-
-#: colors.cpp:433
-msgctxt "color"
-msgid "tomato1"
-msgstr "rajčica 1"
-
-#: colors.cpp:434
-msgctxt "color"
-msgid "tomato2"
-msgstr "rajčica 2"
-
-#: colors.cpp:435
-msgctxt "color"
-msgid "tomato3"
-msgstr "rajčica 3"
-
-#: colors.cpp:436
-msgctxt "color"
-msgid "tomato4"
-msgstr "rajčica 4"
-
-#: colors.cpp:437
-msgctxt "color"
-msgid "turquoise"
-msgstr "tirkizna"
-
-#: colors.cpp:438
-msgctxt "color"
-msgid "turquoise1"
-msgstr "tirkizna 1"
-
-#: colors.cpp:439
-msgctxt "color"
-msgid "turquoise2"
-msgstr "tirkizna 2"
-
-#: colors.cpp:440
-msgctxt "color"
-msgid "turquoise3"
-msgstr "tirkizna 3"
-
-#: colors.cpp:441
-msgctxt "color"
-msgid "turquoise4"
-msgstr "tirkizna 4"
-
-#: colors.cpp:442
-msgctxt "color"
-msgid "violet"
-msgstr "ljubičasta"
-
-#: colors.cpp:443
-msgctxt "color"
-msgid "wheat"
-msgstr "pšenična"
-
-#: colors.cpp:444
-msgctxt "color"
-msgid "wheat1"
-msgstr "pšenična 1"
-
-#: colors.cpp:445
-msgctxt "color"
-msgid "wheat2"
-msgstr "pšenična 2"
-
-#: colors.cpp:446
-msgctxt "color"
-msgid "wheat3"
-msgstr "pšenična 3"
-
-#: colors.cpp:447
-msgctxt "color"
-msgid "wheat4"
-msgstr "pšenična 4"
-
-#: colors.cpp:448
-msgctxt "color"
-msgid "white"
-msgstr "bijela"
-
-#: colors.cpp:449
-msgctxt "color"
-msgid "yellow"
-msgstr "žuta"
-
-#: colors.cpp:450
-msgctxt "color"
-msgid "yellow1"
-msgstr "žuta 1"
-
-#: colors.cpp:451
-msgctxt "color"
-msgid "yellow2"
-msgstr "žuta 2"
-
-#: colors.cpp:452
-msgctxt "color"
-msgid "yellow3"
-msgstr "žuta 3"
-
-#: colors.cpp:453
-msgctxt "color"
-msgid "yellow4"
-msgstr "žuta 4"
diff -Nru kde-l10n-hr-4.12.97/messages/frameworks/kfileaudiopreview5.po kde-l10n-hr-4.13.0/messages/frameworks/kfileaudiopreview5.po
--- kde-l10n-hr-4.12.97/messages/frameworks/kfileaudiopreview5.po 2014-01-25 21:41:22.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/frameworks/kfileaudiopreview5.po 1970-01-01 00:00:00.000000000 +0000
@@ -1,42 +0,0 @@
-# Translation of kfileaudiopreview4 to Croatian
-#
-# Andrej Dundović , 2009.
-msgid ""
-msgstr ""
-"Project-Id-Version: kfileaudiopreview4\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2014-01-24 18:50+0000\n"
-"PO-Revision-Date: 2009-06-21 10:23+0200\n"
-"Last-Translator: Andrej Dundović \n"
-"Language-Team: Croatian \n"
-"Language: hr\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n"
-"%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"X-Generator: Lokalize 0.3\n"
-"X-Environment: kde\n"
-"X-Accelerator-Marker: &\n"
-"X-Text-Markup: kde4\n"
-
-#: kfileaudiopreview.cpp:80
-msgid "Play &automatically"
-msgstr "&Automatski pokreni"
-
-#: mediacontrols_p.h:51
-msgid "start playback"
-msgstr "Pokreni reprodukciju"
-
-#: mediacontrols_p.h:56
-msgid "pause playback"
-msgstr "Pauziraj reprodukciju"
-
-#~ msgid "stop playback"
-#~ msgstr "Zaustavi reprodukciju"
-
-#~ msgid "loop: restarts playback at end"
-#~ msgstr "petlja: ponovno pokreni reprodukciju na završetku"
-
-#~ msgid "Media Player"
-#~ msgstr "Multimedijski svirač"
diff -Nru kde-l10n-hr-4.12.97/messages/frameworks/ki18n.po kde-l10n-hr-4.13.0/messages/frameworks/ki18n.po
--- kde-l10n-hr-4.12.97/messages/frameworks/ki18n.po 2014-01-25 21:41:22.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/frameworks/ki18n.po 1970-01-01 00:00:00.000000000 +0000
@@ -1,10151 +0,0 @@
-# Translation of kdelibs4 to Croatian
-#
-# Renato Pavicic , 2006.
-# Zarko Pintar , 2009.
-# Marko Dimjasevic , 2009, 2010, 2011.
-# Andrej Dundović , 2009, 2010.
-# DoDo , 2009.
-# Andrej Dundovic , 2009, 2010, 2011.
-# Marko Dimjašević , 2011.
-msgid ""
-msgstr ""
-"Project-Id-Version: kdelibs4\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2014-01-24 18:50+0000\n"
-"PO-Revision-Date: 2011-07-22 16:08+0200\n"
-"Last-Translator: Marko Dimjašević \n"
-"Language-Team: Croatian \n"
-"Language: hr\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n"
-"%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"X-Generator: Lokalize 1.2\n"
-"X-Poedit-Language: Croatian\n"
-"X-Poedit-Country: CROATIA\n"
-"X-Poedit-Bookmarks: 1601,-1,-1,-1,-1,-1,-1,-1,-1,-1\n"
-"X-Environment: kde\n"
-"X-Accelerator-Marker: &\n"
-"X-Text-Markup: kde4\n"
-
-#. i18n: Decide which string is used to delimit keys in a keyboard
-#. shortcut (e.g. + in Ctrl+Alt+Tab) in plain text.
-#: kuitmarkup.cpp:294
-msgctxt "shortcut-key-delimiter/plain"
-msgid "+"
-msgstr "+"
-
-#. i18n: Decide which string is used to delimit keys in a keyboard
-#. shortcut (e.g. + in Ctrl+Alt+Tab) in rich text.
-#: kuitmarkup.cpp:298
-msgctxt "shortcut-key-delimiter/rich"
-msgid "+"
-msgstr "+"
-
-#. i18n: Decide which string is used to delimit elements in a GUI path
-#. (e.g. -> in "Go to Settings->Advanced->Core tab.") in plain text.
-#: kuitmarkup.cpp:302
-msgctxt "gui-path-delimiter/plain"
-msgid "→"
-msgstr "→"
-
-#. i18n: Decide which string is used to delimit elements in a GUI path
-#. (e.g. -> in "Go to Settings->Advanced->Core tab.") in rich text.
-#: kuitmarkup.cpp:306
-msgctxt "gui-path-delimiter/rich"
-msgid "→"
-msgstr "→"
-
-#. i18n: The messages with context "tag-format-pattern format"
-#. are KUIT patterns for formatting the text found inside KUIT tags.
-#. The format is either "plain" or "rich", and tells if the pattern
-#. is used for plain text or rich text (which can use HTML tags).
-#. You may be in general satisfied with the patterns as they are in the
-#. original. Some things you may consider changing:
-#. - the proper quotes, those used in msgid are English-standard
-#. - the and tags, does your language script work well with them?
-#: kuitmarkup.cpp:698
-#, fuzzy, kde-format
-#| msgctxt "@title/plain"
-#| msgid "== %1 =="
-msgctxt "tag-format-pattern plain"
-msgid "== %1 =="
-msgstr "== %1 =="
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:703
-#, fuzzy, kde-format
-#| msgctxt "@title/rich"
-#| msgid "%1 "
-msgctxt "tag-format-pattern rich"
-msgid "%1 "
-msgstr "%1 "
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:711
-#, fuzzy, kde-format
-#| msgctxt "@subtitle/plain"
-#| msgid "~ %1 ~"
-msgctxt "tag-format-pattern plain"
-msgid "~ %1 ~"
-msgstr "~ %1 ~"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:716
-#, fuzzy, kde-format
-#| msgctxt "@subtitle/rich"
-#| msgid "%1 "
-msgctxt "tag-format-pattern rich"
-msgid "%1 "
-msgstr "%1 "
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:724
-#, fuzzy, kde-format
-#| msgctxt "@application/plain"
-#| msgid "%1"
-msgctxt "tag-format-pattern plain"
-msgid "%1"
-msgstr "%1"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:729
-#, fuzzy, kde-format
-#| msgctxt "@shortcut/rich"
-#| msgid "%1 "
-msgctxt "tag-format-pattern rich"
-msgid "%1
"
-msgstr "%1 "
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:737
-#, fuzzy, kde-format
-#| msgctxt "@application/plain"
-#| msgid "%1"
-msgctxt "tag-format-pattern plain"
-msgid "%1"
-msgstr "%1"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:742
-#, fuzzy, kde-format
-#| msgctxt "@item/rich"
-#| msgid "%1 "
-msgctxt "tag-format-pattern rich"
-msgid ""
-msgstr "%1 "
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:750
-#, fuzzy, kde-format
-#| msgctxt "@item/plain"
-#| msgid " * %1"
-msgctxt "tag-format-pattern - plain"
-msgid " * %1"
-msgstr " * %1"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:755
-#, fuzzy, kde-format
-#| msgctxt "@item/rich"
-#| msgid "
%1 "
-msgctxt "tag-format-pattern - rich"
-msgid "
%1 "
-msgstr "%1 "
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:762
-#, fuzzy, kde-format
-#| msgctxt "@note/plain"
-#| msgid "Note: %1"
-msgctxt "tag-format-pattern plain"
-msgid "Note: %1"
-msgstr "Napomena: %1"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:767
-#, fuzzy, kde-format
-#| msgctxt "@note/rich"
-#| msgid "Note : %1"
-msgctxt "tag-format-pattern rich"
-msgid "Note : %1"
-msgstr "Napomena : %1"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:773
-#, fuzzy, kde-format
-#| msgid "Re: %1"
-msgctxt ""
-"tag-format-pattern plain\n"
-"%1 is the text, %2 is the note label"
-msgid "%2: %1"
-msgstr "Odgovori: %1"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:779
-#, fuzzy, kde-format
-#| msgctxt ""
-#| "@note-with-label/rich\n"
-#| "%1 is the note label, %2 is the text"
-#| msgid "%1 : %2"
-msgctxt ""
-"tag-format-pattern rich\n"
-"%1 is the text, %2 is the note label"
-msgid "%2 : %1"
-msgstr "%1 : %2"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:786
-#, fuzzy, kde-format
-#| msgctxt "@warning/plain"
-#| msgid "WARNING: %1"
-msgctxt "tag-format-pattern plain"
-msgid "WARNING: %1"
-msgstr "UPOZORENJE: %1"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:791
-#, fuzzy, kde-format
-#| msgctxt "@warning/rich"
-#| msgid "Warning : %1"
-msgctxt "tag-format-pattern rich"
-msgid "Warning : %1"
-msgstr "Upozorenje : %1"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:797
-#, fuzzy, kde-format
-#| msgid "Re: %1"
-msgctxt ""
-"tag-format-pattern plain\n"
-"%1 is the text, %2 is the warning label"
-msgid "%2: %1"
-msgstr "Odgovori: %1"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:803
-#, fuzzy, kde-format
-#| msgctxt ""
-#| "@warning-with-label/rich\n"
-#| "%1 is the warning label, %2 is the text"
-#| msgid "%1 : %2"
-msgctxt ""
-"tag-format-pattern rich\n"
-"%1 is the text, %2 is the warning label"
-msgid "%2 : %1"
-msgstr "%1 : %2"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:810
-#, fuzzy, kde-format
-#| msgctxt "@application/plain"
-#| msgid "%1"
-msgctxt "tag-format-pattern plain"
-msgid "%1"
-msgstr "%1"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:815
-#, fuzzy, kde-format
-#| msgctxt ""
-#| "@link-with-description/rich\n"
-#| "%1 is the URL, %2 is the descriptive text"
-#| msgid "%2 "
-msgctxt "tag-format-pattern rich"
-msgid "%1 "
-msgstr "%2 "
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:821
-#, fuzzy, kde-format
-#| msgctxt "name of digit set with digit string, e.g. 'Arabic (0123456789)'"
-#| msgid "%1 (%2)"
-msgctxt ""
-"tag-format-pattern plain\n"
-"%1 is the descriptive text, %2 is the URL"
-msgid "%1 (%2)"
-msgstr "%1 (%2)"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:827
-#, fuzzy, kde-format
-#| msgctxt ""
-#| "@link-with-description/rich\n"
-#| "%1 is the URL, %2 is the descriptive text"
-#| msgid "%2 "
-msgctxt ""
-"tag-format-pattern rich\n"
-"%1 is the descriptive text, %2 is the URL"
-msgid "%1 "
-msgstr "%2 "
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:834
-#, fuzzy, kde-format
-#| msgctxt "@filename/plain"
-#| msgid "‘%1’"
-msgctxt "tag-format-pattern plain"
-msgid "‘%1’"
-msgstr "‘%1’"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:839
-#, fuzzy, kde-format
-#| msgctxt "@filename/rich"
-#| msgid "%1 "
-msgctxt "tag-format-pattern rich"
-msgid "%1 "
-msgstr "%1 "
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:846
-#, fuzzy, kde-format
-#| msgctxt "@application/plain"
-#| msgid "%1"
-msgctxt "tag-format-pattern plain"
-msgid "%1"
-msgstr "%1"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:851
-#, fuzzy, kde-format
-#| msgctxt "@application/plain"
-#| msgid "%1"
-msgctxt "tag-format-pattern rich"
-msgid "%1"
-msgstr "%1"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:858
-#, fuzzy, kde-format
-#| msgctxt "@application/plain"
-#| msgid "%1"
-msgctxt "tag-format-pattern plain"
-msgid "%1"
-msgstr "%1"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:863
-#, fuzzy, kde-format
-#| msgctxt "@filename/rich"
-#| msgid "%1 "
-msgctxt "tag-format-pattern rich"
-msgid "%1 "
-msgstr "%1 "
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:869
-#, fuzzy, kde-format
-#| msgctxt ""
-#| "@command-with-section/plain\n"
-#| "%1 is the command name, %2 is its man section"
-#| msgid "%1(%2)"
-msgctxt ""
-"tag-format-pattern plain\n"
-"%1 is the command name, %2 is its man section"
-msgid "%1(%2)"
-msgstr "%1(%2)"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:875
-#, fuzzy, kde-format
-#| msgctxt ""
-#| "@command-with-section/rich\n"
-#| "%1 is the command name, %2 is its man section"
-#| msgid "%1(%2) "
-msgctxt ""
-"tag-format-pattern rich\n"
-"%1 is the command name, %2 is its man section"
-msgid "%1(%2) "
-msgstr "%1(%2) "
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:882
-#, fuzzy, kde-format
-#| msgctxt "@resource/plain"
-#| msgid "“%1”"
-msgctxt "tag-format-pattern plain"
-msgid "“%1”"
-msgstr "“%1”"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:887
-#, fuzzy, kde-format
-#| msgctxt "@resource/plain"
-#| msgid "“%1”"
-msgctxt "tag-format-pattern rich"
-msgid "“%1”"
-msgstr "“%1”"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:894
-#, fuzzy, kde-format
-#| msgctxt "@resource/plain"
-#| msgid "“%1”"
-msgctxt "tag-format-pattern plain"
-msgid "“%1”"
-msgstr "“%1”"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:899
-#, fuzzy, kde-format
-#| msgctxt "@filename/rich"
-#| msgid "%1 "
-msgctxt "tag-format-pattern rich"
-msgid "%1 "
-msgstr "%1 "
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:906
-#, kde-format
-msgctxt "tag-format-pattern plain"
-msgid ""
-"\n"
-"%1\n"
-msgstr ""
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:911
-#, fuzzy, kde-format
-#| msgctxt "@shortcut/rich"
-#| msgid "%1 "
-msgctxt "tag-format-pattern rich"
-msgid "%1 "
-msgstr "%1 "
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:918
-#, fuzzy, kde-format
-#| msgctxt "@application/plain"
-#| msgid "%1"
-msgctxt "tag-format-pattern plain"
-msgid "%1"
-msgstr "%1"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:923
-#, fuzzy, kde-format
-#| msgctxt "@shortcut/rich"
-#| msgid "%1 "
-msgctxt "tag-format-pattern rich"
-msgid "%1 "
-msgstr "%1 "
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:930
-#, fuzzy, kde-format
-#| msgctxt "@interface/plain"
-#| msgid "|%1|"
-msgctxt "tag-format-pattern plain"
-msgid "|%1|"
-msgstr "|%1|"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:935
-#, fuzzy, kde-format
-#| msgctxt "@interface/rich"
-#| msgid "%1 "
-msgctxt "tag-format-pattern rich"
-msgid "%1 "
-msgstr "%1 "
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:942
-#, fuzzy, kde-format
-#| msgctxt "@emphasis/plain"
-#| msgid "*%1*"
-msgctxt "tag-format-pattern plain"
-msgid "*%1*"
-msgstr "*%1*"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:947
-#, fuzzy, kde-format
-#| msgctxt "@interface/rich"
-#| msgid "%1 "
-msgctxt "tag-format-pattern rich"
-msgid "%1 "
-msgstr "%1 "
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:952
-#, fuzzy, kde-format
-#| msgctxt "@emphasis-strong/plain"
-#| msgid "**%1**"
-msgctxt "tag-format-pattern plain"
-msgid "**%1**"
-msgstr "**%1**"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:957
-#, fuzzy, kde-format
-#| msgctxt "@shortcut/rich"
-#| msgid "%1 "
-msgctxt "tag-format-pattern rich"
-msgid "%1 "
-msgstr "%1 "
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:964
-#, fuzzy, kde-format
-#| msgctxt "@placeholder/plain"
-#| msgid "<%1>"
-msgctxt "tag-format-pattern plain"
-msgid "<%1>"
-msgstr "<%1>"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:969
-#, fuzzy, kde-format
-#| msgctxt "@placeholder/rich"
-#| msgid "<%1 >"
-msgctxt "tag-format-pattern rich"
-msgid "<%1 >"
-msgstr "<%1 >"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:976
-#, fuzzy, kde-format
-#| msgctxt "@placeholder/plain"
-#| msgid "<%1>"
-msgctxt "tag-format-pattern plain"
-msgid "<%1>"
-msgstr "<%1>"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:981
-#, fuzzy, kde-format
-#| msgctxt "@email/rich"
-#| msgid "<%1 >"
-msgctxt "tag-format-pattern rich"
-msgid "<%1 >"
-msgstr "<%1 >"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:987
-#, fuzzy, kde-format
-#| msgctxt ""
-#| "@email-with-name/plain\n"
-#| "%1 is name, %2 is address"
-#| msgid "%1 <%2>"
-msgctxt ""
-"tag-format-pattern plain\n"
-"%1 is name, %2 is address"
-msgid "%1 <%2>"
-msgstr "%1 <%2>"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:993
-#, fuzzy, kde-format
-#| msgctxt ""
-#| "@email-with-name/rich\n"
-#| "%1 is name, %2 is address"
-#| msgid "%1 "
-msgctxt ""
-"tag-format-pattern rich\n"
-"%1 is name, %2 is address"
-msgid "%1 "
-msgstr "%1 "
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:1000
-#, fuzzy, kde-format
-#| msgctxt "@envar/plain"
-#| msgid "$%1"
-msgctxt "tag-format-pattern plain"
-msgid "$%1"
-msgstr "$%1"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:1005
-#, fuzzy, kde-format
-#| msgctxt "@envar/rich"
-#| msgid "$%1 "
-msgctxt "tag-format-pattern rich"
-msgid "$%1 "
-msgstr "$%1 "
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:1012
-#, fuzzy, kde-format
-#| msgctxt "@message/plain"
-#| msgid "/%1/"
-msgctxt "tag-format-pattern plain"
-msgid "/%1/"
-msgstr "/%1/"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:1017
-#, fuzzy, kde-format
-#| msgctxt "@interface/rich"
-#| msgid "%1 "
-msgctxt "tag-format-pattern rich"
-msgid "%1 "
-msgstr "%1 "
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:1024
-#, fuzzy, kde-format
-#| msgctxt "@application/plain"
-#| msgid "%1"
-msgctxt "tag-format-pattern plain"
-msgid "%1\n"
-msgstr "%1"
-
-#. i18n: KUIT pattern, see the comment to the first of these entries above.
-#: kuitmarkup.cpp:1029
-#, kde-format
-msgctxt "tag-format-pattern rich"
-msgid "%1 "
-msgstr ""
-
-#~ msgctxt "NAME OF TRANSLATORS"
-#~ msgid "Your names"
-#~ msgstr "Renato Pavičić, Žarko Pintar, Marko Dimjašević, Andrej Dundović"
-
-#~ msgctxt "EMAIL OF TRANSLATORS"
-#~ msgid "Your emails"
-#~ msgstr ""
-#~ "renato@translator-shop.org, zarko.pintar@gmail.com, marko@dimjasevic.net, "
-#~ "adundovi@gmail.com"
-
-#~ msgid "Editor Chooser"
-#~ msgstr "Uređivač teksta"
-
-#~ msgid ""
-#~ "Please choose the default text editing component that you wish to use in "
-#~ "this application. If you choose System Default , the application "
-#~ "will honor your changes in the System Settings. All other choices will "
-#~ "override that setting."
-#~ msgstr ""
-#~ "Odaberite zadanu komponentu za uređivanje teksta koju želite koristiti u "
-#~ "ovoj aplikaciji. Ako odaberete Zadano sustavom , program će "
-#~ "primijeniti vaše izmjene u Postavkama sustava. Svi će ostali izbori "
-#~ "premostiti tu postavku."
-
-#~ msgid ""
-#~ "This word was considered to be an \"unknown word\" because it does "
-#~ "not match any entry in the dictionary currently in use. It may also be a "
-#~ "word in a foreign language.
\n"
-#~ "If the word is not misspelled, you may add it to the dictionary by "
-#~ "clicking Add to Dictionary . If you do not want to add the unknown "
-#~ "word to the dictionary, but you want to leave it unchanged, click "
-#~ "Ignore or Ignore All .
\n"
-#~ "However, if the word is misspelled, you can try to find the correct "
-#~ "replacement in the list below. If you cannot find a replacement there, "
-#~ "you may type it in the text box below, and click Replace or "
-#~ "Replace All .
\n"
-#~ " "
-#~ msgstr ""
-#~ "Ova riječ smatra se \"nepoznatom riječi\" jer ne odgovara niti "
-#~ "jednoj riječi iz rječnika koji se trenutno koristi. Moguće je da se radi "
-#~ "o stranoj riječi.
\n"
-#~ "Ako riječ nije pogrešna, možete je dodati u riječnik klikom na "
-#~ "Dodaj u rječnik . Ako je ne želite dodati u rječnik, ali je želite "
-#~ "ostaviti nepromijenjenom, kliknite na Zanemari ili Zanemari "
-#~ "sve .
\n"
-#~ "Također, ako je riječ pogrešna, možete pokušati pronaći zamjensku iz "
-#~ "liste ispod. Ako ne možete pronaći zamjenu, možete je otipkati u tekstni "
-#~ "okvir ispod i kliknuti na Zamijeni ili Zamijeni sve .
\n"
-#~ " "
-
-#~ msgid "Unknown word:"
-#~ msgstr "Nepoznata riječ:"
-
-#~ msgid "Unknown word"
-#~ msgstr "Nepoznata riječ"
-
-#~ msgid "misspelled "
-#~ msgstr "pogrešno napisano "
-
-#~ msgid ""
-#~ "\n"
-#~ "Select the language of the document you are proofing here.
\n"
-#~ " "
-#~ msgstr ""
-#~ "\n"
-#~ "Odaberite jezik dokumenta koji provjeravate.
\n"
-#~ " "
-
-#~ msgid "&Language:"
-#~ msgstr "&Jezik:"
-
-#~ msgid "Text excerpt showing the unknown word in its context."
-#~ msgstr "Isječak teksta nepoznatu riječ prikazuje u njezinom kontekstu."
-
-#~ msgid ""
-#~ "\n"
-#~ "Here you can see a text excerpt showing the unknown word in its "
-#~ "context. If this information is not sufficient to choose the best "
-#~ "replacement for the unknown word, you can click on the document you are "
-#~ "proofing, read a larger part of the text and then return here to continue "
-#~ "proofing.
\n"
-#~ " "
-#~ msgstr ""
-#~ "\n"
-#~ "Ovdje možete vidjeti isječak teksta koji nepoznatu riječ prikazuje u "
-#~ "njezinom kontekstu. Ako ovaj podatak nije dovoljan za odabir najbolje "
-#~ "zamjene za nepoznatu riječ, možete kliknuti dokument koji provjeravate, "
-#~ "označiti veći dio teksta i potom se vrati ovdje da biste nastavili s "
-#~ "provjerom.
\n"
-#~ " "
-
-#~ msgid "... the misspelled word shown in context ..."
-#~ msgstr "… pogrešno napisana riječ prikazana je u kontekstu…"
-
-#~ msgid ""
-#~ "\n"
-#~ "The unknown word was detected and considered unknown because it is not "
-#~ "included in the dictionary. \n"
-#~ "Click here if you consider the unknown word not to be misspelled, and you "
-#~ "want to avoid wrongly detecting it again in the future. If you want to "
-#~ "let it remain as is, but not add it to the dictionary, then click "
-#~ "Ignore or Ignore All instead.
\n"
-#~ " "
-#~ msgstr ""
-#~ "\n"
-#~ "Otkrivena je nepoznata riječ, a smatra se nepoznatom jer nije "
-#~ "uključena u rječnik. \n"
-#~ "Kliknite ovdje ako smatrate da nepoznata riječ nije pogrešno napisana i "
-#~ "želite izbjeći njeno ponovno pogrešno prepoznavanje u budućnosti. Ako je "
-#~ "želite ostaviti u postojećem obliku, ali bez njenog dodavanja u rječnik, "
-#~ "kliknite Ignoriraj ili Ignororaj sve .
\n"
-#~ " "
-
-#~ msgid "<< Add to Dictionary"
-#~ msgstr "<< Dodaj u rječnik"
-
-#~ msgid ""
-#~ "\n"
-#~ "Click here to replace all occurrences of the unknown text with the "
-#~ "text in the edit box above (to the left).
\n"
-#~ " "
-#~ msgstr ""
-#~ "\n"
-#~ "Kliknite ovdje da biste zamijenili sva pojavljivanja nepoznatog teksta "
-#~ "s tekstom iz okvira za uređivanje (lijevo).
\n"
-#~ " "
-
-#~ msgid "R&eplace All"
-#~ msgstr "Zamijeni &sve"
-
-#~ msgid "Suggestion List"
-#~ msgstr "Popis prijedloga"
-
-#~ msgid ""
-#~ "\n"
-#~ "If the unknown word is misspelled, you should check if the correction "
-#~ "for it is available and if it is, click on it. If none of the words in "
-#~ "this list is a good replacement you may type the correct word in the edit "
-#~ "box above.
\n"
-#~ "To correct this word click Replace if you want to correct only "
-#~ "this occurrence or Replace All if you want to correct all "
-#~ "occurrences.
\n"
-#~ " "
-#~ msgstr ""
-#~ "\n"
-#~ "Ako je nepoznata riječ pogrešna, trebate provijeriti da li postoji "
-#~ "korekcija za nju, te ako da onda kliknite na nju. Ako niti jedna riječ iz "
-#~ "liste nije dobra zamjena za nju, onda možete otipkati ispravnu riječ u "
-#~ "okvir za unos
\n"
-#~ "Za ispravak riječi kliknite na Zamijeni ako želite ispraviti "
-#~ "samo ovaj pojam ili Zamijeni sve ako želite ispraviti sve pojmove."
-#~ "
\n"
-#~ " "
-
-#~ msgid "Suggested Words"
-#~ msgstr "Predložene riječi"
-
-#~ msgid ""
-#~ "\n"
-#~ "Click here to replace this occurrence of the unknown text with the "
-#~ "text in the edit box above (to the left).
\n"
-#~ " "
-#~ msgstr ""
-#~ "\n"
-#~ "Kliknite ovdje da biste zamijenili ovo pojavljivanje nepoznatog teksta "
-#~ "s tekstom iz okvira za uređivanje (lijevo).
\n"
-#~ " "
-
-#~ msgid "&Replace"
-#~ msgstr "&Zamijeni"
-
-#~ msgid ""
-#~ "\n"
-#~ "If the unknown word is misspelled, you should type the correction for "
-#~ "your misspelled word here or select it from the list below.
\n"
-#~ "You can then click Replace if you want to correct only this "
-#~ "occurrence of the word or Replace All if you want to correct all "
-#~ "occurrences.
\n"
-#~ " "
-#~ msgstr ""
-#~ "\n"
-#~ "Ako je nepoznata riječ pogrešno napisana, ovdje bi bilo potrebno "
-#~ "unijeti ispravno napisanu riječ ili je izabrati s donjeg popisa.
\n"
-#~ "Ako želite ispraviti samo ovo pojavljivanje riječi kliknute "
-#~ "Zamijeni , a ako želite ispraviti sva pojavljivanja kliknite "
-#~ "Zamijeni sve .
\n"
-#~ " "
-
-#~ msgid "Replace &with:"
-#~ msgstr "&&Zamjeni s:"
-
-#~ msgid ""
-#~ "\n"
-#~ "Click here to let this occurrence of the unknown word remain as is."
-#~ "p>\n"
-#~ "
This action is useful when the word is a name, an acronym, a foreign "
-#~ "word or any other unknown word that you want to use but not add to the "
-#~ "dictionary.
\n"
-#~ " "
-#~ msgstr ""
-#~ "\n"
-#~ "Kliknite ovdje ako želite ovu nepoznatu riječ ostaviti kakva je.
\n"
-#~ "Ova radnja je korisna ako je riječ naziv, akronim, strana riječ ili "
-#~ "neka druga nepoznata riječ koju želite koristiti, ali je ne želite dodati "
-#~ "u riječnik.
\n"
-#~ " "
-
-#~ msgid "&Ignore"
-#~ msgstr "&Ignoriraj"
-
-#~ msgid ""
-#~ "\n"
-#~ "Click here to let all occurrences of the unknown word remain as they "
-#~ "are.
\n"
-#~ "This action is useful when the word is a name, an acronym, a foreign "
-#~ "word or any other unknown word that you want to use but not add to the "
-#~ "dictionary.
\n"
-#~ " "
-#~ msgstr ""
-#~ "\n"
-#~ "Kliknite ovdje ako želite ovu nepoznatu riječ ostaviti kakva je.
\n"
-#~ "Ova radnja je korisna ako je riječ naziv, akronim, strana riječ ili "
-#~ "neka druga nepoznata riječ koju želite koristiti, ali je ne želite dodati "
-#~ "u riječnik.
\n"
-#~ " "
-
-#~ msgid "I&gnore All"
-#~ msgstr "Ignoriraj &sve"
-
-#~ msgid "S&uggest"
-#~ msgstr "&Predloži"
-
-#~ msgid "Language Selection"
-#~ msgstr "Odabir jezika"
-
-#~ msgid "Job"
-#~ msgstr "Posao"
-
-#~ msgid "Job Control"
-#~ msgstr "Kontrola posla"
-
-#~ msgid "Scheduled printing:"
-#~ msgstr "Planirano ispisivanje:"
-
-#~ msgid "Billing information:"
-#~ msgstr "Podaci o plaćanju:"
-
-#~ msgid "Job priority:"
-#~ msgstr "Prioritet posla:"
-
-#~ msgid "Job Options"
-#~ msgstr "Opcije posla"
-
-#~ msgid "Option"
-#~ msgstr "Opcija"
-
-#~ msgid "Value"
-#~ msgstr "Vrijednost"
-
-#~ msgid "Pages"
-#~ msgstr "Stranice"
-
-#~ msgid "Pages Per Sheet"
-#~ msgstr "Stranica po listu"
-
-#~ msgid "1"
-#~ msgstr "1"
-
-#~ msgid "6"
-#~ msgstr "6"
-
-#~ msgid "2"
-#~ msgstr "2"
-
-#~ msgid "9"
-#~ msgstr "9"
-
-#~ msgid "4"
-#~ msgstr "4"
-
-#~ msgid "16"
-#~ msgstr "16"
-
-#~ msgid "Banner Pages"
-#~ msgstr "Stranice-uvodnici"
-
-#~ msgctxt "Banner page at start"
-#~ msgid "Start"
-#~ msgstr "Započni"
-
-#~ msgctxt "Banner page at end"
-#~ msgid "End"
-#~ msgstr "Završetak"
-
-#~ msgid "Page Label"
-#~ msgstr "Oznaka stranice"
-
-#~ msgid "Page Border"
-#~ msgstr "Okvir stranice"
-
-#~ msgid "Mirror Pages"
-#~ msgstr "Zrcalne stranice"
-
-#~ msgid "Mirror pages along vertical axis"
-#~ msgstr "Zrcali stranice oko vertikalne osi"
-
-#~ msgid "Password:"
-#~ msgstr "Zaporka:"
-
-#~ msgid "&Verify:"
-#~ msgstr "&Provjera:"
-
-#~ msgid "Password strength meter:"
-#~ msgstr "Pokazivač kakvoće zaporke:"
-
-#~ msgid "Passwords do not match"
-#~ msgstr "Zaporke se ne podudaraju"
-
-#~ msgid "Supply a username and password below."
-#~ msgstr "Niže navedite korisničko ime i zaporku."
-
-#~ msgid "Username:"
-#~ msgstr "Korisničko ime:"
-
-#~ msgid "Anonymous"
-#~ msgstr "Anonimno"
-
-#~ msgid "Domain:"
-#~ msgstr "Domena:"
-
-#~ msgid "Remember password"
-#~ msgstr "&Zapamti zaporku"
-
-#~ msgid ""
-#~ "Search interactively for shortcut names (e.g. Copy) or combination of "
-#~ "keys (e.g. Ctrl+C) by typing them here."
-#~ msgstr ""
-#~ "Interaktivno traži nazive prečaca (npr. Kopiraj) ili kombinaciju tipki "
-#~ "(npr. Ctrl+C) tipkajući ih ovdje."
-
-#~ msgid ""
-#~ "Here you can see a list of key bindings, i.e. associations between "
-#~ "actions (e.g. 'Copy') shown in the left column and keys or combination of "
-#~ "keys (e.g. Ctrl+V) shown in the right column."
-#~ msgstr ""
-#~ "Ovdje možete vidjeti postavke prečaca, odnosno povezanost između "
-#~ "aktivnost (npr. 'Kopiraj') prikazane u lijevom stupcu i tipke ili "
-#~ "kombinacije tipki (npr. CTRL-V) prikazane u desnom stupcu."
-
-#~ msgid "Action"
-#~ msgstr "Aktivnost"
-
-#~ msgid "Shortcut"
-#~ msgstr "Prečac"
-
-#~ msgid "Alternate"
-#~ msgstr "Alternativno"
-
-#~ msgid "Global"
-#~ msgstr "Opći"
-
-#~ msgid "Global Alternate"
-#~ msgstr "Opće alternativno"
-
-#~ msgid "Mouse Button Gesture"
-#~ msgstr "Gesta s gumbom miša"
-
-#~ msgid "Mouse Shape Gesture"
-#~ msgstr "Gesta s pokretom miša"
-
-#~ msgid "Options"
-#~ msgstr "Opcije"
-
-#~ msgid "Enable &background spellchecking"
-#~ msgstr "Omogući provjeru pravopisa u &pozadini"
-
-#~ msgid "&Automatic spell checking enabled by default"
-#~ msgstr ""
-#~ "Prema zadanim je postavkama &automatska provjera pravopisa omogućena"
-
-#~ msgid "Skip all &uppercase words"
-#~ msgstr "Preskoči sve riječi pisane &velikim slovima"
-
-#~ msgid "S&kip run-together words"
-#~ msgstr "Preskočki spojene riječi"
-
-#~ msgid "Default language:"
-#~ msgstr "Uobičajeni jezik:"
-
-#~ msgid "Ignored Words"
-#~ msgstr "Ignorirane riječi"
-
-#~ msgid "Autocorrect"
-#~ msgstr "Automatski ispravi"
-
-#~ msgid "Main:"
-#~ msgstr "Glavno:"
-
-#~ msgid "Alternate:"
-#~ msgstr "Alternativno:"
-
-#~ msgid "&File"
-#~ msgstr "&Datoteka"
-
-#~ msgid "&Game"
-#~ msgstr "&Igre"
-
-#~ msgid "&Edit"
-#~ msgstr "&Uređivanje"
-
-#~ msgctxt "@title:menu Game move"
-#~ msgid "&Move"
-#~ msgstr "&Premjesti"
-
-#~ msgid "&View"
-#~ msgstr "P&rikaz"
-
-#~ msgid "&Go"
-#~ msgstr "&Kreni"
-
-#~ msgid "&Bookmarks"
-#~ msgstr "&Oznake"
-
-#~ msgid "&Tools"
-#~ msgstr "&Alati"
-
-#~ msgid "&Settings"
-#~ msgstr "&Postavke"
-
-#~ msgid "&Help"
-#~ msgstr "&Pomoć"
-
-#~ msgid "Main Toolbar"
-#~ msgstr "Glavna alatna traka"
-
-#~ msgid "Document Information"
-#~ msgstr "Podaci o dokumentu"
-
-#~ msgctxt "@title:group Document information"
-#~ msgid "General"
-#~ msgstr "Opće"
-
-#~ msgid "URL:"
-#~ msgstr "URL:"
-
-#~ msgid "Title:"
-#~ msgstr "Naslov:"
-
-#~ msgid "Last modified:"
-#~ msgstr "Posljednja izmjena:"
-
-#~ msgid "Document encoding:"
-#~ msgstr "Kodiranje dokumenta:"
-
-#~ msgid "Rendering mode:"
-#~ msgstr "Način iscrtavanja:"
-
-#~ msgid "HTTP Headers"
-#~ msgstr "HTTP zaglavlja"
-
-#~ msgid "Property"
-#~ msgstr "Svojstva"
-
-#~ msgid "HTML Toolbar"
-#~ msgstr "HTML alatna traka"
-
-#~ msgid "JavaScript Errors"
-#~ msgstr "JavaScript pogreške"
-
-#~ msgid ""
-#~ "This dialog provides you with notification and details of scripting "
-#~ "errors that occur on web pages. In many cases it is due to an error in "
-#~ "the web site as designed by its author. In other cases it is the result "
-#~ "of a programming error in Konqueror. If you suspect the former, please "
-#~ "contact the webmaster of the site in question. Conversely if you suspect "
-#~ "an error in Konqueror, please file a bug report at http://bugs.kde.org/. "
-#~ "A test case which illustrates the problem will be appreciated."
-#~ msgstr ""
-#~ "Ovaj dijalog pruža obavijesti i detalje o pogreškama tijakom izvršavanja "
-#~ "skripti na web stranicama. U mnogim slučajima uzrok je autorova pogreška "
-#~ "pri izradi web stranice, dok je u ostalim slučajima uzrok programska "
-#~ "pogreška u Konqueroru. Ako pretpostavljate da je uzrok na web stranici, "
-#~ "molimo vas da kontaktirate web administratora dotične lokacije. Ako "
-#~ "sumnjate na pogrešku u Konqueroru, molimo vas da izvještaj o pogrešci "
-#~ "pošaljete na adresu http://bugs.kde.org/. Ogledni primjer koji ilustrira "
-#~ "pogrešku jako je poželjan."
-
-#~ msgid "&Close"
-#~ msgstr "&Zatvori"
-
-#~ msgid "C&lear"
-#~ msgstr "&Očisti"
-
-#~ msgid "KHTML Regression Testing Utility"
-#~ msgstr "Uslužni program ispitivanja povratnog stanja KHTML-a"
-
-#~ msgid "0"
-#~ msgstr "0"
-
-#~ msgid "Regression testing output"
-#~ msgstr "Izlaz ispitivanja povratnog stanja"
-
-#~ msgid "Pause/Continue regression testing process"
-#~ msgstr "Zaustavi/Nastavi proces ispitivanja povratnog stanja"
-
-#~ msgid "Pause"
-#~ msgstr "Pauza"
-
-#~ msgid ""
-#~ "You may select a file where the log content is stored, before the "
-#~ "regression testing is started."
-#~ msgstr ""
-#~ "Možete odabrati datoteku gdje će sadržaj zapisa biti pohranjen prije "
-#~ "početka ispitivanja regresije."
-
-#~ msgid "Output to File..."
-#~ msgstr "Izlaz u datoteku…"
-
-#~ msgid "Regression Testing Status"
-#~ msgstr "Stanje regresijskog testiranja"
-
-#~ msgid "View HTML Output"
-#~ msgstr "Prikaz izlaza HTML-a"
-
-#~ msgid "Settings"
-#~ msgstr "&Postavke"
-
-#~ msgid "Tests"
-#~ msgstr "Testovi"
-
-#~ msgid "Only Run JS Tests"
-#~ msgstr "Izvrši samo JS-testove"
-
-#~ msgid "Only Run HTML Tests"
-#~ msgstr "Izvrši samo HTML-testove"
-
-#~ msgid "Do Not Suppress Debug Output"
-#~ msgstr "Ne sprečavaj Debug izlaz"
-
-#~ msgid "Do not use Xvfb"
-#~ msgstr "Ne koristi Xvfb"
-
-#~ msgid "Run Tests..."
-#~ msgstr "Izvrši testove…"
-
-#~ msgid "Run Single Test..."
-#~ msgstr "Izvrši jedan test…"
-
-#~ msgid "Specify tests Directory..."
-#~ msgstr "Odredi direktorij testova…"
-
-#~ msgid "Specify khtml Directory..."
-#~ msgstr "Odredi khtml direktorij…"
-
-#~ msgid "Specify Output Directory..."
-#~ msgstr "Odredi izlazni direktorij…"
-
-#~ msgid "F&ind:"
-#~ msgstr "Traž&i:"
-
-#~ msgid "&Next"
-#~ msgstr "&Sljedeće"
-
-#~ msgid "&Previous"
-#~ msgstr "&Prethodno"
-
-#~ msgid "Opt&ions"
-#~ msgstr "Opc&ije"
-
-#~ msgid "Do you want to store this password?"
-#~ msgstr "Želite li zaista pohraniti zaporku?"
-
-#~ msgid "&Store"
-#~ msgstr "&Pohrani"
-
-#~ msgid "Ne&ver store for this site"
-#~ msgstr "&Nikad za ovu stranicu"
-
-#~ msgid "Do ¬ store this time"
-#~ msgstr "Ovog puta &ne pohranjuj"
-
-#~ msgid "JS Calculator"
-#~ msgstr "JS kalkulator"
-
-#~ msgctxt "addition"
-#~ msgid "+"
-#~ msgstr "+"
-
-#~ msgid "AC"
-#~ msgstr "AC"
-
-#~ msgctxt "subtraction"
-#~ msgid "-"
-#~ msgstr "-"
-
-#~ msgctxt "evaluation"
-#~ msgid "="
-#~ msgstr "="
-
-#~ msgid "CL"
-#~ msgstr "CL"
-
-#~ msgid "5"
-#~ msgstr "5"
-
-#~ msgid "3"
-#~ msgstr "3"
-
-#~ msgid "7"
-#~ msgstr "7"
-
-#~ msgid "8"
-#~ msgstr "8"
-
-#~ msgid "MainWindow"
-#~ msgstr "MainWindow"
-
-#~ msgid "KJSEmbed Documentation Viewer "
-#~ msgstr "KJSEmbed preglednik dokumenata "
-
-#~ msgid "Execute"
-#~ msgstr "Izvrši"
-
-#~ msgid "File"
-#~ msgstr "Datoteka"
-
-#~ msgid "Open Script"
-#~ msgstr "Otvori skriptu"
-
-#~ msgid "Open a script..."
-#~ msgstr "Otvori skriptu…"
-
-#~ msgid "Ctrl+O"
-#~ msgstr "Ctrl+O"
-
-#~ msgid "Close Script"
-#~ msgstr "Zatvori skriptu"
-
-#~ msgid "Close script..."
-#~ msgstr "Zatvori skriptu…"
-
-#~ msgid "Quit"
-#~ msgstr "Izlaz"
-
-#~ msgid "Quit application..."
-#~ msgstr "Izlazak iz programa…"
-
-#~ msgid "Run"
-#~ msgstr "Izvrši"
-
-#~ msgid "Run script..."
-#~ msgstr "Izvrši skriptu…"
-
-#~ msgid "Run To..."
-#~ msgstr "Idi na…"
-
-#~ msgid "Run to breakpoint..."
-#~ msgstr "Izvršavaj do točke prekida"
-
-#~ msgid "Step"
-#~ msgstr "Korak"
-
-#~ msgid "Step to next line..."
-#~ msgstr "Korak do slijedeće linije…"
-
-#~ msgid "Stop"
-#~ msgstr "Zaustavi"
-
-#~ msgid "Step execution..."
-#~ msgstr "Postepeno izvršavanje…"
-
-#~ msgid "&Source:"
-#~ msgstr "&Izvor:"
-
-#~ msgid "?"
-#~ msgstr "?"
-
-#~ msgid "&Order by:"
-#~ msgstr "&Poredaj po:"
-
-#~ msgid "Enter search phrase here"
-#~ msgstr "Ovdje unesi pojam pretraživanja"
-
-#~ msgid "Collaborate"
-#~ msgstr "Suradnja"
-
-#~ msgid "Share Hot New Stuff"
-#~ msgstr "Podijeli s drugima nove stvari"
-
-#~ msgid "Author:"
-#~ msgstr "Autor:"
-
-#~ msgid "Email address:"
-#~ msgstr "Adresa e-pošte:"
-
-#~ msgid "Name:"
-#~ msgstr "Naziv:"
-
-#~ msgid "Version:"
-#~ msgstr "Verzija:"
-
-#~ msgid "License:"
-#~ msgstr "Licenca:"
-
-#~ msgid "GPL"
-#~ msgstr "GPL"
-
-#~ msgid "LGPL"
-#~ msgstr "LGPL"
-
-#~ msgid "BSD"
-#~ msgstr "BSD"
-
-#~ msgid "Preview URL:"
-#~ msgstr "Pregled URL-a:"
-
-#~ msgid "Language:"
-#~ msgstr "Jezik:"
-
-#~ msgid "In which language did you describe the above?"
-#~ msgstr "U kojem jeziku ste opisali ovo iznad?"
-
-#~ msgid "Please describe your upload."
-#~ msgstr "Molim vas opišite što šaljete."
-
-#~ msgid "Summary:"
-#~ msgstr "Sažetak:"
-
-#~ msgid "Please give some information about yourself."
-#~ msgstr "Molim vas pružite neke informacije o sebi."
-
-#~ msgid "Provider:"
-#~ msgstr "Pružatelj usluge:"
-
-#~ msgid "Category:"
-#~ msgstr "Kategorija:"
-
-#~ msgid "Newest"
-#~ msgstr "Najnovije"
-
-#~ msgid "Rating"
-#~ msgstr "Ocjena"
-
-#~ msgid "Most downloads"
-#~ msgstr "Najviše preuzimanja"
-
-#~ msgid "Installed"
-#~ msgstr "Instalirano"
-
-#~ msgid "Order by:"
-#~ msgstr "Poredaj po:"
-
-#~ msgid "Search:"
-#~ msgstr "Pretraga:"
-
-#~ msgid "Homepage "
-#~ msgstr "Osobna stranica "
-
-#~ msgid "Update"
-#~ msgstr "Ažuriraj"
-
-#~ msgid "Uninstall"
-#~ msgstr "Odinstaliraj"
-
-#~ msgid "Become a Fan"
-#~ msgstr "Postanite obožavatelj/ica"
-
-#~ msgid "Install"
-#~ msgstr "Instaliraj"
-
-#~ msgid "File to upload:"
-#~ msgstr "Datoteka za slanje:"
-
-#~ msgid "New Upload"
-#~ msgstr "Novo slanje"
-
-#~ msgid "Description:"
-#~ msgstr "Opis:"
-
-#~ msgid "Changelog:"
-#~ msgstr "Dnevnik promjena:"
-
-#~ msgid "Please fill out the information about your upload in English."
-#~ msgstr "Molim vas da ispunite informacije o vašem slanju na engleskom."
-
-#~ msgid "Name of the file as it will appear on the website"
-#~ msgstr "Naziv datoteke koje će se pojaviti na web stranici"
-
-#~ msgid ""
-#~ "This should clearly describe the file content. It can be the same text as "
-#~ "the title of the kvtml file."
-#~ msgstr ""
-#~ "Ovo treba jasno opisivati sadržaj datoteke. Može biti isti tekst kao i "
-#~ "naslov kvtml datoteke."
-
-#~ msgid "Preview Images"
-#~ msgstr "Pregled slika"
-
-#~ msgid "Select Preview..."
-#~ msgstr "Odaberi pregled…"
-
-#~ msgid "Set a price for this item"
-#~ msgstr "Postavite cijenu za ovu stavku"
-
-#~ msgid "Price"
-#~ msgstr "Cijena"
-
-#~ msgid "Price:"
-#~ msgstr "Cijena:"
-
-#~ msgid "Reason for price:"
-#~ msgstr "Razlog za cijenu:"
-
-#~ msgid "Fetch content link from server"
-#~ msgstr "Dohvati link sadržaja s poslužitelja"
-
-#~ msgid "Create content on server"
-#~ msgstr "Stvori sadržaj na poslužitelju"
-
-#~ msgid "Upload content"
-#~ msgstr "Pošalji sadržaj"
-
-#~ msgid "Upload first preview"
-#~ msgstr "Prvi pregled slanja"
-
-#~ msgid "Note: You can edit, update and delete your content on the website."
-#~ msgstr ""
-#~ "Napomena: možete urediti, ažurirati i izbrisati Vaš sadržaj na web-"
-#~ "stranici."
-
-#~ msgid "Upload second preview"
-#~ msgstr "Drugi pregled slanja"
-
-#~ msgid "Upload third preview"
-#~ msgstr "Treći pregled slanja"
-
-#~ msgid ""
-#~ "I ensure that this content does not violate any existing copyright, law "
-#~ "or trademark. I agree for my IP address to be logged. (Distributing "
-#~ "content without the permission of the copyright holder is illegal.)"
-#~ msgstr ""
-#~ "Jamčim da ovaj sadržaj ne krši bilo koje postojeće autorsko pravo, zakon "
-#~ "ili zaštitni znak. Slažem se da moja IP adresa bude zabilježena. "
-#~ "(Distribucija sadržaja bez dozvole nositelja autorskog prava je "
-#~ "protuzakonita.)"
-
-#~ msgid "Start Upload"
-#~ msgstr "Započni slanje"
-
-#~ msgid "Play a &sound"
-#~ msgstr "Reproduciraj &zvuk"
-
-#~ msgid "Select the sound to play"
-#~ msgstr "Odaberite zvuk za puštanje"
-
-#~ msgid "Show a message in a &popup"
-#~ msgstr "&Pokaži poruku u skočnom okviru"
-
-#~ msgid "Log to a file"
-#~ msgstr "Zapisuj dnevnik u datoteku"
-
-#~ msgid "Mark &taskbar entry"
-#~ msgstr "Označi unos zada&tkovne trake"
-
-#~ msgid "Run &command"
-#~ msgstr "Izvrši &naredbu"
-
-#~ msgid "Select the command to run"
-#~ msgstr "Odaberite naredbu koju treba izvršiti"
-
-#~ msgid "Sp&eech"
-#~ msgstr "&Govor"
-
-#~ msgid ""
-#~ "Specifies how Jovie should speak the event when received. If you "
-#~ "select \"Speak custom text\", enter the text in the box. You may use the "
-#~ "following substitution strings in the text:%e Name of the "
-#~ "event %a Application that sent the event %m"
-#~ "dt> The message sent by the application "
-#~ msgstr ""
-#~ "Definira kako bi Jovie trebao izgovoriti poruku o primljenom "
-#~ "događaju. Ako odaberete \"Izgovori prilagođeni tekst\", unesite tekst u "
-#~ "polje. Možete koristiti sljedeće zamjenske nizove u tekstu: %e"
-#~ "dt> Naziv događaja %a Aplikacija koja je poslala "
-#~ "događaj %m Poruka koju je poslala aplikacija "
-#~ "qt>"
-
-#~ msgid "Speak Event Message"
-#~ msgstr "Izgovori poruku radnje"
-
-#~ msgid "Speak Event Name"
-#~ msgstr "Izgovori naziv događaja"
-
-#~ msgid "Speak Custom Text"
-#~ msgstr "Izgovori proizvoljni tekst"
-
-#~ msgid "Distance between desktop icons"
-#~ msgstr "Udaljenost između ikona radne površine"
-
-#~ msgid "The distance between icons specified in pixels."
-#~ msgstr "Udaljenost između ikona određena pikselima."
-
-#~ msgid "Widget style to use"
-#~ msgstr "Stil widgeta koji se koristi"
-
-#~ msgid ""
-#~ "The name of the widget style, for example \"keramik\" or \"plastik\". "
-#~ "Without quotes."
-#~ msgstr ""
-#~ "Naziv za stil widgeta, na primjer \"keramik\" ili \"plastik\". Bez "
-#~ "navodnika."
-
-#~ msgid "Use the PC speaker"
-#~ msgstr "Koristi PC zvučnik"
-
-#~ msgid ""
-#~ "Whether the ordinary PC speaker should be used instead of KDE's own "
-#~ "notifications system."
-#~ msgstr ""
-#~ "Treba li koristiti PC zvučnik umjesto vlastitog KDE-ovog obavjesnog "
-#~ "sustava."
-
-#~ msgid "What terminal application to use"
-#~ msgstr "Koju aplikaciju za terminal koristiti"
-
-#~ msgid ""
-#~ "Whenever a terminal application is launched this terminal emulator "
-#~ "program will be used.\n"
-#~ msgstr ""
-#~ "Pri svakom pokretanju terminala, koristit će se ovaj terminal emulator.\n"
-
-#~ msgid "Fixed width font"
-#~ msgstr "Pismo stalne širine"
-
-#~ msgid ""
-#~ "This font is used when a fixed font is needed. A fixed font has a "
-#~ "constant width.\n"
-#~ msgstr ""
-#~ "Ovo pismo se koristi pri potrebi za fiksnim pismom. Fiksno pismo je pismo "
-#~ "stalne širine.\n"
-
-#~ msgid "System wide font"
-#~ msgstr "Pismo sistema"
-
-#~ msgid "Font for menus"
-#~ msgstr "Pismo izbornika"
-
-#~ msgid "What font to use for menus in applications."
-#~ msgstr "Koje pismo koristiti za aplikacijske izbornike."
-
-#~ msgid "Color for links"
-#~ msgstr "Boja za poveznice"
-
-#~ msgid "What color links should be that have not yet been clicked on"
-#~ msgstr "Izaberite boju za one poveznice koje još nisu bile kliknute"
-
-#~ msgid "Color for visited links"
-#~ msgstr "Boja za posjećene poveznice"
-
-#~ msgid "Font for the taskbar"
-#~ msgstr "Pismo radne trake"
-
-#~ msgid ""
-#~ "What font to use for the panel at the bottom of the screen, where the "
-#~ "currently running applications are."
-#~ msgstr ""
-#~ "Odaberite pismo za ploču na dnu zaslona, gdje se nalaze trenutno otvorene "
-#~ "aplikacije."
-
-#~ msgid "Fonts for toolbars"
-#~ msgstr "Pismo alatne trake"
-
-#~ msgid "Shortcut for taking screenshot"
-#~ msgstr "Kratica za snimku zaslona"
-
-#~ msgid "Shortcut for toggling Clipboard Actions on and off"
-#~ msgstr "Prečac za ukjlučivanje i isključivanje Radnji odlagališta"
-
-#~ msgid "Shortcut for shutting down the computer without confirmation"
-#~ msgstr "Prečac za gašenje računala bez prethodne potvrde"
-
-#~ msgid "Show directories first"
-#~ msgstr "Prvo prikaži direktorije"
-
-#~ msgid ""
-#~ "Whether directories should be placed at the top when displaying files"
-#~ msgstr "Uvijek direktorije postavi na vrh prilikom prikazivanja datoteka"
-
-#~ msgid "The URLs recently visited"
-#~ msgstr "Nedavno posjećeni URL-ovi"
-
-#~ msgid "Used for auto-completion in file dialogs, for example"
-#~ msgstr "Koristi se, na primjer za samo-kompletiranje u datotečnim dialozima"
-
-#~ msgid "Show file preview in file dialog"
-#~ msgstr "Prikaži pregled datoteke u datotečnom dialogu"
-
-#~ msgid "Show hidden files"
-#~ msgstr "Prikaži sakrivene datoteke"
-
-#~ msgid ""
-#~ "Whether files starting with a dot (convention for hidden files) should be "
-#~ "shown"
-#~ msgstr "Uvijek prikaži datoteke koje počinju sa točkom (sakrivene daoteke)"
-
-#~ msgid "Show speedbar"
-#~ msgstr "Prikaži traku s brzobirom"
-
-#~ msgid ""
-#~ "Whether the shortcut icons to the left in the file dialog should be shown"
-#~ msgstr "Uvijek prikaži ikone prečaca s lijeve strane u datotečnom dialogu"
-
-#~ msgid "What country"
-#~ msgstr "Koja zemlja"
-
-#~ msgid ""
-#~ "Used to determine how to display numbers, currency and time/date, for "
-#~ "example"
-#~ msgstr ""
-#~ "Korisiti se, na primjer za određivanje kako prikazati brojeve, valutu i "
-#~ "vrijeme/datum"
-
-#~ msgid "What language to use to display text"
-#~ msgstr "Kojim jezikom treba prikazati tekst"
-
-#~ msgid "Character used for indicating positive numbers"
-#~ msgstr "Kojim znakom treba označiti pozitivne brojeve"
-
-#~ msgid "Most countries have no character for this"
-#~ msgstr "Većina zemalja za ovo nema znak"
-
-#~ msgid "Path to the autostart directory"
-#~ msgstr "Putanja do autostart direktorija"
-
-#~ msgid ""
-#~ "Path to the directory containing executables to be run on session login"
-#~ msgstr ""
-#~ "Putanja do direktorija sa programima koje treba pokrenuti prilikom "
-#~ "logiranja u sesiju."
-
-#~ msgid "Enable SOCKS support"
-#~ msgstr "Omogući podršku za SOCKS"
-
-#~ msgid "Whether SOCKS version 4 and 5 should be enabled in KDE's sub systems"
-#~ msgstr "Obje SOCKS verzije, 4 i 5 biti će omogućene u KDE-ovom podsustavu"
-
-#~ msgid "Path to custom SOCKS library"
-#~ msgstr "Putanja do prilagođene SOCKS biblioteke"
-
-#~ msgid "Highlight toolbar buttons on mouse over"
-#~ msgstr "Osvjetli gumbe alatne trake prilikom prelaska miša"
-
-#~ msgid "Show text on toolbar icons "
-#~ msgstr "Prikaži tekst na ikonama alatne trake"
-
-#~ msgid "Whether text should be shown in addition to icons on toolbar icons"
-#~ msgstr "Uvijek prikaži teskt uz ikone na ikonama alatne trake"
-
-#~ msgid "Password echo type"
-#~ msgstr "Tip prikaza zaporke"
-
-#~ msgid "The size of the dialog"
-#~ msgstr "Veličina dialoga"
-
-#~ msgid "Anytime"
-#~ msgstr "Bilo kad"
-
-#~ msgid "Before"
-#~ msgstr "Prije"
-
-#~ msgid "After"
-#~ msgstr "Nakon"
-
-#~ msgid "Today"
-#~ msgstr "Danas"
-
-#~ msgid "ThreadWeaver Jobs Examples"
-#~ msgstr "Primjeri ThreadWeaver poslova"
-
-#~ msgid ""
-#~ "The program executes 100 jobs in 4 threads. Each job waits for a random "
-#~ "number of milliseconds between 1 and 1000."
-#~ msgstr ""
-#~ "Program izvršava 100 poslova u 4 niza. Svaki posao čeka na slučajni broj "
-#~ "milisekundi između 1 i 1000."
-
-#~ msgid ""
-#~ "Check to see logging information about thread activity. Watch the console "
-#~ "output to see the log information."
-#~ msgstr ""
-#~ "Provjeri dnevničke informacije o aktivnosti slijeda. Prati konzolni izlaz "
-#~ "da biste vidjeli dnevničke informacije. "
-
-#~ msgid "Log thread activity"
-#~ msgstr "Dnevnik aktivnosti u nizu"
-
-#~ msgid "Displays Thread Activity"
-#~ msgstr "Prikaz aktivnosti niza"
-
-#~ msgid "Start"
-#~ msgstr "Započni"
-
-#~ msgid "GUI based example for the Weaver Thread Manager"
-#~ msgstr "GUI prrimjer Weaver Thread upravitelja"
-
-#~ msgid "Remaining number of jobs:"
-#~ msgstr "Preostali broj poslova:"
-
-#~ msgid "What time is it? Click to update."
-#~ msgstr "Koliko je sati? Kliknite za ažuriranje."
-
-#~ msgid ""
-#~ "(do not know yet)
"
-#~ msgstr ""
-#~ "(još ne znam)
"
-
-#~ msgid "Select Files..."
-#~ msgstr "Odaberi datoteke…"
-
-#~ msgid "Cancel"
-#~ msgstr "Odustani"
-
-#~ msgid "Suspend"
-#~ msgstr "Suspendiraj"
-
-#~ msgid "Name"
-#~ msgstr "Naziv"
-
-#~ msgid "Host"
-#~ msgstr "Domaćin"
-
-#~ msgid "Port"
-#~ msgstr "Ulaz"
-
-#~ msgid "i18n() takes at least one argument"
-#~ msgstr "i18n() zahtijeva barem jedan argument"
-
-#~ msgid "i18nc() takes at least two arguments"
-#~ msgstr "i18nc() zahtijeva barem dva argumenta"
-
-#~ msgid "i18np() takes at least two arguments"
-#~ msgstr "i18np() zahtijeva barem dva argumenta"
-
-#~ msgid "i18ncp() takes at least three arguments"
-#~ msgstr "i18ncp() zahtijeva barem tri argumenta"
-
-#~ msgid "System Default (currently: %1)"
-#~ msgstr "Zadano sustavom (trenutno: %1)"
-
-#~ msgid ""
-#~ "The template needs information about you, which is stored in your address "
-#~ "book.\n"
-#~ "However, the required plugin could not be loaded.\n"
-#~ "\n"
-#~ "Please install the KDEPIM/Kontact package for your system."
-#~ msgstr ""
-#~ "Predlošku su potrebne informacije o vama, a koje su pohranjene u vašem "
-#~ "adresaru.\n"
-#~ "Također, ne mogu učitati potreban priključak.\n"
-#~ "\n"
-#~ "Molim instalirajte KDEPIM/Kontact paket na vašem sustavu."
-
-#~ msgid "Only local files are supported."
-#~ msgstr "Podržane su samo lokalne datoteke."
-
-#~ msgid "Keep output results from scripts"
-#~ msgstr "Zadrži izlazne rezultate skripte."
-
-#~ msgid "Check whether config file itself requires updating"
-#~ msgstr "Provjerite je li potrebno ažuriranje konfiguracijske datoteke"
-
-#~ msgid "File to read update instructions from"
-#~ msgstr "Nije uspjelo čitanje ažuriranih uputa iz"
-
-#~ msgid "KConf Update"
-#~ msgstr "KConf ažuriranje"
-
-#~ msgid "KDE Tool for updating user configuration files"
-#~ msgstr "KDE alat za ažuriranje korisničkih konfiguracijskih datoteka"
-
-#~ msgid "(c) 2001, Waldo Bastian"
-#~ msgstr "© 2001 Waldo Bastian"
-
-#~ msgid "Waldo Bastian"
-#~ msgstr "Waldo Bastian"
-
-#~ msgid "??"
-#~ msgstr "??"
-
-#~ msgid "&About"
-#~ msgstr "O &programu"
-
-#~ msgid ""
-#~ "No information available.\n"
-#~ "The supplied KAboutData object does not exist."
-#~ msgstr ""
-#~ "Nema dostupnih podataka.\n"
-#~ "Navedeni objekt KAboutData ne postoji."
-
-#~ msgid "A&uthor"
-#~ msgstr "&Autor"
-
-#~ msgid "A&uthors"
-#~ msgstr "&Autori"
-
-#~ msgid ""
-#~ "Please use http://bugs.kde.org to "
-#~ "report bugs.\n"
-#~ msgstr ""
-#~ "Molim koristite http://bugs.kde.org "
-#~ "za prijavljivanje grešaka.\n"
-
-#~ msgid "Please report bugs to %2 .\n"
-#~ msgstr ""
-#~ "Molim Vas koristite %2 .\n"
-#~ " da biste prijavili greške.\n"
-
-#~ msgid "&Thanks To"
-#~ msgstr "&Zahvale"
-
-#~ msgid "T&ranslation"
-#~ msgstr "&Prijevod"
-
-#~ msgid "&License Agreement"
-#~ msgstr "&Licenčni ugovor"
-
-#~ msgid "Author"
-#~ msgstr "Autor"
-
-#~ msgid "Email"
-#~ msgstr "E-pošta"
-
-#~ msgid "Homepage"
-#~ msgstr "Osobna stranica"
-
-#~ msgid "Task"
-#~ msgstr "Zadatak"
-
-#~ msgid ""
-#~ "%1 version %2 Using KDE %3"
-#~ "html>"
-#~ msgstr ""
-#~ "%1 inačica %2 Koristeći KDE "
-#~ "%3"
-
-#~ msgid "%1 %2, %3"
-#~ msgstr "%1 %2, %3"
-
-#~ msgid "Other Contributors:"
-#~ msgstr "Ostali pridonositelji:"
-
-#~ msgid "(No logo available)"
-#~ msgstr "(Nema dostupnog logotipa)"
-
-#~ msgid "About %1"
-#~ msgstr "O programu %1"
-
-#~ msgid "Close"
-#~ msgstr "Zatvori"
-
-#~ msgctxt "Freeze the window geometry"
-#~ msgid "Freeze"
-#~ msgstr "Zamrzni"
-
-#~ msgctxt "Dock this window"
-#~ msgid "Dock"
-#~ msgstr "Usidri"
-
-#~ msgid "Detach"
-#~ msgstr "Odvoji"
-
-#~ msgid "Hide %1"
-#~ msgstr "Sakrij %1"
-
-#~ msgid "Show %1"
-#~ msgstr "Prikaži %1"
-
-#~ msgid "Search Columns"
-#~ msgstr "Pretraži stupce"
-
-#~ msgid "All Visible Columns"
-#~ msgstr "Sve vidljive stupce"
-
-#~ msgctxt "Column number %1"
-#~ msgid "Column No. %1"
-#~ msgstr "Stupac br. %1"
-
-#~ msgid "S&earch:"
-#~ msgstr "&Traži"
-
-#~ msgctxt "@option:check"
-#~ msgid "Do Spellchecking"
-#~ msgstr "Provjeri pravopis"
-
-#~ msgctxt "@option:check"
-#~ msgid "Create &root/affix combinations not in dictionary"
-#~ msgstr "Stvaraj korijen/afiks kombinacije koje nisu u rječniku"
-
-#~ msgctxt "@option:check"
-#~ msgid "Consider run-together &words as spelling errors"
-#~ msgstr "Smatraj spojene riječi pravopisnim pogreškama"
-
-#~ msgctxt "@label:listbox"
-#~ msgid "&Dictionary:"
-#~ msgstr "&Rječnik:"
-
-#~ msgctxt "@label:listbox"
-#~ msgid "&Encoding:"
-#~ msgstr "Kodiranj&e:"
-
-#~ msgctxt "@item:inlistbox Spell checker"
-#~ msgid "International Ispell "
-#~ msgstr "Internacionalan Ispell "
-
-#~ msgctxt "@item:inlistbox Spell checker"
-#~ msgid "Aspell "
-#~ msgstr "Aspell "
-
-#~ msgctxt "@item:inlistbox Spell checker"
-#~ msgid "Hspell "
-#~ msgstr "Hspell "
-
-#~ msgctxt "@item:inlistbox Spell checker"
-#~ msgid "Zemberek "
-#~ msgstr "Zemberek "
-
-#~ msgctxt "@item:inlistbox Spell checker"
-#~ msgid "Hunspell "
-#~ msgstr "Hunspell "
-
-#~ msgctxt "@label:listbox"
-#~ msgid "&Client:"
-#~ msgstr "&Klijent:"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "Hebrew"
-#~ msgstr "Hebrejski"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "Turkish"
-#~ msgstr "Turski"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "English"
-#~ msgstr "Engleski"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "Spanish"
-#~ msgstr "Španjolski"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "Danish"
-#~ msgstr "Danski"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "German"
-#~ msgstr "Njemački"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "German (new spelling)"
-#~ msgstr "Njemački (novi pravopis)"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "Brazilian Portuguese"
-#~ msgstr "Brazilski portugalski"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "Portuguese"
-#~ msgstr "Portugalski"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "Esperanto"
-#~ msgstr "Esperanto"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "Norwegian"
-#~ msgstr "Norveški"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "Polish"
-#~ msgstr "Poljski"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "Russian"
-#~ msgstr "Ruski"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "Slovenian"
-#~ msgstr "Slovenski"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "Slovak"
-#~ msgstr "Slovački"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "Czech"
-#~ msgstr "Češki"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "Swedish"
-#~ msgstr "Švedski"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "Swiss German"
-#~ msgstr "Švicarski njemački"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "Ukrainian"
-#~ msgstr "Ukrajinski"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "Lithuanian"
-#~ msgstr "Litvanski"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "French"
-#~ msgstr "Francuski"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "Belarusian"
-#~ msgstr "Bjeloruski"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "Hungarian"
-#~ msgstr "Mađarski"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "Unknown"
-#~ msgstr "Nepoznato"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "ISpell Default"
-#~ msgstr "ISpell Uobičajeno"
-
-#~ msgctxt "@item Spelling dictionary: %1 dictionary name, %2 file name"
-#~ msgid "Default - %1 [%2]"
-#~ msgstr "Uobičajeno – %1 [%2]"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "ASpell Default"
-#~ msgstr "ASpell Uobičajeno"
-
-#~ msgctxt "@item Spelling dictionary: %1 dictionary name"
-#~ msgid "Default - %1"
-#~ msgstr "Uobičajeno – %1"
-
-#~ msgctxt "@item Spelling dictionary"
-#~ msgid "Hunspell Default"
-#~ msgstr "Zadan Hunspell "
-
-#~ msgid "You have to restart the dialog for changes to take effect"
-#~ msgstr "Da bi izmijene imale učinak potrebno je ponovo pokrenuti dijalog"
-
-#~ msgid "Spell Checker"
-#~ msgstr "Provjera pravopisa"
-
-#~ msgid "Check Spelling"
-#~ msgstr "Provjeri pravopis"
-
-#~ msgid "&Finished"
-#~ msgstr "&Završeno"
-
-#~ msgid "As-you-type spell checking enabled."
-#~ msgstr "Provjera pravopisa tijekom pisanja je omogućena."
-
-#~ msgid "As-you-type spell checking disabled."
-#~ msgstr "Provjera pravopisa tijekom pisanja je onemogućena."
-
-#~ msgid "Incremental Spellcheck"
-#~ msgstr "Inkrementalna provjera pravopisa"
-
-#~ msgid "Too many misspelled words. As-you-type spell checking disabled."
-#~ msgstr ""
-#~ "Potoji previše pogrešno napisanih riječi. Provjera pravopisa tijekom "
-#~ "pisanja je onemogućena."
-
-#~ msgid "Check Spelling..."
-#~ msgstr "Provjeri pravopis…"
-
-#~ msgid "Auto Spell Check"
-#~ msgstr "Automatskap provjera pravopisa"
-
-#~ msgid "Allow Tabulations"
-#~ msgstr "Dostupne tabulacije"
-
-#~ msgid "Spell Checking"
-#~ msgstr "Provjera pravopisa"
-
-#~ msgid "&Back"
-#~ msgstr "&Prethodno"
-
-#~ msgctxt "Opposite to Back"
-#~ msgid "&Next"
-#~ msgstr "&Sljedeće"
-
-#~ msgid "&Password:"
-#~ msgstr "&Zaporka:"
-
-#~ msgid "&Keep password"
-#~ msgstr "&Čuvaj zaporku"
-
-#~ msgid ""
-#~ "The password strength meter gives an indication of the security of the "
-#~ "password you have entered. To improve the strength of the password, "
-#~ "try:\n"
-#~ " - using a longer password;\n"
-#~ " - using a mixture of upper- and lower-case letters;\n"
-#~ " - using numbers or symbols, such as #, as well as letters."
-#~ msgstr ""
-#~ "Mjerač kvalitete zaporke pokazuje njenu visinu sigurnosti. Za povećanje "
-#~ "kvalitete zaporke pokušajte slijedeće:\n"
-#~ "- koristite dulju zaporku;\n"
-#~ " – koristite mješavinu velikih i malih slova;\n"
-#~ "- koristite brojeve ili simbole, kao što je # uz slova."
-
-#~ msgid "You entered two different passwords. Please try again."
-#~ msgstr "Upisali ste dvije različite zaporke. Pokušajte ponovno."
-
-#~ msgid ""
-#~ "The password you have entered has a low strength. To improve the strength "
-#~ "of the password, try:\n"
-#~ " - using a longer password;\n"
-#~ " - using a mixture of upper- and lower-case letters;\n"
-#~ " - using numbers or symbols as well as letters.\n"
-#~ "\n"
-#~ "Would you like to use this password anyway?"
-#~ msgstr ""
-#~ "Zaporka koju ste unjeli slabe je kvalitete. Za povećanje njnezine "
-#~ "kvalitete pokušajte slijedeće:\n"
-#~ "- koristite dulju zaporku;\n"
-#~ " – koristite mješavinu velikih i malih slova;\n"
-#~ "- koristite brojeve ili simbole uz slova.\n"
-#~ "\n"
-#~ "Ili ipak želite koristiti ovu zaporku?"
-
-#~ msgid "Low Password Strength"
-#~ msgstr "Slaba zaporka"
-
-#~ msgid "Password Input"
-#~ msgstr "Unos zaporke"
-
-#~ msgid "Password is empty"
-#~ msgstr "Nema zaporke"
-
-#~ msgid "Password must be at least 1 character long"
-#~ msgid_plural "Password must be at least %1 characters long"
-#~ msgstr[0] "Zaporka mora biti dugačka bar %1 znak"
-#~ msgstr[1] "Zaporka mora biti dugačka bar %1 znaka"
-#~ msgstr[2] "Zaporka mora biti dugačka bar %1 znakova"
-
-#~ msgid "Passwords match"
-#~ msgstr "Zaporke se podudaraju"
-
-#~ msgid "Undo: %1"
-#~ msgstr "Poništi: %1"
-
-#~ msgid "Redo: %1"
-#~ msgstr "Vrati: %1"
-
-#~ msgid "&Undo"
-#~ msgstr "&Poništi"
-
-#~ msgid "&Redo"
-#~ msgstr "&Vrati"
-
-#~ msgid "&Undo: %1"
-#~ msgstr "&Poništi: %1"
-
-#~ msgid "&Redo: %1"
-#~ msgstr "&Vrati: %1"
-
-#~ msgid "Unknown View"
-#~ msgstr "Nepoznati prikaz"
-
-#~ msgid ""
-#~ "A command-line application that can be used to run KUnitTest modules."
-#~ msgstr ""
-#~ "Naredbeno linijska aplikacija koja može biti korištena da pokreće modul "
-#~ "KUnitTest."
-
-#~ msgid "Only run modules whose filenames match the regexp."
-#~ msgstr ""
-#~ "Pokreći samo module čiji datotečni nazivi zadovoljavaju regularni izraz."
-
-#~ msgid ""
-#~ "Only run tests modules which are found in the folder. Use the query "
-#~ "option to select modules."
-#~ msgstr ""
-#~ "Pokreći samo testne module koji su nađeni u mapi. Koristi opcije upita da "
-#~ "bi odabrao module."
-
-#~ msgid ""
-#~ "Disables debug capturing. You typically use this option when you use the "
-#~ "GUI."
-#~ msgstr ""
-#~ "Onemogući proces ispravljanja. Obično se ova opcija koristi kada koritite "
-#~ "GUI."
-
-#~ msgid "KUnitTest ModRunner"
-#~ msgstr "KUnitTest ModRunner"
-
-#~ msgid "(C) 2005 Jeroen Wijnhout"
-#~ msgstr "© 2005 Jeroen Wijnhout"
-
-#~ msgid "kde4-config"
-#~ msgstr "kde4-config"
-
-#~ msgid "A little program to output installation paths"
-#~ msgstr "Mali program za ispis instalacijskih putanja"
-
-#~ msgid "(C) 2000 Stephan Kulow"
-#~ msgstr "© 2000 Stephan Kulow"
-
-#~ msgid "Left for legacy support"
-#~ msgstr "Ostavljeno radi podrške ostavštini"
-
-#~ msgid "Compiled in prefix for KDE libraries"
-#~ msgstr "Prevedeno u prefiksu za KDE biblioteke"
-
-#~ msgid "Compiled in exec_prefix for KDE libraries"
-#~ msgstr "Prevedeno u exec-prefiksu za KDE biblioteke"
-
-#~ msgid "Compiled in library path suffix"
-#~ msgstr "Prevedeno u putanji bibliotečnog sufiksa"
-
-#~ msgid "Prefix in $HOME used to write files"
-#~ msgstr "Korišten je prefiks $HOME pri zapisu datoteka"
-
-#~ msgid "Compiled in version string for KDE libraries"
-#~ msgstr "Prevedeno u stringu verziije za KDE biblioteke"
-
-#~ msgid "Available KDE resource types"
-#~ msgstr "Dostupni tipovi KDE resursa"
-
-#~ msgid "Search path for resource type"
-#~ msgstr "Putanja pretrage za podatkovni tip"
-
-#~ msgid "Find filename inside the resource type given to --path"
-#~ msgstr "Traži po nazivu datoteke unutar podatkovnog tipa datog sa --path"
-
-#~ msgid "User path: desktop|autostart|document"
-#~ msgstr "Korisnička putanja: radna površina|autostart|dokument"
-
-#~ msgid "Prefix to install resource files to"
-#~ msgstr "Prefiks za instalaciju resursnih datoteka"
-
-#~ msgid "Installation prefix for Qt"
-#~ msgstr "Instalacijski prefiks za Qt."
-
-#~ msgid "Location of installed Qt binaries"
-#~ msgstr "Lokacija instaliranih Qt binarnih datoteka"
-
-#~ msgid "Location of installed Qt libraries"
-#~ msgstr "Lokacija instaliranih Qt biblioteka"
-
-#~ msgid "Location of installed Qt plugins"
-#~ msgstr "Lokacija instaliranih Qt priključaka"
-
-#~ msgid "Applications menu (.desktop files)"
-#~ msgstr "Izbornik aplikacija (.desktop datoteke)"
-
-#~ msgid "Autostart directories"
-#~ msgstr "Autostart direktoriji"
-
-#~ msgid "Cached information (e.g. favicons, web-pages)"
-#~ msgstr "Informacije iz međuspemnika (npr. favicon-e, web-stranice)"
-
-#~ msgid "CGIs to run from kdehelp"
-#~ msgstr "CGI-i za pokretanje iz kdehelp-a"
-
-#~ msgid "Configuration files"
-#~ msgstr "Postavne datoteke"
-
-#~ msgid "Where applications store data"
-#~ msgstr "Gdje aplikacije pohranjuju podatke"
-
-#~ msgid "Emoticons"
-#~ msgstr "Emotikone"
-
-#~ msgid "Executables in $prefix/bin"
-#~ msgstr "Izvršne datoteke u $prefix/bin"
-
-#~ msgid "HTML documentation"
-#~ msgstr "HTML dokumentacija"
-
-#~ msgid "Icons"
-#~ msgstr "Ikone"
-
-#~ msgid "Configuration description files"
-#~ msgstr "Datoteke s opisom postavki"
-
-#~ msgid "Libraries"
-#~ msgstr "Biblioteke"
-
-#~ msgid "Includes/Headers"
-#~ msgstr "Includes/Headers"
-
-#~ msgid "Translation files for KLocale"
-#~ msgstr "Datoteke prevoda za KLocale"
-
-#~ msgid "Mime types"
-#~ msgstr "Mime tipovi"
-
-#~ msgid "Loadable modules"
-#~ msgstr "Učitljivi moduli"
-
-#~ msgid "Legacy pixmaps"
-#~ msgstr "Zastarjele piksmape"
-
-#~ msgid "Qt plugins"
-#~ msgstr "Qt priključci"
-
-#~ msgid "Services"
-#~ msgstr "Servisi"
-
-#~ msgid "Service types"
-#~ msgstr "Servisni tipovi"
-
-#~ msgid "Application sounds"
-#~ msgstr "Zvukovi aplikacije"
-
-#~ msgid "Templates"
-#~ msgstr "Predlošci"
-
-#~ msgid "Wallpapers"
-#~ msgstr "Tapete"
-
-#~ msgid "XDG Application menu (.desktop files)"
-#~ msgstr "XDG aplikacijski izbornik (.desktop datoteke)"
-
-#~ msgid "XDG Menu descriptions (.directory files)"
-#~ msgstr "XDG opisi izbornika (.directory datoteke)"
-
-#~ msgid "XDG Icons"
-#~ msgstr "XDG ikone"
-
-#~ msgid "XDG Mime Types"
-#~ msgstr "XDG mime tipovi"
-
-#~ msgid "XDG Menu layout (.menu files)"
-#~ msgstr "XDG rapored izbornika (.menu datoteke)"
-
-#~ msgid "XDG autostart directory"
-#~ msgstr "XDG autostart direktorij"
-
-#~ msgid "Temporary files (specific for both current host and current user)"
-#~ msgstr ""
-#~ "Privremene datoteke (specifične i za trenutnog domaćina i trenutnog "
-#~ "korisnika)"
-
-#~ msgid "UNIX Sockets (specific for both current host and current user)"
-#~ msgstr ""
-#~ "UNIX-spojna točka (specifično za trenutno računalo kao i trenutnog "
-#~ "korisnika)"
-
-#~ msgid "%1 - unknown type\n"
-#~ msgstr "%1 – nepoznati tip\n"
-
-#~ msgid "%1 - unknown type of userpath\n"
-#~ msgstr "%1 – nepoznati tip korisničke putanje\n"
-
-#~ msgid "DBus Backend error: connection to helper failed. %1"
-#~ msgstr ""
-#~ "Pogreška DBus pozadinskog sustava: povezivanje na pomagaća nije uspjelo. "
-#~ "%1"
-
-#~ msgid ""
-#~ "DBus Backend error: could not contact the helper. Connection error: %1. "
-#~ "Message error: %2"
-#~ msgstr ""
-#~ "Pogreška pozadinskog sustava DBus: nije moguće kontaktirati pomagača. "
-#~ "Pogreška veze: %1. Poruka pogreške: %2"
-
-#~ msgid "DBus Backend error: received corrupt data from helper %1 %2"
-#~ msgstr ""
-#~ "Pogreška pozadinskog sustava DBus: primljen je pokvaren podatak od "
-#~ "pomagača %1 %2"
-
-#~ msgid "Please contact your system administrator."
-#~ msgstr "Kontaktirajte vašeg administratora sustava."
-
-#~ msgid "Configuration file \"%1\" not writable.\n"
-#~ msgstr "Zapisivanje u datoteku konfiguracije \"%1\" nije dopušteno.\n"
-
-#~ msgid "No target filename has been given."
-#~ msgstr "Nije zadan ciljni naziv datoteke"
-
-#~ msgid "Already opened."
-#~ msgstr "Datoteka je već otvorena."
-
-#~ msgid "Insufficient permissions in target directory."
-#~ msgstr "Nedovoljne ovlasti u ciljnom direktoriju"
-
-#~ msgid "Unable to open temporary file."
-#~ msgstr "Nije moguće otvoriti privremenu datoteku."
-
-#~ msgid "Synchronization to disk failed"
-#~ msgstr "Sinkronizacija na disk nije uspjela"
-
-#~ msgid "Error during rename."
-#~ msgstr "Pogreška kod promjene imena."
-
-#~ msgid ""
-#~ "No licensing terms for this program have been specified.\n"
-#~ "Please check the documentation or the source for any\n"
-#~ "licensing terms.\n"
-#~ msgstr ""
-#~ "Za ovaj program nema odredbi uvjeta licenciranja.\n"
-#~ "Za uvjete licenciranja provjerite dokumentaciju ili\n"
-#~ "izvorni kod.\n"
-
-#~ msgid "This program is distributed under the terms of the %1."
-#~ msgstr "Ovaj program se distribuira pod uvjetima %1."
-
-#~ msgctxt "@item license (short name)"
-#~ msgid "GPL v2"
-#~ msgstr "GPL v2"
-
-#~ msgctxt "@item license"
-#~ msgid "GNU General Public License Version 2"
-#~ msgstr "GNU General Public License Version 2"
-
-#~ msgctxt "@item license (short name)"
-#~ msgid "LGPL v2"
-#~ msgstr "LGPL v2"
-
-#~ msgctxt "@item license"
-#~ msgid "GNU Lesser General Public License Version 2"
-#~ msgstr "GNU Lesser General Public License Version 2"
-
-#~ msgctxt "@item license (short name)"
-#~ msgid "BSD License"
-#~ msgstr "BSD Licenca"
-
-#~ msgctxt "@item license"
-#~ msgid "BSD License"
-#~ msgstr "BSD Licenca"
-
-#~ msgctxt "@item license (short name)"
-#~ msgid "Artistic License"
-#~ msgstr "Artistic licenca"
-
-#~ msgctxt "@item license"
-#~ msgid "Artistic License"
-#~ msgstr "Artistic licenca"
-
-#~ msgctxt "@item license (short name)"
-#~ msgid "QPL v1.0"
-#~ msgstr "QPL v1.0"
-
-#~ msgctxt "@item license"
-#~ msgid "Q Public License"
-#~ msgstr "Q Javna Licenca"
-
-#~ msgctxt "@item license (short name)"
-#~ msgid "GPL v3"
-#~ msgstr "GPL v3"
-
-#~ msgctxt "@item license"
-#~ msgid "GNU General Public License Version 3"
-#~ msgstr "GNU General Public License Version 3"
-
-#~ msgctxt "@item license (short name)"
-#~ msgid "LGPL v3"
-#~ msgstr "LGPL v3"
-
-#~ msgctxt "@item license"
-#~ msgid "GNU Lesser General Public License Version 3"
-#~ msgstr "GNU Lesser General Public License Version 3"
-
-#~ msgctxt "@item license"
-#~ msgid "Custom"
-#~ msgstr "Prilagođeno"
-
-#~ msgctxt "@item license"
-#~ msgid "Not specified"
-#~ msgstr "Nije određeno"
-
-#~ msgctxt "replace this with information about your translation team"
-#~ msgid ""
-#~ "KDE is translated into many languages thanks to the work of the "
-#~ "translation teams all over the world.
For more information on KDE "
-#~ "internationalization visit http://l10n."
-#~ "kde.org
"
-#~ msgstr ""
-#~ "KDE je preveden na više jezika zahvaljujući radu prevoditeljskih "
-#~ "timova u cijelom svijetu.
Za više informacija o "
-#~ "internacionalizaciji KDE-a posjetite http://l10n.kde.org
"
-
-#~ msgid "Use the X-server display 'displayname'"
-#~ msgstr "Koristite prikaz X-poslužitelja 'displayname'."
-
-#~ msgid "Use the QWS display 'displayname'"
-#~ msgstr "Koristite QWS prikaz 'displayname'."
-
-#~ msgid "Restore the application for the given 'sessionId'"
-#~ msgstr "Vrati aplikaciju za zadani 'sessionId'"
-
-#~ msgid ""
-#~ "Causes the application to install a private color\n"
-#~ "map on an 8-bit display"
-#~ msgstr ""
-#~ "Uzrokuje da aplikacija postavi privatnu mapu\n"
-#~ "boja na 8-bitnom zaslonu."
-
-#~ msgid ""
-#~ "Limits the number of colors allocated in the color\n"
-#~ "cube on an 8-bit display, if the application is\n"
-#~ "using the QApplication::ManyColor color\n"
-#~ "specification"
-#~ msgstr ""
-#~ "Ograničava broj boja povezanih u kocki\n"
-#~ "boja na 8-bitnom zaslonu, ako aplikacija\n"
-#~ "koristi QApplication::ManyColor \n"
-#~ "specifikacije boja."
-
-#~ msgid "tells Qt to never grab the mouse or the keyboard"
-#~ msgstr "govori Qt-u da nikad ne preuzme miša ili tastaturu"
-
-#~ msgid ""
-#~ "running under a debugger can cause an implicit\n"
-#~ "-nograb, use -dograb to override"
-#~ msgstr ""
-#~ "pokretanje pod debugger-om može uzrokovati implicitni\n"
-#~ "-nograb, koristite -dograb da biste to izbjegli."
-
-#~ msgid "switches to synchronous mode for debugging"
-#~ msgstr "prebacuje u sinkroni mod za traženje grešaka."
-
-#~ msgid "defines the application font"
-#~ msgstr "definira pismo aplikacije."
-
-#~ msgid ""
-#~ "sets the default background color and an\n"
-#~ "application palette (light and dark shades are\n"
-#~ "calculated)"
-#~ msgstr ""
-#~ "postavlja uobičajenu boju pozadine i\n"
-#~ "paletu aplikacije (svijetle i tamne sjene se\n"
-#~ "izračunavaju)."
-
-#~ msgid "sets the default foreground color"
-#~ msgstr "postavlja uobičajenu boju prvog plana"
-
-#~ msgid "sets the default button color"
-#~ msgstr "postavlja uobičajenu boju gumba"
-
-#~ msgid "sets the application name"
-#~ msgstr "postavlja naziv aplikacije"
-
-#~ msgid "sets the application title (caption)"
-#~ msgstr "postavlja naslov aplikacije (naslov)"
-
-#~ msgid ""
-#~ "forces the application to use a TrueColor visual on\n"
-#~ "an 8-bit display"
-#~ msgstr ""
-#~ "prisiljava aplikaciju da koristi TrueColor prikaz na\n"
-#~ "na 8-bitnom zaslonu."
-
-#~ msgid ""
-#~ "sets XIM (X Input Method) input style. Possible\n"
-#~ "values are onthespot, overthespot, offthespot and\n"
-#~ "root"
-#~ msgstr ""
-#~ "postavlja XIM (X Input Method) stil unosa. Moguće\n"
-#~ "vrijednosti su onthespot, overthespot, offthespot i\n"
-#~ "root"
-
-#~ msgid "set XIM server"
-#~ msgstr "postavlja XIM poslužitelj"
-
-#~ msgid "disable XIM"
-#~ msgstr "Onemogući XIM"
-
-#~ msgid "forces the application to run as QWS Server"
-#~ msgstr "tjera aplikaciju da radi kao QWS poslužitelj."
-
-#~ msgid "mirrors the whole layout of widgets"
-#~ msgstr "zrcali čitav raspored widgeta."
-
-#~ msgid "applies the Qt stylesheet to the application widgets"
-#~ msgstr "primijeni stilski predložak Qt-a na aplikacijske widgete"
-
-#~ msgid ""
-#~ "use a different graphics system instead of the default one, options are "
-#~ "raster and opengl (experimental)"
-#~ msgstr ""
-#~ "koristi drugi grafički sustav umjesto zadanog, opcije su raster i opengl "
-#~ "(eksperimentalno)"
-
-#~ msgid "Use 'caption' as name in the titlebar"
-#~ msgstr "Koristi 'naslov' kao tekst naslovne trake"
-
-#~ msgid "Use 'icon' as the application icon"
-#~ msgstr "Koristi 'ikonu' kao ikonu apikacije"
-
-#~ msgid "Use alternative configuration file"
-#~ msgstr "Koristi alternativnu datoteku s postavkama"
-
-#~ msgid "Disable crash handler, to get core dumps"
-#~ msgstr ""
-#~ "Onemogućuje voditelja rušenja (crash handler), za dobivanje sadržaja "
-#~ "jezgre (core dump)."
-
-#~ msgid "Waits for a WM_NET compatible windowmanager"
-#~ msgstr "Čeka WM_NET kompatibilni upravitelj prozorima"
-
-#~ msgid "sets the application GUI style"
-#~ msgstr "postavlja GUI stil aplikacije"
-
-#~ msgid ""
-#~ "sets the client geometry of the main widget - see man X for the argument "
-#~ "format (usually WidthxHeight+XPos+YPos)"
-#~ msgstr ""
-#~ "postavlja geometriju klijenta glavnog widgeta – pogledajte man X za oblik "
-#~ "argumenta (obično WidthxHeight+XPos+YPos)"
-
-#~ msgid "KDE Application"
-#~ msgstr "KDE Aplikacija"
-
-#~ msgid "Qt"
-#~ msgstr "Qt"
-
-#~ msgid "KDE"
-#~ msgstr "KDE"
-
-#~ msgid "Unknown option '%1'."
-#~ msgstr "Nepoznata opcija '%1'."
-
-#~ msgctxt "@info:shell %1 is cmdoption name"
-#~ msgid "'%1' missing."
-#~ msgstr "'%1' nedostaje."
-
-#~ msgctxt ""
-#~ "@info:shell message on appcmd --version; do not translate 'Development "
-#~ "Platform'%3 application name, other %n version strings"
-#~ msgid ""
-#~ "Qt: %1\n"
-#~ "KDE Development Platform: %2\n"
-#~ "%3: %4\n"
-#~ msgstr ""
-#~ "Qt: %1\n"
-#~ "KDE Development Platform: %2\n"
-#~ "%3: %4\n"
-
-#~ msgctxt "the 2nd argument is a list of name+address, one on each line"
-#~ msgid ""
-#~ "%1 was written by\n"
-#~ "%2"
-#~ msgstr ""
-#~ "%1 je napisao:\n"
-#~ "%2"
-
-#~ msgid ""
-#~ "This application was written by somebody who wants to remain anonymous."
-#~ msgstr "Ovu aplikaciju je napisao netko tko želi ostati anoniman."
-
-#~ msgid "Please use http://bugs.kde.org to report bugs.\n"
-#~ msgstr "Nedostatke prijavite na adresi http://bugs.kde.org\n"
-
-#~ msgid "Please report bugs to %1.\n"
-#~ msgstr "Nedostatke prijavite na adresi %1\n"
-
-#~ msgid "Unexpected argument '%1'."
-#~ msgstr "Nepčekivani argument '%1'."
-
-#~ msgid "Use --help to get a list of available command line options."
-#~ msgstr ""
-#~ "Za dobivanje popisa raspoloživih opcija naredbenog retka upotrijebite --"
-#~ "help."
-
-#~ msgid "[options] "
-#~ msgstr "[opcije]"
-
-#~ msgid "[%1-options]"
-#~ msgstr "[%1-opcije]"
-
-#~ msgid "Usage: %1 %2\n"
-#~ msgstr "Upotreba: %1 %2\n"
-
-#~ msgid ""
-#~ "\n"
-#~ "Generic options:\n"
-#~ msgstr ""
-#~ "\n"
-#~ "Generičke opcije:\n"
-
-#~ msgid "Show help about options"
-#~ msgstr "Prikaži pomoć za opcije"
-
-#~ msgid "Show %1 specific options"
-#~ msgstr "Prikaži opcije za %1"
-
-#~ msgid "Show all options"
-#~ msgstr "Prikaži sve opcije"
-
-#~ msgid "Show author information"
-#~ msgstr "Prikaži podatke o autoru"
-
-#~ msgid "Show version information"
-#~ msgstr "Prikaži podatke o verziji"
-
-#~ msgid "Show license information"
-#~ msgstr "Prikaži podatke o licenci"
-
-#~ msgid "End of options"
-#~ msgstr "Kraj opcija"
-
-#~ msgid ""
-#~ "\n"
-#~ "%1 options:\n"
-#~ msgstr ""
-#~ "\n"
-#~ "%1 opcije:\n"
-
-#~ msgid ""
-#~ "\n"
-#~ "Options:\n"
-#~ msgstr ""
-#~ "\n"
-#~ "Opcije:\n"
-
-#~ msgid ""
-#~ "\n"
-#~ "Arguments:\n"
-#~ msgstr ""
-#~ "\n"
-#~ "Argumenti:\n"
-
-#~ msgid "The files/URLs opened by the application will be deleted after use"
-#~ msgstr ""
-#~ "Datoteke/URL-ovi otvoreni od strane aplikacije biti će izbrisani nakon "
-#~ "upotrebe"
-
-#~ msgid "KDE-tempfile"
-#~ msgstr "KDE-tempfile"
-
-#~ msgid "Function must be called from the main thread."
-#~ msgstr "Funkcija mora biti pozvana iz glavnog slijeda."
-
-#~ msgid ""
-#~ "Error launching %1. Either KLauncher is not running anymore, or it failed "
-#~ "to start the application."
-#~ msgstr ""
-#~ "Pogreška pri pokretanju %1. Ili KLauncher više nije pokrenut ili ne može "
-#~ "pokrenuti aplikaciju."
-
-#~ msgid ""
-#~ "KLauncher could not be reached via D-Bus. Error when calling %1:\n"
-#~ "%2\n"
-#~ msgstr ""
-#~ "KLauncheru nije moguće pristupiti putem D-Busa. Pogreška pri pozivu %1:\n"
-#~ "%2\n"
-
-#~ msgid ""
-#~ "Could not launch the KDE Help Center:\n"
-#~ "\n"
-#~ "%1"
-#~ msgstr ""
-#~ "Nije moguće pokrenuti KDE-ov centar pomoći:\n"
-#~ "\n"
-#~ "%1"
-
-#~ msgid "Could not Launch Help Center"
-#~ msgstr "Nije moguće pokrenuti centar pomoći"
-
-#~ msgid ""
-#~ "Could not launch the mail client:\n"
-#~ "\n"
-#~ "%1"
-#~ msgstr ""
-#~ "Nije moguće pokrenuti klijent za poštu:\n"
-#~ "\n"
-#~ "%1"
-
-#~ msgid "Could not launch Mail Client"
-#~ msgstr "Nije moguće pokrenuti klijent za poštu"
-
-#~ msgid ""
-#~ "Could not launch the browser:\n"
-#~ "\n"
-#~ "%1"
-#~ msgstr ""
-#~ "Nije moguće pokrenuti pretraživač:\n"
-#~ "\n"
-#~ "%1"
-
-#~ msgid "Could not launch Browser"
-#~ msgstr "Nije moguće pokrenuti pretraživač"
-
-#~ msgid ""
-#~ "Could not launch the terminal client:\n"
-#~ "\n"
-#~ "%1"
-#~ msgstr ""
-#~ "Nije moguće pokrenuti terminalski klijent:\n"
-#~ "\n"
-#~ "%1"
-
-#~ msgid "Could not launch Terminal Client"
-#~ msgstr "Ne mogu učitati terminalski klijent"
-
-#~ msgctxt "@item Text character set"
-#~ msgid "Western European"
-#~ msgstr "Zapadno europski"
-
-#~ msgctxt "@item Text character set"
-#~ msgid "Central European"
-#~ msgstr "Srednjeeuropski"
-
-#~ msgctxt "@item Text character set"
-#~ msgid "Baltic"
-#~ msgstr "Baltički"
-
-#~ msgctxt "@item Text character set"
-#~ msgid "South-Eastern Europe"
-#~ msgstr "Jugoistočna Europa"
-
-#~ msgctxt "@item Text character set"
-#~ msgid "Turkish"
-#~ msgstr "Turski"
-
-#~ msgctxt "@item Text character set"
-#~ msgid "Cyrillic"
-#~ msgstr "Ćirilica"
-
-#~ msgctxt "@item Text character set"
-#~ msgid "Chinese Traditional"
-#~ msgstr "Kineski tradicionalan"
-
-#~ msgctxt "@item Text character set"
-#~ msgid "Chinese Simplified"
-#~ msgstr "Kineski pojednostavljen"
-
-#~ msgctxt "@item Text character set"
-#~ msgid "Korean"
-#~ msgstr "Korejski"
-
-#~ msgctxt "@item Text character set"
-#~ msgid "Japanese"
-#~ msgstr "Japanski"
-
-#~ msgctxt "@item Text character set"
-#~ msgid "Greek"
-#~ msgstr "Grčki"
-
-#~ msgctxt "@item Text character set"
-#~ msgid "Arabic"
-#~ msgstr "Arapski"
-
-#~ msgctxt "@item Text character set"
-#~ msgid "Hebrew"
-#~ msgstr "Hebrejski"
-
-#~ msgctxt "@item Text character set"
-#~ msgid "Thai"
-#~ msgstr "Thai"
-
-#~ msgctxt "@item Text character set"
-#~ msgid "Unicode"
-#~ msgstr "Unicode"
-
-#~ msgctxt "@item Text character set"
-#~ msgid "Northern Saami"
-#~ msgstr "Sjeverni Saami"
-
-#~ msgctxt "@item Text character set"
-#~ msgid "Other"
-#~ msgstr "Ostalo"
-
-#~ msgctxt "@item %1 character set, %2 encoding"
-#~ msgid "%1 ( %2 )"
-#~ msgstr "%1 ( %2 )"
-
-#~ msgctxt "@item"
-#~ msgid "Other encoding (%1)"
-#~ msgstr "Drugo kodiranje (%1)"
-
-#~ msgctxt "@item Text encoding: %1 character set, %2 encoding"
-#~ msgid "%1 ( %2 )"
-#~ msgstr "%1 ( %2 )"
-
-#~ msgctxt "@item Text character set"
-#~ msgid "Disabled"
-#~ msgstr "Onemogućeno"
-
-#~ msgctxt "@item Text character set"
-#~ msgid "Universal"
-#~ msgstr "Univerzalno"
-
-#~ msgctxt ""
-#~ "@note-with-label/plain\n"
-#~ "%1 is the note label, %2 is the text"
-#~ msgid "%1: %2"
-#~ msgstr "%1: %2"
-
-#~ msgctxt ""
-#~ "@warning-with-label/plain\n"
-#~ "%1 is the warning label, %2 is the text"
-#~ msgid "%1: %2"
-#~ msgstr "%1: %2"
-
-#~ msgctxt ""
-#~ "@link-with-description/plain\n"
-#~ "%1 is the URL, %2 is the descriptive text"
-#~ msgid "%2 (%1)"
-#~ msgstr "%2 (%1)"
-
-#~ msgctxt "@application/rich"
-#~ msgid "%1"
-#~ msgstr "%1"
-
-#~ msgctxt "@command/plain"
-#~ msgid "%1"
-#~ msgstr "%1"
-
-#~ msgctxt "@command/rich"
-#~ msgid "%1 "
-#~ msgstr "%1 "
-
-#~ msgctxt "@resource/rich"
-#~ msgid "“%1”"
-#~ msgstr "“%1”"
-
-#~ msgctxt "@icode/plain"
-#~ msgid "“%1”"
-#~ msgstr "“%1”"
-
-#~ msgctxt "@icode/rich"
-#~ msgid "%1 "
-#~ msgstr "%1 "
-
-#~ msgctxt "@shortcut/plain"
-#~ msgid "%1"
-#~ msgstr "%1"
-
-#~ msgctxt "@emphasis/rich"
-#~ msgid "%1 "
-#~ msgstr "%1 "
-
-#~ msgctxt "@emphasis-strong/rich"
-#~ msgid "%1 "
-#~ msgstr "%1 "
-
-#~ msgctxt "@email/plain"
-#~ msgid "<%1>"
-#~ msgstr "<%1>"
-
-#~ msgctxt "@message/rich"
-#~ msgid "%1 "
-#~ msgstr "%1 "
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Alt"
-#~ msgstr "Alt"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "AltGr"
-#~ msgstr "Alt"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Backspace"
-#~ msgstr "Backspace"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "CapsLock"
-#~ msgstr "CapsLock"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Control"
-#~ msgstr "Ctrl"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Ctrl"
-#~ msgstr "Ctrl"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Del"
-#~ msgstr "Del"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Delete"
-#~ msgstr "Izbriši"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Down"
-#~ msgstr "Dolje"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "End"
-#~ msgstr "Završetak"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Enter"
-#~ msgstr "Enter"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Esc"
-#~ msgstr "Esc"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Escape"
-#~ msgstr "Escape"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Home"
-#~ msgstr "Kućni telefon"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Hyper"
-#~ msgstr "Hiper"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Ins"
-#~ msgstr "Ins"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Insert"
-#~ msgstr "Umetni"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Left"
-#~ msgstr "Lijevo"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Menu"
-#~ msgstr "Izbornik"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Meta"
-#~ msgstr "Meta"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "NumLock"
-#~ msgstr "NumLock"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "PageDown"
-#~ msgstr "PageDown"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "PageUp"
-#~ msgstr "PageUp"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "PgDown"
-#~ msgstr "PageDown"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "PgUp"
-#~ msgstr "PageUp"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "PauseBreak"
-#~ msgstr "Pause"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "PrintScreen"
-#~ msgstr "Ispis"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "PrtScr"
-#~ msgstr "Ispis"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Return"
-#~ msgstr "Return"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Right"
-#~ msgstr "Desno"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "ScrollLock"
-#~ msgstr "ScrollLock"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Shift"
-#~ msgstr "Shift"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Space"
-#~ msgstr "Razmaknica"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Super"
-#~ msgstr "Super"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "SysReq"
-#~ msgstr "SysReq"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Tab"
-#~ msgstr "Tab"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Up"
-#~ msgstr "Gore"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "Win"
-#~ msgstr "Win"
-
-#~ msgctxt "keyboard-key-name"
-#~ msgid "F%1"
-#~ msgstr "F%1"
-
-#~ msgctxt "digit set"
-#~ msgid "Arabic-Indic"
-#~ msgstr "Arapski-Indijski"
-
-#~ msgctxt "digit set"
-#~ msgid "Bengali"
-#~ msgstr "Bengalski"
-
-#~ msgctxt "digit set"
-#~ msgid "Devanagari"
-#~ msgstr "Devanagari"
-
-#~ msgctxt "digit set"
-#~ msgid "Eastern Arabic-Indic"
-#~ msgstr "Istočno Arapsko-Indijski"
-
-#~ msgctxt "digit set"
-#~ msgid "Gujarati"
-#~ msgstr "Gudžaratski"
-
-#~ msgctxt "digit set"
-#~ msgid "Gurmukhi"
-#~ msgstr "Gurmuki"
-
-#~ msgctxt "digit set"
-#~ msgid "Kannada"
-#~ msgstr "Kannadski"
-
-#~ msgctxt "digit set"
-#~ msgid "Khmer"
-#~ msgstr "Kmerski"
-
-#~ msgctxt "digit set"
-#~ msgid "Malayalam"
-#~ msgstr "Malajalamski"
-
-#~ msgctxt "digit set"
-#~ msgid "Oriya"
-#~ msgstr "Oriyanski"
-
-#~ msgctxt "digit set"
-#~ msgid "Tamil"
-#~ msgstr "Tamilski"
-
-#~ msgctxt "digit set"
-#~ msgid "Telugu"
-#~ msgstr "Telugu"
-
-#~ msgctxt "digit set"
-#~ msgid "Thai"
-#~ msgstr "Tajlandski"
-
-#~ msgctxt "digit set"
-#~ msgid "Arabic"
-#~ msgstr "Arapski"
-
-#~ msgctxt "size in bytes"
-#~ msgid "%1 B"
-#~ msgstr "%1 B"
-
-#~ msgctxt "size in 1000 bytes"
-#~ msgid "%1 kB"
-#~ msgstr "%1 kB"
-
-#~ msgctxt "size in 10^6 bytes"
-#~ msgid "%1 MB"
-#~ msgstr "%1 MB"
-
-#~ msgctxt "size in 10^9 bytes"
-#~ msgid "%1 GB"
-#~ msgstr "%1 GB"
-
-#~ msgctxt "size in 10^12 bytes"
-#~ msgid "%1 TB"
-#~ msgstr "%1 TB"
-
-#~ msgctxt "size in 10^15 bytes"
-#~ msgid "%1 PB"
-#~ msgstr "%1 PB"
-
-#~ msgctxt "size in 10^18 bytes"
-#~ msgid "%1 EB"
-#~ msgstr "%1 EB"
-
-#~ msgctxt "size in 10^21 bytes"
-#~ msgid "%1 ZB"
-#~ msgstr "%1 ZB"
-
-#~ msgctxt "size in 10^24 bytes"
-#~ msgid "%1 YB"
-#~ msgstr "%1 YB"
-
-#~ msgctxt "memory size in 1024 bytes"
-#~ msgid "%1 KB"
-#~ msgstr "%1 KB"
-
-#~ msgctxt "memory size in 2^20 bytes"
-#~ msgid "%1 MB"
-#~ msgstr "%1 MB"
-
-#~ msgctxt "memory size in 2^30 bytes"
-#~ msgid "%1 GB"
-#~ msgstr "%1 GB"
-
-#~ msgctxt "memory size in 2^40 bytes"
-#~ msgid "%1 TB"
-#~ msgstr "%1 TB"
-
-#~ msgctxt "memory size in 2^50 bytes"
-#~ msgid "%1 PB"
-#~ msgstr "%1 PB"
-
-#~ msgctxt "memory size in 2^60 bytes"
-#~ msgid "%1 EB"
-#~ msgstr "%1 EB"
-
-#~ msgctxt "memory size in 2^70 bytes"
-#~ msgid "%1 ZB"
-#~ msgstr "%1 ZB"
-
-#~ msgctxt "memory size in 2^80 bytes"
-#~ msgid "%1 YB"
-#~ msgstr "%1 YB"
-
-#~ msgctxt "size in 1024 bytes"
-#~ msgid "%1 KiB"
-#~ msgstr "%1 KiB"
-
-#~ msgctxt "size in 2^20 bytes"
-#~ msgid "%1 MiB"
-#~ msgstr "%1 MiB"
-
-#~ msgctxt "size in 2^30 bytes"
-#~ msgid "%1 GiB"
-#~ msgstr "%1 GiB"
-
-#~ msgctxt "size in 2^40 bytes"
-#~ msgid "%1 TiB"
-#~ msgstr "%1 TiB"
-
-#~ msgctxt "size in 2^50 bytes"
-#~ msgid "%1 PiB"
-#~ msgstr "%1 PiB"
-
-#~ msgctxt "size in 2^60 bytes"
-#~ msgid "%1 EiB"
-#~ msgstr "%1 EiB"
-
-#~ msgctxt "size in 2^70 bytes"
-#~ msgid "%1 ZiB"
-#~ msgstr "%1 ZiB"
-
-#~ msgctxt "size in 2^80 bytes"
-#~ msgid "%1 YiB"
-#~ msgstr "%1 YiB"
-
-#~ msgctxt "@item:intext %1 is a real number, e.g. 1.23 days"
-#~ msgid "%1 days"
-#~ msgstr "%1 dana"
-
-#~ msgctxt "@item:intext %1 is a real number, e.g. 1.23 hours"
-#~ msgid "%1 hours"
-#~ msgstr "%1 sata"
-
-#~ msgctxt "@item:intext %1 is a real number, e.g. 1.23 minutes"
-#~ msgid "%1 minutes"
-#~ msgstr "%1 minuta"
-
-#~ msgctxt "@item:intext %1 is a real number, e.g. 1.23 seconds"
-#~ msgid "%1 seconds"
-#~ msgstr "%1 sekunda"
-
-#~ msgctxt "@item:intext"
-#~ msgid "%1 millisecond"
-#~ msgid_plural "%1 milliseconds"
-#~ msgstr[0] "%1 millisekunda"
-#~ msgstr[1] "%1 millisekunde"
-#~ msgstr[2] "%1 millisekundi"
-
-#~ msgctxt "@item:intext"
-#~ msgid "1 day"
-#~ msgid_plural "%1 days"
-#~ msgstr[0] "%1 dan"
-#~ msgstr[1] "%1 dana"
-#~ msgstr[2] "%1 dana"
-
-#~ msgctxt "@item:intext"
-#~ msgid "1 hour"
-#~ msgid_plural "%1 hours"
-#~ msgstr[0] "%1 sat"
-#~ msgstr[1] "%1 sata"
-#~ msgstr[2] "%1 sati"
-
-#~ msgctxt "@item:intext"
-#~ msgid "1 minute"
-#~ msgid_plural "%1 minutes"
-#~ msgstr[0] "%1 minuta"
-#~ msgstr[1] "%1 minute"
-#~ msgstr[2] "%1 minuta"
-
-#~ msgctxt "@item:intext"
-#~ msgid "1 second"
-#~ msgid_plural "%1 seconds"
-#~ msgstr[0] "%1 sekunda"
-#~ msgstr[1] "%1 sekunde"
-#~ msgstr[2] "%1 sekundi"
-
-#~ msgctxt ""
-#~ "@item:intext days and hours. This uses the previous item:intext messages. "
-#~ "If this does not fit the grammar of your language please contact the i18n "
-#~ "team to solve the problem"
-#~ msgid "%1 and %2"
-#~ msgstr "%1 i %2"
-
-#~ msgctxt ""
-#~ "@item:intext hours and minutes. This uses the previous item:intext "
-#~ "messages. If this does not fit the grammar of your language please "
-#~ "contact the i18n team to solve the problem"
-#~ msgid "%1 and %2"
-#~ msgstr "%1 i %2"
-
-#~ msgctxt ""
-#~ "@item:intext minutes and seconds. This uses the previous item:intext "
-#~ "messages. If this does not fit the grammar of your language please "
-#~ "contact the i18n team to solve the problem"
-#~ msgid "%1 and %2"
-#~ msgstr "%1 i %2"
-
-#~ msgctxt "Before Noon KLocale::LongName"
-#~ msgid "Ante Meridiem"
-#~ msgstr "Prijepodne"
-
-#~ msgctxt "Before Noon KLocale::ShortName"
-#~ msgid "AM"
-#~ msgstr "AM"
-
-#~ msgctxt "Before Noon KLocale::NarrowName"
-#~ msgid "A"
-#~ msgstr "A"
-
-#~ msgctxt "After Noon KLocale::LongName"
-#~ msgid "Post Meridiem"
-#~ msgstr "Poslijepodne"
-
-#~ msgctxt "After Noon KLocale::ShortName"
-#~ msgid "PM"
-#~ msgstr "PM"
-
-#~ msgctxt "After Noon KLocale::NarrowName"
-#~ msgid "P"
-#~ msgstr "P"
-
-#~ msgid "Yesterday"
-#~ msgstr "Jučer"
-
-#~ msgctxt "concatenation of dates and time"
-#~ msgid "%1 %2"
-#~ msgstr "%1 %2"
-
-#~ msgctxt "concatenation of date/time and time zone"
-#~ msgid "%1 %2"
-#~ msgstr "%1 %2"
-
-#~ msgid "no error"
-#~ msgstr "nema pogreške"
-
-#~ msgid "requested family not supported for this host name"
-#~ msgstr "zahtijevana porodica nije podržana za ovo računalo"
-
-#~ msgid "temporary failure in name resolution"
-#~ msgstr "privremeni neuspjeh pri razrješavanju naziva"
-
-#~ msgid "non-recoverable failure in name resolution"
-#~ msgstr "nepopravljiva pogreška pri određivanju naziva"
-
-#~ msgid "invalid flags"
-#~ msgstr "neispravne zastavice"
-
-#~ msgid "memory allocation failure"
-#~ msgstr "pogreška pri dodjeljivanju memorije"
-
-#~ msgid "name or service not known"
-#~ msgstr "naziv ili usluga nisu poznati"
-
-#~ msgid "requested family not supported"
-#~ msgstr "zahtijevana porodica protokola nije podržana"
-
-#~ msgid "requested service not supported for this socket type"
-#~ msgstr "zahtijevana usluga nije podržana za ovu vrstu priključka"
-
-#~ msgid "requested socket type not supported"
-#~ msgstr "zahtijevana vrsta priključka nije podržana"
-
-#~ msgid "unknown error"
-#~ msgstr "nepoznata pogreška"
-
-#~ msgctxt "1: the i18n'ed system error code, from errno"
-#~ msgid "system error: %1"
-#~ msgstr "sistemska pogreška: %1"
-
-#~ msgid "request was canceled"
-#~ msgstr "zahtijev je otkazan"
-
-#~ msgctxt "1: the unknown socket address family number"
-#~ msgid "Unknown family %1"
-#~ msgstr "Nepoznata obitelj %1"
-
-#~ msgctxt "Socket error code NoError"
-#~ msgid "no error"
-#~ msgstr "bez greške"
-
-#~ msgctxt "Socket error code LookupFailure"
-#~ msgid "name lookup has failed"
-#~ msgstr "Potraga po nazivu nije uspjela"
-
-#~ msgctxt "Socket error code AddressInUse"
-#~ msgid "address already in use"
-#~ msgstr "adresa se već koristi"
-
-#~ msgctxt "Socket error code AlreadyBound"
-#~ msgid "socket is already bound"
-#~ msgstr "spojna točka je već vezana"
-
-#~ msgctxt "Socket error code AlreadyCreated"
-#~ msgid "socket is already created"
-#~ msgstr "spojna točka je već stvorena"
-
-#~ msgctxt "Socket error code NotBound"
-#~ msgid "socket is not bound"
-#~ msgstr "spojna točka nije vezana"
-
-#~ msgctxt "Socket error code NotCreated"
-#~ msgid "socket has not been created"
-#~ msgstr "spojna točka nije stvorena"
-
-#~ msgctxt "Socket error code WouldBlock"
-#~ msgid "operation would block"
-#~ msgstr "operacija će blokirati"
-
-#~ msgctxt "Socket error code ConnectionRefused"
-#~ msgid "connection actively refused"
-#~ msgstr "Spajanje odbijeno"
-
-#~ msgctxt "Socket error code ConnectionTimedOut"
-#~ msgid "connection timed out"
-#~ msgstr "isteklo vrijeme spajanja"
-
-#~ msgctxt "Socket error code InProgress"
-#~ msgid "operation is already in progress"
-#~ msgstr "operacija je već u tijeku"
-
-#~ msgctxt "Socket error code NetFailure"
-#~ msgid "network failure occurred"
-#~ msgstr "problem s mrežom"
-
-#~ msgctxt "Socket error code NotSupported"
-#~ msgid "operation is not supported"
-#~ msgstr "operacija nije podržana"
-
-#~ msgctxt "Socket error code Timeout"
-#~ msgid "timed operation timed out"
-#~ msgstr "isteklo vrijeme za vremensku operaciju"
-
-#~ msgctxt "Socket error code UnknownError"
-#~ msgid "an unknown/unexpected error has happened"
-#~ msgstr "dogodila se nepoznata/neočekivana pogreška"
-
-#~ msgctxt "Socket error code RemotelyDisconnected"
-#~ msgid "remote host closed connection"
-#~ msgstr "udaljeno računalo prekinulo je vezu"
-
-#~ msgid "Specified socket path is invalid"
-#~ msgstr "Navedena putanja utičnice je neispravna"
-
-#~ msgid "The socket operation is not supported"
-#~ msgstr "Operacija priključka nije podržana"
-
-#~ msgid "Connection refused"
-#~ msgstr "Veza odbijena"
-
-#~ msgid "Permission denied"
-#~ msgstr "Zahtjev je odbijen."
-
-#~ msgid "Connection timed out"
-#~ msgstr "Isteklo vrijeme spajanja"
-
-#~ msgid "Unknown error"
-#~ msgstr "Nepoznata pogreška"
-
-#~ msgid "Could not set non-blocking mode"
-#~ msgstr "Nije moguće postaviti ne blokirajući način"
-
-#~ msgid "Address is already in use"
-#~ msgstr "Adresa se već koristi"
-
-#~ msgid "Path cannot be used"
-#~ msgstr "Putanja se ne može koristiti"
-
-#~ msgid "No such file or directory"
-#~ msgstr "Datoteka ili direktorij ne postoje."
-
-#~ msgid "Not a directory"
-#~ msgstr "Nije direktorij"
-
-#~ msgid "Read-only filesystem"
-#~ msgstr "Datotečni sustav kojeg je jedino moguće čitati"
-
-#~ msgid "Unknown socket error"
-#~ msgstr "Nepoznata pogreška utičnice"
-
-#~ msgid "Operation not supported"
-#~ msgstr "Operacija nije podržana"
-
-#~ msgid "Timed out trying to connect to remote host"
-#~ msgstr "Isteklo vrijeme za pokušaj povezivanja na udaljeno računalo"
-
-#~ msgid "address family for nodename not supported"
-#~ msgstr "upotreba adresne skupine za naziv čvora nije podržana"
-
-#~ msgid "invalid value for 'ai_flags'"
-#~ msgstr "neispravna vrijednost za 'ai_flags'"
-
-#~ msgid "'ai_family' not supported"
-#~ msgstr "'ai_family' nije podržano"
-
-#~ msgid "no address associated with nodename"
-#~ msgstr "nema adrese povezane s nazivom čvora"
-
-#~ msgid "servname not supported for ai_socktype"
-#~ msgstr "baziv poslužitelja nije podržan za ai_socktype"
-
-#~ msgid "'ai_socktype' not supported"
-#~ msgstr "'ai_socktype' nije podržano"
-
-#~ msgid "system error"
-#~ msgstr "sistemska pogreška"
-
-#~ msgid "NEC SOCKS client"
-#~ msgstr "NEC SOCKS klijent"
-
-#~ msgid "Dante SOCKS client"
-#~ msgstr "Dante SOCKS klijent"
-
-#~ msgctxt "SSL error"
-#~ msgid "No error"
-#~ msgstr "Nema pogreške"
-
-#~ msgctxt "SSL error"
-#~ msgid "The certificate authority's certificate is invalid"
-#~ msgstr "Certifikat certifikacijskog autoriteta je nevažeći"
-
-#~ msgctxt "SSL error"
-#~ msgid "The certificate has expired"
-#~ msgstr "Certifikat je istekao"
-
-#~ msgctxt "SSL error"
-#~ msgid "The certificate is invalid"
-#~ msgstr "Certifikat nije valjajući"
-
-#~ msgctxt "SSL error"
-#~ msgid "The certificate is not signed by any trusted certificate authority"
-#~ msgstr ""
-#~ "Certifkat nije potpisan od strane pouzdanog certifikacijskog autoriteta"
-
-#~ msgctxt "SSL error"
-#~ msgid "The certificate has been revoked"
-#~ msgstr "Certifikat je opozvan"
-
-#~ msgctxt "SSL error"
-#~ msgid "The certificate is unsuitable for this purpose"
-#~ msgstr "Certifikat nije prikladan za ovu svrhu"
-
-#~ msgctxt "SSL error"
-#~ msgid ""
-#~ "The root certificate authority's certificate is not trusted for this "
-#~ "purpose"
-#~ msgstr ""
-#~ "Certifikatu izvorišnog certifikacijskog autoriteta se ne vjeruje za ovu "
-#~ "namjenu"
-
-#~ msgctxt "SSL error"
-#~ msgid ""
-#~ "The certificate authority's certificate is marked to reject this "
-#~ "certificate's purpose"
-#~ msgstr ""
-#~ "Certifikat certifikacijskog autoriteta je označen za odbijanje namjene "
-#~ "ovog certifikata"
-
-#~ msgctxt "SSL error"
-#~ msgid "The peer did not present any certificate"
-#~ msgstr "Ravnopravni član nije podnio nikakav certifikat."
-
-#~ msgctxt "SSL error"
-#~ msgid "The certificate does not apply to the given host"
-#~ msgstr "Certifikat se ne odnosi na dano računalo"
-
-#~ msgctxt "SSL error"
-#~ msgid "The certificate cannot be verified for internal reasons"
-#~ msgstr "Nije moguće provjeriti certifikat zbog internih razloga"
-
-#~ msgctxt "SSL error"
-#~ msgid "The certificate chain is too long"
-#~ msgstr "Certifikacijski lanac je predugačak"
-
-#~ msgctxt "SSL error"
-#~ msgid "Unknown error"
-#~ msgstr "Nepoznata pogreška"
-
-#~ msgid "Could not find mime type %2 "
-#~ msgid_plural ""
-#~ "Could not find mime types:\n"
-#~ "%2 "
-#~ msgstr[0] "Nije moguće pronaći mime tip %2 "
-#~ msgstr[1] ""
-#~ "Nije moguće pronaći mime tipove:\n"
-#~ "%2 "
-#~ msgstr[2] ""
-#~ "Nije moguće pronaći mime tipove:\n"
-#~ "%2 "
-
-#~ msgid ""
-#~ "No mime types installed. Check that shared-mime-info is installed, and "
-#~ "that XDG_DATA_DIRS is not set, or includes /usr/share."
-#~ msgstr ""
-#~ "Nema instaliranih mime tipova. Provjerite jesu li shared-mime-info "
-#~ "instalirani, te da nije postavljen XDG_DATA_DIRS ili uključuje /usr/share."
-
-#~ msgctxt "dictionary variant"
-#~ msgid "40"
-#~ msgstr "40"
-
-#~ msgctxt "dictionary variant"
-#~ msgid "60"
-#~ msgstr "60"
-
-#~ msgctxt "dictionary variant"
-#~ msgid "80"
-#~ msgstr "80"
-
-#~ msgctxt "dictionary variant"
-#~ msgid "-ise suffixes"
-#~ msgstr "-ise sufiksi"
-
-#~ msgctxt "dictionary variant"
-#~ msgid "-ize suffixes"
-#~ msgstr "-ize sufiksi"
-
-#~ msgctxt "dictionary variant"
-#~ msgid "-ise suffixes and with accents"
-#~ msgstr "-ise sufiksi sa akcentima"
-
-#~ msgctxt "dictionary variant"
-#~ msgid "-ise suffixes and without accents"
-#~ msgstr "-ise sufiksi bez akcentata"
-
-#~ msgctxt "dictionary variant"
-#~ msgid "-ize suffixes and with accents"
-#~ msgstr "-ize sufiksi sa akcentima"
-
-#~ msgctxt "dictionary variant"
-#~ msgid "-ize suffixes and without accents"
-#~ msgstr "-ize sufiksi bez akcenata"
-
-#~ msgctxt "dictionary variant"
-#~ msgid "large"
-#~ msgstr "veliko"
-
-#~ msgctxt "dictionary variant"
-#~ msgid "medium"
-#~ msgstr "srednji"
-
-#~ msgctxt "dictionary variant"
-#~ msgid "small"
-#~ msgstr "malo"
-
-#~ msgctxt "dictionary variant"
-#~ msgid "variant 0"
-#~ msgstr "varijanta 0"
-
-#~ msgctxt "dictionary variant"
-#~ msgid "variant 1"
-#~ msgstr "varijanta 1"
-
-#~ msgctxt "dictionary variant"
-#~ msgid "variant 2"
-#~ msgstr "varijanta 2"
-
-#~ msgctxt "dictionary variant"
-#~ msgid "without accents"
-#~ msgstr "bez akcenata"
-
-#~ msgctxt "dictionary variant"
-#~ msgid "with accents"
-#~ msgstr "sa akcentima"
-
-#~ msgctxt "dictionary variant"
-#~ msgid "with ye"
-#~ msgstr "sa ye"
-
-#~ msgctxt "dictionary variant"
-#~ msgid "with yeyo"
-#~ msgstr "sa yeyo"
-
-#~ msgctxt "dictionary variant"
-#~ msgid "with yo"
-#~ msgstr "sa yo"
-
-#~ msgctxt "dictionary variant"
-#~ msgid "extended"
-#~ msgstr "prošireni"
-
-#~ msgctxt "dictionary name. %1-language, %2-country and %3 variant name"
-#~ msgid "%1 (%2) [%3]"
-#~ msgstr "%1 (%2) [%3]"
-
-#~ msgctxt "dictionary name. %1-language and %2-country name"
-#~ msgid "%1 (%2)"
-#~ msgstr "%1 (%2)"
-
-#~ msgctxt "dictionary name. %1-language and %2-variant name"
-#~ msgid "%1 [%2]"
-#~ msgstr "%1 [%2]"
-
-#~ msgid "File %1 does not exist"
-#~ msgstr "Datoteka %1 nije pronađena"
-
-#~ msgid "Cannot open %1 for reading"
-#~ msgstr "Nije moguće otvoriti %1 za čitanje"
-
-#~ msgid "Cannot create memory segment for file %1"
-#~ msgstr "Nije moguće stvoriti memorijski odjeljak za datoteku %1"
-
-#~ msgid "Could not read data from %1 into shm"
-#~ msgstr "Nije moguće pročitati podatke iz %1 u shm"
-
-#~ msgid "Only 'ReadOnly' allowed"
-#~ msgstr "Dozvoljen je samo 'ReadOnly'"
-
-#~ msgid "Cannot seek past eof"
-#~ msgstr "Nije moguće pronaći prošli kraj daoteke (EOF)"
-
-#~ msgid "Library \"%1\" not found"
-#~ msgstr "Biblioteka \"%1\" nije pronađena"
-
-#~ msgid "No service matching the requirements was found."
-#~ msgstr "Nije nađena usluga koja odgovara zahtjevima."
-
-#~ msgid ""
-#~ "The service provides no library, the Library key is missing in the ."
-#~ "desktop file."
-#~ msgstr ""
-#~ "Servis ne nudi biblioteku, 'Library key' nedostaje u .desktop datoteci."
-
-#~ msgid "The library does not export a factory for creating components."
-#~ msgstr "Biblioteka ne izvozi radionicu za stvaranje komponenti."
-
-#~ msgid ""
-#~ "The factory does not support creating components of the specified type."
-#~ msgstr "Radionica ne podržava stvaranje komponenti navedenog tipa."
-
-#~ msgid "KLibLoader: Unknown error"
-#~ msgstr "KLibLoader: Nepoznata pogreška"
-
-#~ msgid "Could not find plugin '%1' for application '%2'"
-#~ msgstr "Nije moguće pronaći priključak '%1' za aplikaciju '%2'"
-
-#~ msgid "The provided service is not valid"
-#~ msgstr "Izdani certifikat nije valjajući"
-
-#~ msgid ""
-#~ "The service '%1' provides no library or the Library key is missing in "
-#~ msgstr "Servis '%1' ne nudi biblioteku ili nedostaje 'Library key'"
-
-#~ msgid "The library %1 does not offer a KDE 4 compatible factory."
-#~ msgstr "Biblioteka %1 ne nudi KDE 4 kompatibilnu radionicu."
-
-#~ msgid "The plugin '%1' uses an incompatible KDE library (%2)."
-#~ msgstr "Priključak '%1' ne koristi kompatibilnu KDE biblioteku (%2)."
-
-#~ msgid "KBuildSycoca"
-#~ msgstr "KBuildSycoca"
-
-#~ msgid "Rebuilds the system configuration cache."
-#~ msgstr "Ponovno građenje privremene pohrane konfiguracije sustava."
-
-#~ msgid "(c) 1999-2002 KDE Developers"
-#~ msgstr "© 1999–2002 Razvijatelji KDE-a"
-
-#~ msgid "David Faure"
-#~ msgstr "David Faure"
-
-#~ msgid "Do not signal applications to update"
-#~ msgstr "Nemoj javiti aplikacijama da se obnove."
-
-#~ msgid "Disable incremental update, re-read everything"
-#~ msgstr "Onemogući inkrementalno osvježavanje, sve pročitaj ponovno."
-
-#~ msgid "Check file timestamps"
-#~ msgstr "Provjeri oznake vremena datoteke."
-
-#~ msgid "Disable checking files (dangerous)"
-#~ msgstr "Onemogući provjeru datoteka (nesigurno)"
-
-#~ msgid "Create global database"
-#~ msgstr "Izradi opću bazu podataka"
-
-#~ msgid "Perform menu generation test run only"
-#~ msgstr "Izvedi generiranje menija samo za probu."
-
-#~ msgid "Track menu id for debug purposes"
-#~ msgstr "Prati oznaku izbornika radi ispravljanja pogreški"
-
-#~ msgid "KDE Daemon"
-#~ msgstr "KDE Demon"
-
-#~ msgid "KDE Daemon - triggers Sycoca database updates when needed"
-#~ msgstr ""
-#~ "KDE Daemon – pokreće nadopunjavanje Sycoca baze podataka kada je to "
-#~ "potrebno."
-
-#~ msgid "Check Sycoca database only once"
-#~ msgstr "Bazu podataka Sycoca ispitaj samo jedanput"
-
-#~ msgctxt "Encodings menu"
-#~ msgid "Default"
-#~ msgstr "Uuobičajeno"
-
-#~ msgctxt "Encodings menu"
-#~ msgid "Autodetect"
-#~ msgstr "Samodetekcija"
-
-#~ msgid "No Entries"
-#~ msgstr "Nema unosa"
-
-#~ msgid "Clear List"
-#~ msgstr "Isprazni listu"
-
-#~ msgid "F&ull Screen Mode"
-#~ msgstr "Preko punog &zaslona"
-
-#~ msgid "Full Screen"
-#~ msgstr "Preko punog zaslona"
-
-#~ msgid "Exit F&ull Screen Mode"
-#~ msgstr "Izlaz iz p&unog zaslona"
-
-#~ msgid "Exit Full Screen"
-#~ msgstr "Izlaz iz punog zaslona"
-
-#~ msgid ""
-#~ "The key sequence '%1' is ambiguous. Use 'Configure Shortcuts'\n"
-#~ "from the 'Settings' menu to solve the ambiguity.\n"
-#~ "No action will be triggered."
-#~ msgstr ""
-#~ "Kombinacija tipaka '%1' je dvosmislena. Molim iskoristite 'Podešavanje "
-#~ "prečaca'\n"
-#~ " iz izbornika 'Postavke' kako biste riješili dvosmislenost.\n"
-#~ "Nijedna radnja neće biti izvršena."
-
-#~ msgid "Ambiguous shortcut detected"
-#~ msgstr "Opažen je dvoznačan prečac"
-
-#~ msgctxt "go back"
-#~ msgid "&Back"
-#~ msgstr "&Natrag"
-
-#~ msgctxt "go forward"
-#~ msgid "&Forward"
-#~ msgstr "Na&prijed"
-
-#~ msgctxt "home page"
-#~ msgid "&Home"
-#~ msgstr "&Početak"
-
-#~ msgctxt "show help"
-#~ msgid "&Help"
-#~ msgstr "&Pomoć"
-
-#~ msgid "Show &Menubar"
-#~ msgstr "Prikaži traku s &izbornikom"
-
-#~ msgid "Show MenubarShows the menubar again after it has been hidden
"
-#~ msgstr ""
-#~ "Prikaži traku s izbornikomPrikazuje traku s izbornikom nakon skrivanja."
-#~ "
"
-
-#~ msgid "Show St&atusbar"
-#~ msgstr "Prikaži traku &stanja"
-
-#~ msgid ""
-#~ "Show StatusbarShows the statusbar, which is the bar at the bottom of "
-#~ "the window used for status information.
"
-#~ msgstr ""
-#~ "Prikaži traku stanjaPrikazuje traku stanja. To je traka na dnu prozora "
-#~ "koja se koristi za statusne informacije.
"
-
-#~ msgid ""
-#~ "No information available. The supplied KAboutData object does "
-#~ "not exist. "
-#~ msgstr ""
-#~ "Nema dostupnih podataka. Navedeni objekt KAboutData ne postoji."
-#~ " "
-
-#~ msgid ""
-#~ "%1 Version %2 "
-#~ msgstr ""
-#~ "%1 Inačica %2 "
-
-#~ msgctxt ""
-#~ "Program name, version and KDE platform version; do not translate "
-#~ "'Development Platform'"
-#~ msgid ""
-#~ "%1 Version %2 Using KDE "
-#~ "Development Platform %3"
-#~ msgstr ""
-#~ "%1 Inačica %2 Koristite "
-#~ "KDE Development Platform %3"
-
-#~ msgid "License: %1"
-#~ msgstr "Licenca: %1"
-
-#~ msgid "License Agreement"
-#~ msgstr "Licencni ugovor"
-
-#~ msgid "About KDE"
-#~ msgstr "O KDE-u"
-
-#~ msgid ""
-#~ "KDE - Be Free! Platform Version %1"
-#~ "b>"
-#~ msgstr ""
-#~ "KDE – budi slobodan! Inačica "
-#~ "platforme %1 "
-
-#~ msgid ""
-#~ "KDE is a world-wide network of software engineers, artists, "
-#~ "writers, translators and facilitators who are committed to Free Software development. This community has created hundreds "
-#~ "of Free Software applications as part of the KDE Development Platform and "
-#~ "KDE Software Distribution. KDE is a cooperative enterprise in "
-#~ "which no single entity controls the efforts or products of KDE to the "
-#~ "exclusion of others. Everyone is welcome to join and contribute to KDE, "
-#~ "including you. Visit %2 for more "
-#~ "information about the KDE community and the software we produce."
-#~ msgstr ""
-#~ "KDE je međunarodna mreža softverskih inženjera, umjetnika, "
-#~ "pisaca, prevodioca i podupiratelja odanih razvoju slobodnog softvera . Ova zajednica stvorila je stotine "
-#~ "aplikacija slobodnog softvera koje su dio KDE Development Platforme i KDE "
-#~ "Software Distributiona. KDE je suradnički pothvat u kojem ne "
-#~ "postoji izdvojeni subjekt koji kontrolira smjer razvoja ili proizvode KDE-"
-#~ "a. Svi se slobodno mogu pridružiti i doprinijeti KDE-u, uključujući i Vas."
-#~ " Posjetite %2 za više informacija o "
-#~ "zajednici KDE i softveru kojeg stvaramo."
-
-#~ msgid ""
-#~ "Software can always be improved, and the KDE team is ready to do "
-#~ "so. However, you - the user - must tell us when something does not work "
-#~ "as expected or could be done better. KDE has a bug tracking "
-#~ "system. Visit %1 or use the \"Report Bug...\" dialog "
-#~ "from the \"Help\" menu to report bugs. If you have a "
-#~ "suggestion for improvement then you are welcome to use the bug tracking "
-#~ "system to register your wish. Make sure you use the severity called "
-#~ "\"Wishlist\"."
-#~ msgstr ""
-#~ "Softver se uvijek može unaprijediti i tim KDE spreman je na to. "
-#~ "Međutim, Vi – korisnik – morate nam reći kada nešto ne radi prema "
-#~ "očekivanjima ili kada bi nešto moglo raditi bolje. KDE ima "
-#~ "sustav za praćenje grešaka. Posjetite %1 ili "
-#~ "iskoristite dijalog \"Prijava nedostataka...\" iz izbornika \"Pomoć\" "
-#~ "kako biste prijavili grešku. Ako imate prijedlog za "
-#~ "unapređenje, tada ste slobodni iskoristiti sustav za praćenje grešaka "
-#~ "kako biste prijavili svoju želju. Obratite pozornost na to da odaberete "
-#~ "razinu ozbiljnosti nazvanu \"Wishlist\"."
-
-#~ msgid ""
-#~ "You do not have to be a software developer to be a member of the "
-#~ "KDE team. You can join the national teams that translate program "
-#~ "interfaces. You can provide graphics, themes, sounds, and improved "
-#~ "documentation. You decide! Visit %1 for "
-#~ "information on some projects in which you can participate. If "
-#~ "you need more information or documentation, then a visit to %2 will provide you with what you need."
-#~ msgstr ""
-#~ "Ne trebate biti razvijatelj softvera kako biste bili dio tima KDE. "
-#~ "Možete se pridružiti nacionalnim timovima koji prevode programsko "
-#~ "sučelje. Možete izrađivati grafiku, teme, zvukove i unaprijediti "
-#~ "dokumentaciju. Sami odlučujete! Posjetite %1"
-#~ "a> za više informacija o projektima u kojima možete sudjelovati. Ako trebate više informacija ili dokumentaciju, posjetite %2 i pronaći ćete što trebate."
-
-#~ msgid ""
-#~ "KDE software is and will always be available free of charge, "
-#~ "however creating it is not free. To support development the "
-#~ "KDE community has formed the KDE e.V., a non-profit organization legally "
-#~ "founded in Germany. KDE e.V. represents the KDE community in legal and "
-#~ "financial matters. See %1 for information on KDE e.V."
-#~ " KDE benefits from many kinds of contributions, including "
-#~ "financial. We use the funds to reimburse members and others for expenses "
-#~ "they incur when contributing. Further funds are used for legal support "
-#~ "and organizing conferences and meetings. We would like to "
-#~ "encourage you to support our efforts with a financial donation, using one "
-#~ "of the ways described at %2 . Thank you very "
-#~ "much in advance for your support."
-#~ msgstr ""
-#~ "KDE je i uvijek će biti dostupan bez naknade, ali njegovo stvaranje "
-#~ "nije besplatno. Kako bi podržala razvoj, zajednica KDE "
-#~ "osnovala je KDE e.V., neprofitnu organizaciju pravno utemeljenu u "
-#~ "Njemačkoj. KDE e.V. zastupa zajednicu KDE u pravnim i financijskim "
-#~ "pitanjima. Pogledajte %1 za više informacija o KDE e.V."
-#~ " KDE ima koristi od mnogo različitih doprinosa, uključujući "
-#~ "financijske. Sredstva se koriste za naknadu troškova članovima i ostalima "
-#~ "koji se javljaju kod doprinosa. Dodatno se sredstva koriste za pravnu "
-#~ "pomoć i organiziranje konferencija i sastanaka. Pozivamo Vas "
-#~ "da nas podržite financijskom donacijom koristeći se jednim od načina "
-#~ "opisanih na %2 . Unaprijed Vam zahvaljujemo "
-#~ "na vašoj podršci."
-
-#~ msgctxt "About KDE"
-#~ msgid "&About"
-#~ msgstr "&O KDE-u"
-
-#~ msgid "&Report Bugs or Wishes"
-#~ msgstr "Prijavite &nedostatke ili želje"
-
-#~ msgid "&Join KDE"
-#~ msgstr "Pridružite se KDE-u"
-
-#~ msgid "&Support KDE"
-#~ msgstr "&Podržite KDE"
-
-#~ msgctxt "Opposite to Back"
-#~ msgid "Next"
-#~ msgstr "Sljedeće"
-
-#~ msgid "Finish"
-#~ msgstr "Završi"
-
-#~ msgid "Configure"
-#~ msgstr "Konfiguriranje"
-
-#~ msgid "Print Immediately"
-#~ msgstr "Odmah ispiši"
-
-#~ msgid "Hold Indefinitely"
-#~ msgstr "zadrži nedefiniranim"
-
-#~ msgid "Day (06:00 to 17:59)"
-#~ msgstr "Dan (06:00 do 17:59)"
-
-#~ msgid "Night (18:00 to 05:59)"
-#~ msgstr "Noć (18:00 do 05:59)"
-
-#~ msgid "Second Shift (16:00 to 23:59)"
-#~ msgstr "Druga smjena (16:00 do 23:59)"
-
-#~ msgid "Third Shift (00:00 to 07:59)"
-#~ msgstr "Treća smjena (00:00 do 07:59)"
-
-#~ msgid "Weekend (Saturday to Sunday)"
-#~ msgstr "Vikend (od subote do nedjelje)"
-
-#~ msgid "Specific Time"
-#~ msgstr "Specifično vrijeme"
-
-#~ msgid "Left to Right, Top to Bottom"
-#~ msgstr "S lijeva na desno, od vrha prema dnu"
-
-#~ msgid "Left to Right, Bottom to Top"
-#~ msgstr "S lijeva na desno, od dna prema vrhu"
-
-#~ msgid "Right to Left, Bottom to Top"
-#~ msgstr "S desna na lijevo, od dna prema vrhu"
-
-#~ msgid "Right to Left, Top to Bottom"
-#~ msgstr "S desna na lijevo, od vrha prema dnu"
-
-#~ msgid "Bottom to Top, Left to Right"
-#~ msgstr "Od dna prema vrhu, s lijeva na desno"
-
-#~ msgid "Bottom to Top, Right to Left"
-#~ msgstr "Od dna prema vrhu, s desna na lijevo"
-
-#~ msgid "Top to Bottom, Left to Right"
-#~ msgstr "Od vrha prema dnu, s lijeva na desno"
-
-#~ msgid "Top to Bottom, Right to Left"
-#~ msgstr "Od vrha prema dnu, s desna na lijevo"
-
-#~ msgctxt "No border line"
-#~ msgid "None"
-#~ msgstr "Bez"
-
-#~ msgid "Single Line"
-#~ msgstr "Jednostruka linija"
-
-#~ msgid "Single Thick Line"
-#~ msgstr "Jednostruka debela linija"
-
-#~ msgid "Double Line"
-#~ msgstr "Dvostruka linija"
-
-#~ msgid "Double Thick Line"
-#~ msgstr "Dvostruka debela linija"
-
-#~ msgctxt "Banner page"
-#~ msgid "None"
-#~ msgstr "Bez"
-
-#~ msgctxt "Banner page"
-#~ msgid "Standard"
-#~ msgstr "Standardno"
-
-#~ msgctxt "Banner page"
-#~ msgid "Unclassified"
-#~ msgstr "Van klase"
-
-#~ msgctxt "Banner page"
-#~ msgid "Confidential"
-#~ msgstr "Povjerljivo"
-
-#~ msgctxt "Banner page"
-#~ msgid "Classified"
-#~ msgstr "Klasificirano"
-
-#~ msgctxt "Banner page"
-#~ msgid "Secret"
-#~ msgstr "Tajno"
-
-#~ msgctxt "Banner page"
-#~ msgid "Top Secret"
-#~ msgstr "Vrlo tajno"
-
-#~ msgid "All Pages"
-#~ msgstr "Sve stranice"
-
-#~ msgid "Odd Pages"
-#~ msgstr "Neparne stranice"
-
-#~ msgid "Even Pages"
-#~ msgstr "Parne stranice"
-
-#~ msgid "Page Set"
-#~ msgstr "Skup stranica"
-
-#~ msgctxt "@title:window"
-#~ msgid "Print"
-#~ msgstr "Ispis"
-
-#~ msgid "--- separator ---"
-#~ msgstr "--- razdjelnik ---"
-
-#~ msgid "Change Text"
-#~ msgstr "Promijeni tekst"
-
-#~ msgid "Icon te&xt:"
-#~ msgstr "&Tekst ikone:"
-
-#~ msgid "&Hide text when toolbar shows text alongside icons"
-#~ msgstr "S&akrij tekst kada alatna traka prikazuje tekst uz ikone"
-
-#~ msgid "Configure Toolbars"
-#~ msgstr "Konfiguriranje alatnih traka"
-
-#~ msgid ""
-#~ "Do you really want to reset all toolbars of this application to their "
-#~ "default? The changes will be applied immediately."
-#~ msgstr ""
-#~ "Zaista želiš vratiti sve alatne trake ove aplikacije na početne "
-#~ "vrijednosti? Promjene će biti odmah prihvaćene."
-
-#~ msgid "Reset Toolbars"
-#~ msgstr "Vrati Alatne trake"
-
-#~ msgid "Reset"
-#~ msgstr "Vrati izvorno"
-
-#~ msgid "&Toolbar:"
-#~ msgstr "&Alatna traka:"
-
-#~ msgid "A&vailable actions:"
-#~ msgstr "&Dostupne aktivnosti:"
-
-#~ msgid "Filter"
-#~ msgstr "Filter"
-
-#~ msgid "Curr&ent actions:"
-#~ msgstr "&Trenutne aktivnosti:"
-
-#~ msgid "Change &Icon..."
-#~ msgstr "Promjeni &ikonu…"
-
-#~ msgid "Change Te&xt..."
-#~ msgstr "Promijeni tekst…"
-
-#~ msgctxt "@item:intable Action name in toolbar editor"
-#~ msgid "%1"
-#~ msgstr "%1"
-
-#~ msgid ""
-#~ "This element will be replaced with all the elements of an embedded "
-#~ "component."
-#~ msgstr ""
-#~ "Ovaj će element biti zamijenjen svim elementima povezane komponente."
-
-#~ msgid ""
-#~ msgstr ""
-
-#~ msgid ""
-#~ msgstr ""
-
-#~ msgid ""
-#~ "This is a dynamic list of actions. You can move it, but if you remove it "
-#~ "you will not be able to re-add it."
-#~ msgstr ""
-#~ "Ovo je dinamički popis aktivnosti. Možete ga pomaknuti, ali ukoliko ga "
-#~ "uklonite nećete ga moći ponovno dodati."
-
-#~ msgid "ActionList: %1"
-#~ msgstr "Popis aktivnosti: %1"
-
-#~ msgctxt "@label Action tooltip in toolbar editor, below the action list"
-#~ msgid "%1"
-#~ msgstr "%1"
-
-#~ msgid "Change Icon"
-#~ msgstr "Promjeni ikonu…"
-
-#~ msgid "Manage Link"
-#~ msgstr "Odredi poveznicu"
-
-#~ msgid "Link Text:"
-#~ msgstr "Tekst poveznice:"
-
-#~ msgid "Link URL:"
-#~ msgstr "URL poveznice:"
-
-#~ msgid "Password"
-#~ msgstr "Zaporka"
-
-#~ msgid "Select Region of Image"
-#~ msgstr "Izaberite dio slike"
-
-#~ msgid "Please click and drag on the image to select the region of interest:"
-#~ msgstr ""
-#~ "Molim vas kliknite i vucite na sliku za odabir regije koja vas zanima:"
-
-#~ msgid "Default:"
-#~ msgstr "Uobičajeno:"
-
-#~ msgctxt "No shortcut defined"
-#~ msgid "None"
-#~ msgstr "Bez"
-
-#~ msgid "Custom:"
-#~ msgstr "Prilagođeno:"
-
-#~ msgid "Shortcut Schemes"
-#~ msgstr "Prečaci"
-
-#~ msgid "Current scheme:"
-#~ msgstr "Trenutna shema:"
-
-#~ msgid "New..."
-#~ msgstr "Novo…"
-
-#~ msgid "Delete"
-#~ msgstr "Izbriši"
-
-#~ msgid "More Actions"
-#~ msgstr "Više akcija"
-
-#~ msgid "Save as Scheme Defaults"
-#~ msgstr "Spremi pod uobičajene sheme"
-
-#~ msgid "Export Scheme..."
-#~ msgstr "Izvezi shemu…"
-
-#~ msgid "Name for New Scheme"
-#~ msgstr "Naziv nove sheme"
-
-#~ msgid "Name for new scheme:"
-#~ msgstr "Naziv nove sheme:"
-
-#~ msgid "New Scheme"
-#~ msgstr "Nova shema"
-
-#~ msgid "A scheme with this name already exists."
-#~ msgstr "Shema sa tim nazivom već postoji."
-
-#~ msgid ""
-#~ "Do you really want to delete the scheme %1?\n"
-#~ "Note that this will not remove any system wide shortcut schemes."
-#~ msgstr ""
-#~ "Zaista želite izbrisati shemu %1\n"
-#~ "Imajte na umu da ovo neće izbrisati niti jednu shemu sistemskih prečaca."
-
-#~ msgid "Export to Location"
-#~ msgstr "Izvezi u lokaciju"
-
-#~ msgid "Could not export shortcuts scheme because the location is invalid."
-#~ msgstr "Nije moguće izvesti sheme prečaca jer lokacija nije valjana."
-
-#~ msgid ""
-#~ "The current shortcut scheme is modified. Save before switching to the new "
-#~ "one?"
-#~ msgstr ""
-#~ "Trenutna shema prečaca je promijenjena. Želite li je spremiti prije "
-#~ "prelaska na novu?"
-
-#~ msgid "Configure Shortcuts"
-#~ msgstr "Konfiguriranje prečaca"
-
-#~ msgid "Print"
-#~ msgstr "Ispis"
-
-#~ msgid "Reset to Defaults"
-#~ msgstr "Vrati na uobičajeno"
-
-#~ msgid "Unknown"
-#~ msgstr "Nepoznato"
-
-#~ msgid "Key Conflict"
-#~ msgstr "Sukob tipki"
-
-#~ msgid ""
-#~ "The '%1' shape gesture has already been allocated to the \"%2\" action.\n"
-#~ "Do you want to reassign it from that action to the current one?"
-#~ msgstr ""
-#~ "Kombinacija tipki '%1' već je dodijeljena aktivnosti \"%2\".\n"
-#~ "Želite li izmijeniti dodjelu iz te u trenutnu aktivnosti?"
-
-#~ msgid "Reassign"
-#~ msgstr "Prenamjeni"
-
-#~ msgid ""
-#~ "The '%1' rocker gesture has already been allocated to the \"%2\" action.\n"
-#~ "Do you want to reassign it from that action to the current one?"
-#~ msgstr ""
-#~ "Kombinacija tipki '%1' već je dodijeljena aktivnosti \"%2\".\n"
-#~ "Želite li izmijeniti dodjelu iz te u trenutnu aktivnosti?"
-
-#~ msgctxt "header for an applications shortcut list"
-#~ msgid "Shortcuts for %1"
-#~ msgstr "Prečaci za %1"
-
-#~ msgid "Global:"
-#~ msgstr "Opće:"
-
-#~ msgid "Action Name"
-#~ msgstr "Naziv radnje"
-
-#~ msgid "Shortcuts"
-#~ msgstr "Prečaci"
-
-#~ msgid "Description"
-#~ msgstr "Opis"
-
-#~ msgctxt "@item:intable Action name in shortcuts configuration"
-#~ msgid "%1"
-#~ msgstr "%1"
-
-#~ msgid "Switch Application Language"
-#~ msgstr "Promijeni jezik aplikacije"
-
-#~ msgid ""
-#~ "Please choose the language which should be used for this application:"
-#~ msgstr "Molim odaberite jezik koji će biti korišten za tu aplikaciju:"
-
-#~ msgid "Add Fallback Language"
-#~ msgstr "Dodaj pomoćni jezik"
-
-#~ msgid ""
-#~ "Adds one more language which will be used if other translations do not "
-#~ "contain a proper translation."
-#~ msgstr ""
-#~ "Dodavanje još jednog jezika koji će biti korišten ako drugi prijevodi ne "
-#~ "sadrže valjani prijevod."
-
-#~ msgid ""
-#~ "The language for this application has been changed. The change will take "
-#~ "effect the next time the application is started."
-#~ msgstr ""
-#~ "Jezik ove aplikacije je promijenjen. Promjene će biti prihvaćene nakon "
-#~ "ponovnog pokretanja aplikacije."
-
-#~ msgid "Application Language Changed"
-#~ msgstr "Jezik aplikacije je promijenjen"
-
-#~ msgid "Primary language:"
-#~ msgstr "Primarni jezik:"
-
-#~ msgid "Fallback language:"
-#~ msgstr "Pomoćni jezik:"
-
-#~ msgid "Remove"
-#~ msgstr "Ukloni"
-
-#~ msgid ""
-#~ "This is the main application language which will be used first, before "
-#~ "any other languages."
-#~ msgstr ""
-#~ "Ovo je glavni jezik aplikacije koji će prvi biti korišten, prije svih "
-#~ "drugih jezika."
-
-#~ msgid ""
-#~ "This is the language which will be used if any previous languages do not "
-#~ "contain a proper translation."
-#~ msgstr ""
-#~ "Ovaj jezik će biti korišten ako niti jedan prethodni ne sadrži valjani "
-#~ "prijevod."
-
-#~ msgid "Tip of the Day"
-#~ msgstr "Savjet dana"
-
-#~ msgid "Did you know...?\n"
-#~ msgstr "Jeste li znal…?\n"
-
-#~ msgid "&Show tips on startup"
-#~ msgstr "Tijekom pokretanja &prikaži savjete"
-
-#~ msgctxt "Opposite to Previous"
-#~ msgid "&Next"
-#~ msgstr "&Sljedeće"
-
-#~ msgctxt "City, Country"
-#~ msgid "%1, %2"
-#~ msgstr "%1, %2"
-
-#~ msgctxt "A generic social network or homepage link of an unlisted type."
-#~ msgid "Other"
-#~ msgstr "Ostalo"
-
-#~ msgctxt "A type of link."
-#~ msgid "Blog"
-#~ msgstr "Blog"
-
-#~ msgctxt "A type of link."
-#~ msgid "Homepage"
-#~ msgstr "Osobna stranica"
-
-#~ msgid "Submit Bug Report"
-#~ msgstr "Prijava nedostatka"
-
-#~ msgid ""
-#~ "Your email address. If incorrect, use the Configure Email button to "
-#~ "change it"
-#~ msgstr ""
-#~ "Vaša adresa e-pošte. Ako je netočna, ispravite je putem gumba "
-#~ "\"Konfiguriranje e-pošte\"."
-
-#~ msgctxt "Email sender address"
-#~ msgid "From:"
-#~ msgstr "Od:"
-
-#~ msgid "Configure Email..."
-#~ msgstr "Konfiguriranje e-pošte…"
-
-#~ msgid "The email address this bug report is sent to."
-#~ msgstr "Adresa e-pošte na koju se šalje ova prijava nedostatka."
-
-#~ msgctxt "Email receiver address"
-#~ msgid "To:"
-#~ msgstr "Za:"
-
-#~ msgid "&Send"
-#~ msgstr "&Pošalji"
-
-#~ msgid "Send bug report."
-#~ msgstr "Pošalji prijava o nedostatku"
-
-#~ msgid "Send this bug report to %1."
-#~ msgstr "Ovu prijavu nedostatka pošalji na adresu: %1."
-
-#~ msgid ""
-#~ "The application for which you wish to submit a bug report - if incorrect, "
-#~ "please use the Report Bug menu item of the correct application"
-#~ msgstr ""
-#~ "Aplikacija za koju želite poslati prijavu nedostatka. Ako je netočno, "
-#~ "putem izbornika \"Prijava nedostatka\" odaberite željenu aplikaciju."
-
-#~ msgid "Application: "
-#~ msgstr "Aplikacija:"
-
-#~ msgid ""
-#~ "The version of this application - please make sure that no newer version "
-#~ "is available before sending a bug report"
-#~ msgstr ""
-#~ "Verzija ove aplikacije. Provjerite ne postoji li novija verzije prije "
-#~ "slanja prijava nedostatka."
-
-#~ msgid "no version set (programmer error)"
-#~ msgstr "verzija nije postavljena (pogreška programera)"
-
-#~ msgid "OS:"
-#~ msgstr "OS:"
-
-#~ msgid "Compiler:"
-#~ msgstr "Kompajler:"
-
-#~ msgid "Se&verity"
-#~ msgstr "&Ozbiljnost"
-
-#~ msgid "Critical"
-#~ msgstr "Kritično"
-
-#~ msgid "Grave"
-#~ msgstr "Ozbiljno"
-
-#~ msgctxt "normal severity"
-#~ msgid "Normal"
-#~ msgstr "Normalno"
-
-#~ msgid "Wishlist"
-#~ msgstr "Popis želja"
-
-#~ msgid "Translation"
-#~ msgstr "Prijevod"
-
-#~ msgid "S&ubject: "
-#~ msgstr "&Predmet:"
-
-#~ msgid ""
-#~ "Enter the text (in English if possible) that you wish to submit for the "
-#~ "bug report.\n"
-#~ "If you press \"Send\", a mail message will be sent to the maintainer of "
-#~ "this program.\n"
-#~ msgstr ""
-#~ "Unesite tekst koji želite poslati kao prijavu o nedostatku (na engleskom, "
-#~ "ukoliko je moguće).\n"
-#~ "Poruka će biti poslana održavatelju ovog programa nakon što kliknete gumb "
-#~ "\"Pošalji\".\n"
-
-#~ msgid ""
-#~ "To submit a bug report, click on the button below. This will open a "
-#~ "web browser window on http://bugs.kde."
-#~ "org where you will find a form to fill in. The information displayed "
-#~ "above will be transferred to that server. "
-#~ msgstr ""
-#~ "Za prijavljivanje izvještaja o grešci, kliknite na vezu dolje.Ona će "
-#~ "otvoriti prozor Web preglednika na http://bugs.kde.org gdje ćete pronaći obrazac koji treba popuniti."
-#~ "Informacija prikazana gore biti će prenešna na taj poslužitelj. "
-
-#~ msgid "&Launch Bug Report Wizard"
-#~ msgstr "&Pokreni čarobnjak za prijavu grešaka"
-
-#~ msgctxt "unknown program name"
-#~ msgid "unknown"
-#~ msgstr "nije poznat"
-
-#~ msgid ""
-#~ "You must specify both a subject and a description before the report can "
-#~ "be sent."
-#~ msgstr "Prije slanja prijave morate navesti i temu i opis."
-
-#~ msgid ""
-#~ "You chose the severity Critical . Please note that this severity "
-#~ "is intended only for bugs that:
break unrelated software on "
-#~ "the system (or the whole system) cause serious data loss"
-#~ "li> introduce a security hole on the system where the affected package "
-#~ "is installed \n"
-#~ "Does the bug you are reporting cause any of the above damage? If it "
-#~ "does not, please select a lower severity. Thank you.
"
-#~ msgstr ""
-#~ "Odabrali ste razinu ozbiljnosti Kritično . Molim uzmite u obzir "
-#~ "da je ta razina ozbiljnosti namijenjena samo za kvarove koji "
-#~ "p>
onesposobljavaju rad drugih programe u sustavu (ili cijeli "
-#~ "sustav) uzrokuju ozbiljan gubitak podataka uvode "
-#~ "sigurnosnu rupu u sustavu na kojem je zahvaćeni paket instaliran "
-#~ "ul>\n"
-#~ "Stvara li kvar koji prijavljujete bilo koji od navedenih simptoma? Ako "
-#~ "ne, molim smanjite ozbiljnost. Hvala!
"
-
-#~ msgid ""
-#~ "You chose the severity Grave . Please note that this severity is "
-#~ "intended only for bugs that:
make the package in question "
-#~ "unusable or mostly so cause data loss introduce a "
-#~ "security hole allowing access to the accounts of users who use the "
-#~ "affected package \n"
-#~ "Does the bug you are reporting cause any of the above damage? If it "
-#~ "does not, please select a lower severity. Thank you.
"
-#~ msgstr ""
-#~ "Odabrali ste razinu ozbiljnosti Ozbiljno . Molim uzmite u obzir "
-#~ "da je ta razina ozbiljnosti namijenjena samo za kvarove koji:"
-#~ "p>
čine paket o kojem se radi potpuno ili gotovo beskorisnim"
-#~ "li> ostvaruju gubitak podataka uvodi sigurnosnu rupu u sustavu "
-#~ "koja omogućuje pristup računima korisnika koji koriste zahvaćeni paket"
-#~ "li> \n"
-#~ "Stvara li kvar koji prijavljujete bilo koji od navedenih simptoma? Ako "
-#~ "ne, molim smanjite razinu ozbiljnosti. Hvala!
"
-
-#~ msgid ""
-#~ "Unable to send the bug report.\n"
-#~ "Please submit a bug report manually....\n"
-#~ "See http://bugs.kde.org/ for instructions."
-#~ msgstr ""
-#~ "Nije moguće poslati izvještaj o kvaru.\n"
-#~ "Molim vas da izvještaj o kvaru prijavite ručno...\n"
-#~ "Upute potražite na adresi: http://bugs.kde.org/ ."
-
-#~ msgid "Bug report sent, thank you for your input."
-#~ msgstr "Prijava o kvaru je poslana. Zahvaljujemo."
-
-#~ msgid ""
-#~ "Close and discard\n"
-#~ "edited message?"
-#~ msgstr ""
-#~ "Zatvoriti i odbaciti\n"
-#~ "uređivanu poruku?"
-
-#~ msgid "Close Message"
-#~ msgstr "Zatvori poruku"
-
-#~ msgctxt "Action to send an email to a contributor"
-#~ msgid "Email contributor"
-#~ msgstr "Pošalji e-poštu pridonositelju"
-
-#~ msgid "Visit contributor's homepage"
-#~ msgstr "Posjetite osobnu stranicu pridonositelja"
-
-#~ msgctxt "Action to send an email to a contributor"
-#~ msgid ""
-#~ "Email contributor\n"
-#~ "%1"
-#~ msgstr ""
-#~ "Pošalji e-poštu pridonositelju\n"
-#~ "%1"
-
-#~ msgid ""
-#~ "Visit contributor's homepage\n"
-#~ "%1"
-#~ msgstr ""
-#~ "Posjetite osobnu stranicu pridonositelja\n"
-#~ "%1"
-
-#~ msgid ""
-#~ "Visit contributor's profile on %1\n"
-#~ "%2"
-#~ msgstr ""
-#~ "Posjetite profil pridonositelja na %1\n"
-#~ "%2"
-
-#~ msgid ""
-#~ "Visit contributor's page\n"
-#~ "%1"
-#~ msgstr ""
-#~ "Posjetite stranicu pridonositelja\n"
-#~ "%1"
-
-#~ msgid ""
-#~ "Visit contributor's blog\n"
-#~ "%1"
-#~ msgstr ""
-#~ "Posjetite blog pridonositelja\n"
-#~ "%1"
-
-#~ msgctxt "@item Contributor name in about dialog."
-#~ msgid "%1"
-#~ msgstr "%1"
-
-#~ msgid "&Try"
-#~ msgstr "&Pokušaj"
-
-#~ msgid "modified"
-#~ msgstr "izmijenjeno"
-
-#~ msgctxt "Document/application separator in titlebar"
-#~ msgid " – "
-#~ msgstr " – "
-
-#~ msgid "&Details"
-#~ msgstr "&Detalji"
-
-#~ msgid "Get help..."
-#~ msgstr "Zatraži pomoć…"
-
-#~ msgctxt "@action:button filter-yes"
-#~ msgid "%1"
-#~ msgstr "%1"
-
-#~ msgctxt "@action:button filter-no"
-#~ msgid "%1"
-#~ msgstr "%1"
-
-#~ msgctxt "@action:button filter-continue"
-#~ msgid "%1"
-#~ msgstr "%1"
-
-#~ msgctxt "@action:button filter-cancel"
-#~ msgid "%1"
-#~ msgstr "%1"
-
-#~ msgctxt "@action:button post-filter"
-#~ msgid "."
-#~ msgstr "."
-
-#~ msgid "Details"
-#~ msgstr "Detalji"
-
-#~ msgid "Question"
-#~ msgstr "Pitanje"
-
-#~ msgid "Do not ask again"
-#~ msgstr "Ne pitaj ponovno"
-
-#~ msgid "Warning"
-#~ msgstr "Upozorenje"
-
-#~ msgid "Error"
-#~ msgstr "Pogreška"
-
-#~ msgid "Sorry"
-#~ msgstr "Isprike"
-
-#~ msgid "Information"
-#~ msgstr "Podaci"
-
-#~ msgid "Do not show this message again"
-#~ msgstr "Ne prikazuj više ovu poruku"
-
-#~ msgid "Find Next"
-#~ msgstr "Traži sljedeće"
-
-#~ msgid "Find next occurrence of '%1 '? "
-#~ msgstr "Traži slijedeću pojavu '%1 '? "
-
-#~ msgid "1 match found."
-#~ msgid_plural "%1 matches found."
-#~ msgstr[0] "Pronađen %1 par."
-#~ msgstr[1] "Pronađena %1 para."
-#~ msgstr[2] "Pronađeno %1 parova."
-
-#~ msgid "No matches found for '%1 '. "
-#~ msgstr "Nije pronađeno: '%1 '. "
-
-#~ msgid "No matches found for '%1 '."
-#~ msgstr "Nije pronađeno: '%1 '."
-
-#~ msgid "Beginning of document reached."
-#~ msgstr "Došao sam do početka dokumenta."
-
-#~ msgid "End of document reached."
-#~ msgstr "Došao sam do kraja dokumenta."
-
-#~ msgid "Continue from the end?"
-#~ msgstr "Nastavljam od kraja?"
-
-#~ msgid "Continue from the beginning?"
-#~ msgstr "Nastavljam ispočetka?"
-
-#~ msgid "Find Text"
-#~ msgstr "Pronađi tekst"
-
-#~ msgctxt "@title:group"
-#~ msgid "Find"
-#~ msgstr "Traži"
-
-#~ msgid "&Text to find:"
-#~ msgstr "&Tekst:"
-
-#~ msgid "Regular e&xpression"
-#~ msgstr "Regularni izraz"
-
-#~ msgid "&Edit..."
-#~ msgstr "&Uredi…"
-
-#~ msgid "Replace With"
-#~ msgstr "Zamijeni sa:"
-
-#~ msgid "Replace&ment text:"
-#~ msgstr "Za&mjenski tekst:"
-
-#~ msgid "Use p&laceholders"
-#~ msgstr "Koristi p&laceholdere"
-
-#~ msgid "Insert Place&holder"
-#~ msgstr "Mjesto za umetanje"
-
-#~ msgid "C&ase sensitive"
-#~ msgstr "Pazi na veličinu slova"
-
-#~ msgid "&Whole words only"
-#~ msgstr "Samo &cijele riječi"
-
-#~ msgid "From c&ursor"
-#~ msgstr "Od &pokazivača"
-
-#~ msgid "Find &backwards"
-#~ msgstr "Traži &unatrag"
-
-#~ msgid "&Selected text"
-#~ msgstr "Odabrani tek&st"
-
-#~ msgid "&Prompt on replace"
-#~ msgstr "&Upozori prilikom zamjene"
-
-#~ msgid "Start replace"
-#~ msgstr "Zamijeni"
-
-#~ msgid ""
-#~ "If you press the Replace button, the text you entered above is "
-#~ "searched for within the document and any occurrence is replaced with the "
-#~ "replacement text. "
-#~ msgstr ""
-#~ "Ako pritisnete gumb Zamijeni , dokument će biti pretražen "
-#~ "tekstom za pretragu i svako pojavljivanje će biti zamijenjeno tekstom za "
-#~ "zamijenu. "
-
-#~ msgid "&Find"
-#~ msgstr "&Traži"
-
-#~ msgid "Start searching"
-#~ msgstr "Započni pretragu"
-
-#~ msgid ""
-#~ "If you press the Find button, the text you entered above is "
-#~ "searched for within the document. "
-#~ msgstr ""
-#~ "Ako pritisnete gumb Nađi , dokument će biti pretražen za tekst "
-#~ "koji ste unijeli iznad. "
-
-#~ msgid ""
-#~ "Enter a pattern to search for, or select a previous pattern from the list."
-#~ msgstr "Unesite uzorak za kojim tragate ili odaberite prijašnji s liste."
-
-#~ msgid "If enabled, search for a regular expression."
-#~ msgstr "Ako je omogućeno, traži regularni izraz."
-
-#~ msgid "Click here to edit your regular expression using a graphical editor."
-#~ msgstr ""
-#~ "Kliknite ovdje kako bi ste promijenili vaš regularni izraz koristeći "
-#~ "grafički uređivač."
-
-#~ msgid "Enter a replacement string, or select a previous one from the list."
-#~ msgstr "Unesite zamjenski niz znakova ili odaberite prijašnji s liste."
-
-#~ msgid ""
-#~ "If enabled, any occurrence of \\N
, where "
-#~ "N
is an integer number, will be replaced with the "
-#~ "corresponding capture (\"parenthesized substring\") from the pattern."
-#~ "To include (a literal \\N
in your replacement, put "
-#~ "an extra backslash in front of it, like \\\\N
.
"
-#~ "qt>"
-#~ msgstr ""
-#~ "Ako je omogućeno, svako pojavljivanje \\N
-a, gdje "
-#~ "je N
cijeli broj, bit će zamijenjeno odgovarajućim "
-#~ "uhvatom (\"podniz u zagradi\") iz uzorka.Kako biste dodali literal "
-#~ "\\N
u vašu zamjenu, dodajte jednu dodatnu obrnutu "
-#~ "kosu crtu ispred njega, npr. \\\\N
.
"
-
-#~ msgid "Click for a menu of available captures."
-#~ msgstr "Kliknite za izbornik dostupnih uhvata."
-
-#~ msgid "Require word boundaries in both ends of a match to succeed."
-#~ msgstr ""
-#~ "Zahtijevaj da se granice riječi na oba kraja podudaraju da bi se "
-#~ "podudarnost prihvatila."
-
-#~ msgid ""
-#~ "Start searching at the current cursor location rather than at the top."
-#~ msgstr ""
-#~ "Bolje pokreni pretragu od trenutne pozicije pokazivača nego od vrha."
-
-#~ msgid "Only search within the current selection."
-#~ msgstr "Pretražuj samo u trenutno označenom."
-
-#~ msgid ""
-#~ "Perform a case sensitive search: entering the pattern 'Joe' will not "
-#~ "match 'joe' or 'JOE', only 'Joe'."
-#~ msgstr ""
-#~ "Izvrši pretragu ovisnu o velikim i malim slovima: unošenjem uzorka 'Ivan' "
-#~ "neće biti pronađen 'ivan', niti 'IVAN', već samo 'Ivan'."
-
-#~ msgid "Search backwards."
-#~ msgstr "Traži unatrag."
-
-#~ msgid "Ask before replacing each match found."
-#~ msgstr "Pitaj prije nego zamijeniš svaki pojedini pronalazak."
-
-#~ msgid "Any Character"
-#~ msgstr "Bilo koji znak"
-
-#~ msgid "Start of Line"
-#~ msgstr "Početak reda"
-
-#~ msgid "End of Line"
-#~ msgstr "Završetak retka"
-
-#~ msgid "Set of Characters"
-#~ msgstr "Set znakova"
-
-#~ msgid "Repeats, Zero or More Times"
-#~ msgstr "Ponavlja, nula ili više puta"
-
-#~ msgid "Repeats, One or More Times"
-#~ msgstr "Ponavlja, jedan ili više puta"
-
-#~ msgid "Optional"
-#~ msgstr "Neobavezno"
-
-#~ msgid "Escape"
-#~ msgstr "Escape"
-
-#~ msgid "TAB"
-#~ msgstr "TAB"
-
-#~ msgid "Newline"
-#~ msgstr "Novi red"
-
-#~ msgid "Carriage Return"
-#~ msgstr "Novi redak"
-
-#~ msgid "White Space"
-#~ msgstr "Bijeli prostor (white space)"
-
-#~ msgid "Digit"
-#~ msgstr "Znamenka"
-
-#~ msgid "Complete Match"
-#~ msgstr "Cijeloviti pogodak"
-
-#~ msgid "Captured Text (%1)"
-#~ msgstr "Uhvaćen tekst (%1)"
-
-#~ msgid "You must enter some text to search for."
-#~ msgstr "Morate upisati tekst koji se traži."
-
-#~ msgid "Invalid regular expression."
-#~ msgstr "Neispravan regularni izraz."
-
-#~ msgid "Replace"
-#~ msgstr "Zamijeni"
-
-#~ msgctxt "@action:button Replace all occurrences"
-#~ msgid "&All"
-#~ msgstr "&Sve"
-
-#~ msgid "&Skip"
-#~ msgstr "&Preskoči"
-
-#~ msgid "Replace '%1' with '%2'?"
-#~ msgstr "Zamijeni '%1' sa '%2'?"
-
-#~ msgid "No text was replaced."
-#~ msgstr "Ništa teksta nije zamijenjeno."
-
-#~ msgid "1 replacement done."
-#~ msgid_plural "%1 replacements done."
-#~ msgstr[0] "%1 zamjena izvršena."
-#~ msgstr[1] "%1 zamjene izvršene."
-#~ msgstr[2] "%1 zamjena izvršenih."
-
-#~ msgid "Do you want to restart search from the end?"
-#~ msgstr "Želite li pretraživati ponovno od kraja?"
-
-#~ msgid "Do you want to restart search at the beginning?"
-#~ msgstr "Želite li pretraživati ponovno od početka?"
-
-#~ msgctxt "@action:button Restart find & replace"
-#~ msgid "Restart"
-#~ msgstr "Ponovi"
-
-#~ msgctxt "@action:button Stop find & replace"
-#~ msgid "Stop"
-#~ msgstr "Zaustavi"
-
-#~ msgid ""
-#~ "Your replacement string is referencing a capture greater than '\\%1', "
-#~ msgstr "Vaš zamjenski string odnosi se na uhvat veći od '\\%1',"
-
-#~ msgid "but your pattern only defines 1 capture."
-#~ msgid_plural "but your pattern only defines %1 captures."
-#~ msgstr[0] "no vaš uzorak definira samo %1 uhvat."
-#~ msgstr[1] "no vaš uzorak definira samo %1 uhvata."
-#~ msgstr[2] "no vaš uzorak definira samo %1 uhvata."
-
-#~ msgid "but your pattern defines no captures."
-#~ msgstr "no vaš uzorak ne definira ni jedan uhvat."
-
-#~ msgid ""
-#~ "\n"
-#~ "Please correct."
-#~ msgstr ""
-#~ "\n"
-#~ "Molim ispravite."
-
-#~ msgctxt "@item Font name"
-#~ msgid "Sans Serif"
-#~ msgstr "Sans Serif"
-
-#~ msgctxt "@item Font name"
-#~ msgid "Serif"
-#~ msgstr "Serif"
-
-#~ msgctxt "@item Font name"
-#~ msgid "Monospace"
-#~ msgstr "Monospace"
-
-#~ msgctxt "@item Font name"
-#~ msgid "%1"
-#~ msgstr "%1"
-
-#~ msgctxt "@item Font name [foundry]"
-#~ msgid "%1 [%2]"
-#~ msgstr "%1 [%2]"
-
-#~ msgctxt "short"
-#~ msgid "The Quick Brown Fox Jumps Over The Lazy Dog"
-#~ msgstr "Riba ribi grize rep šđčćž ŠĐČĆŽ"
-
-#~ msgctxt "Numeric IDs of scripts for font previews"
-#~ msgid "1"
-#~ msgstr "1"
-
-#~ msgid "Select Font"
-#~ msgstr "Odaberi font"
-
-#~ msgid "Choose..."
-#~ msgstr "Odaberi…"
-
-#~ msgid "Click to select a font"
-#~ msgstr "Font odaberite klikanjem"
-
-#~ msgid "Preview of the selected font"
-#~ msgstr "Pregled odabranog fonta"
-
-#~ msgid ""
-#~ "This is a preview of the selected font. You can change it by clicking the "
-#~ "\"Choose...\" button."
-#~ msgstr ""
-#~ "Ovo je pregled odabranog fonta. Font možete promijeniti klikanjem gumba "
-#~ "\"Odaberi...\"."
-
-#~ msgid "Preview of the \"%1\" font"
-#~ msgstr "Pregled fonta \"%1\""
-
-#~ msgid ""
-#~ "This is a preview of the \"%1\" font. You can change it by clicking the "
-#~ "\"Choose...\" button."
-#~ msgstr ""
-#~ "Ovo je pregled fonta \"%1\". Font možete promijeniti klikanjem gumba "
-#~ "\"Odaberi...\"."
-
-#~ msgctxt "@info:whatsthis"
-#~ msgid "Here you can choose the font to be used."
-#~ msgstr "Ovdje možete odabrati pismo koji želite upotrebljavati."
-
-#~ msgid "Requested Font"
-#~ msgstr "Zahtijevani font"
-
-#~ msgctxt "@option:check"
-#~ msgid "Font"
-#~ msgstr "Pismo"
-
-#~ msgctxt "@info:whatsthis"
-#~ msgid "Enable this checkbox to change the font family settings."
-#~ msgstr ""
-#~ "Da biste promijenili postavku obitelji fontova označite ovaj odabirni "
-#~ "okvir."
-
-#~ msgctxt "@info:tooltip"
-#~ msgid "Change font family?"
-#~ msgstr "Promjena skupine pisma?"
-
-#~ msgctxt "@label"
-#~ msgid "Font:"
-#~ msgstr "Pismo:"
-
-#~ msgctxt "@option:check"
-#~ msgid "Font style"
-#~ msgstr "Stil pisma"
-
-#~ msgctxt "@info:whatsthis"
-#~ msgid "Enable this checkbox to change the font style settings."
-#~ msgstr "Omogući ovaj odabirni okvir za promjenu postavki stila pisma"
-
-#~ msgctxt "@info:tooltip"
-#~ msgid "Change font style?"
-#~ msgstr "Promijeniti stil pisma?"
-
-#~ msgid "Font style:"
-#~ msgstr "Stil fonta:"
-
-#~ msgctxt "@option:check"
-#~ msgid "Size"
-#~ msgstr "Veličina"
-
-#~ msgctxt "@info:whatsthis"
-#~ msgid "Enable this checkbox to change the font size settings."
-#~ msgstr ""
-#~ "Da biste promijenili postavku veličine pisma označite ovaj odabirni okvir."
-
-#~ msgctxt "@info:tooltip"
-#~ msgid "Change font size?"
-#~ msgstr "Promjena veličine pisma?"
-
-#~ msgctxt "@label:listbox Font size"
-#~ msgid "Size:"
-#~ msgstr "Veličina:"
-
-#~ msgctxt "@info:whatsthis"
-#~ msgid "Here you can choose the font family to be used."
-#~ msgstr "Ovdje možete odabrati skupinu pisma koju želite upotrebljavati."
-
-#~ msgctxt "@info:whatsthis"
-#~ msgid "Here you can choose the font style to be used."
-#~ msgstr "Ovdje možete odabrati stil pisma koji želite upotrebljavati."
-
-#~ msgctxt "@item font"
-#~ msgid "Italic"
-#~ msgstr "Kurziv"
-
-#~ msgctxt "@item font"
-#~ msgid "Oblique"
-#~ msgstr "Oblo"
-
-#~ msgctxt "@item font"
-#~ msgid "Bold"
-#~ msgstr "Podebljan"
-
-#~ msgctxt "@item font"
-#~ msgid "Bold Italic"
-#~ msgstr "Podebljani kurziv"
-
-#~ msgctxt "@item font size"
-#~ msgid "Relative"
-#~ msgstr "Relativno"
-
-#~ msgid "Font sizefixed or relative to environment"
-#~ msgstr ""
-#~ "Veličina pisma fiksna ili relativna u odnosu na "
-#~ "okolinu"
-
-#~ msgid ""
-#~ "Here you can switch between fixed font size and font size to be "
-#~ "calculated dynamically and adjusted to changing environment (e.g. widget "
-#~ "dimensions, paper size)."
-#~ msgstr ""
-#~ "Ovdje možete odabrati između fiksne veličine slova i dinamički izračunate "
-#~ "veličine koja se prilagođava izmjenama okoline (npr. prema veličini "
-#~ "widgeta, papira, itd.)."
-
-#~ msgid "Here you can choose the font size to be used."
-#~ msgstr "Ovdje možete odabrati veličinu fonta koju želite upotrebljavati."
-
-#~ msgid "The Quick Brown Fox Jumps Over The Lazy Dog"
-#~ msgstr "Riba ribi grize rep šđčćž ŠĐČĆŽ"
-
-#~ msgid ""
-#~ "This sample text illustrates the current settings. You may edit it to "
-#~ "test special characters."
-#~ msgstr ""
-#~ "Ovaj tekst je primjer koji prikazuje trenutne postavke fonta. Možete ga "
-#~ "izmijeniti ako želite provjeriti druge ili posebne znakove."
-
-#~ msgid "Actual Font"
-#~ msgstr "Stvaran font"
-
-#~ msgctxt "@item Font style"
-#~ msgid "%1"
-#~ msgstr "%1"
-
-#~ msgid "Search"
-#~ msgstr "Traži"
-
-#~ msgid " Stalled "
-#~ msgstr "Zastoj"
-
-#~ msgid " %1/s "
-#~ msgstr " %1/s "
-
-#~ msgctxt "%1 is the label, we add a ':' to it"
-#~ msgid "%1:"
-#~ msgstr "%1:"
-
-#~ msgid "%2 of %3 complete"
-#~ msgid_plural "%2 of %3 complete"
-#~ msgstr[0] "%2 of %3 završeno"
-#~ msgstr[1] "%2 of %3 završeno"
-#~ msgstr[2] "%2 of %3 završeno"
-
-#~ msgid "%2 / %1 folder"
-#~ msgid_plural "%2 / %1 folders"
-#~ msgstr[0] "%2 / %1 mape"
-#~ msgstr[1] "%2 / %1 mapa"
-#~ msgstr[2] "%2 / %1 mapa"
-
-#~ msgid "%2 / %1 file"
-#~ msgid_plural "%2 / %1 files"
-#~ msgstr[0] "%2 / %1 datoteka"
-#~ msgstr[1] "%2 / %1 datoteka"
-#~ msgstr[2] "%2 / %1 datoteka"
-
-#~ msgid "%1% of %2"
-#~ msgstr "%1% od %2"
-
-#~ msgid "%2% of 1 file"
-#~ msgid_plural "%2% of %1 files"
-#~ msgstr[0] "%2% od %1 datoteke"
-#~ msgstr[1] "%2% od %1 datoteke"
-#~ msgstr[2] "%2% od %1 datoteka"
-
-#~ msgid "%1%"
-#~ msgstr "%1%"
-
-#~ msgid "Stalled"
-#~ msgstr "Zastoj"
-
-#~ msgid "%2/s (%3 remaining)"
-#~ msgid_plural "%2/s (%3 remaining)"
-#~ msgstr[0] "%2/s (%3 preostalo)"
-#~ msgstr[1] "%2/s (%3 preostalo)"
-#~ msgstr[2] "%2/s (%3 preostalo)"
-
-#~ msgctxt "speed in bytes per second"
-#~ msgid "%1/s"
-#~ msgstr "%1/s"
-
-#~ msgid "%1/s (done)"
-#~ msgstr "%1/s (učinjeno)"
-
-#~ msgid "&Resume"
-#~ msgstr "&Vrati izvorno"
-
-#~ msgid "&Pause"
-#~ msgstr "&Pauza"
-
-#~ msgctxt "The source url of a job"
-#~ msgid "Source:"
-#~ msgstr "Izvor:"
-
-#~ msgctxt "The destination url of a job"
-#~ msgid "Destination:"
-#~ msgstr "Destinacija:"
-
-#~ msgid "Click this to expand the dialog, to show details"
-#~ msgstr "Kliknite za proširenje dialoga, za prikaz detalja"
-
-#~ msgid "&Keep this window open after transfer is complete"
-#~ msgstr "&Ostavi prozor otvorenim nakon izvršenog prijenosa"
-
-#~ msgid "Open &File"
-#~ msgstr "Otvori &Datoteku"
-
-#~ msgid "Open &Destination"
-#~ msgstr "Otvori D&estinaciju"
-
-#~ msgid "Progress Dialog"
-#~ msgstr "Dialog napretka"
-
-#~ msgid "%1 folder"
-#~ msgid_plural "%1 folders"
-#~ msgstr[0] "%1 mapa"
-#~ msgstr[1] "%1 mape"
-#~ msgstr[2] "%1 mapa"
-
-#~ msgid "%1 file"
-#~ msgid_plural "%1 files"
-#~ msgstr[0] "%1 datoteka"
-#~ msgstr[1] "%1 datoteke"
-#~ msgstr[2] "%1 datoteka"
-
-#~ msgid "Click this to collapse the dialog, to hide details"
-#~ msgstr "Kliknite ovdje da bi ste sklopili dijalog, odnosno sakrili detalje."
-
-#~ msgid "The style '%1' was not found"
-#~ msgstr "Stil '%1' nije pronađen"
-
-#~ msgid "Do not run in the background."
-#~ msgstr "Ne pokreći u pozadini."
-
-#~ msgid "Internally added if launched from Finder"
-#~ msgstr "Interno dodano u slučaju pokretanja iz Pretraživača."
-
-#~ msgid "Unknown Application"
-#~ msgstr "Nepoznata aplikacija"
-
-#~ msgid "Minimize"
-#~ msgstr "Minimiziraj"
-
-#~ msgid "&Minimize"
-#~ msgstr "&Minimiziraj"
-
-#~ msgid "&Restore"
-#~ msgstr "&Vrati"
-
-#~ msgid "Are you sure you want to quit %1 ? "
-#~ msgstr ""
-#~ "Sigurno želite izaći iz %1 ? |/|Sigurno želite izaći iz "
-#~ "$[gen %1] ? "
-
-#~ msgid "Confirm Quit From System Tray"
-#~ msgstr "Prihvati izlazak iz sistemske trake"
-
-#~ msgctxt "@title:window"
-#~ msgid "Dr. Klash' Accelerator Diagnosis"
-#~ msgstr "Dr. Klash dijagnoza ubrzivača"
-
-#~ msgctxt "@option:check"
-#~ msgid "Disable automatic checking"
-#~ msgstr "Onemogući automatsko provjeravanje"
-
-#~ msgctxt "@action:button"
-#~ msgid "Close"
-#~ msgstr "Zatvori"
-
-#~ msgid "Accelerators changed "
-#~ msgstr "Izmijenjeni ubrzivači "
-
-#~ msgid "Accelerators removed "
-#~ msgstr "Uklonjeni ubrzivači "
-
-#~ msgid "Accelerators added (just for your info) "
-#~ msgstr "Dodani ubrzivači (samo za vašu referencu) "
-
-#~ msgctxt "left mouse button"
-#~ msgid "left button"
-#~ msgstr "lijeva tipka"
-
-#~ msgctxt "middle mouse button"
-#~ msgid "middle button"
-#~ msgstr "srednja tipka"
-
-#~ msgctxt "right mouse button"
-#~ msgid "right button"
-#~ msgstr "desna tipka"
-
-#~ msgctxt "a nonexistent value of mouse button"
-#~ msgid "invalid button"
-#~ msgstr "nevaljajuća tipka"
-
-#~ msgctxt ""
-#~ "a kind of mouse gesture: hold down one mouse button, then press another "
-#~ "button"
-#~ msgid "Hold %1, then push %2"
-#~ msgstr "Drži %1, a zatim pritisni %2"
-
-#~ msgid "Conflict with Global Shortcut"
-#~ msgstr "Sukom s općim prečacem"
-
-#~ msgid ""
-#~ "The '%1' key combination has already been allocated to the global action "
-#~ "\"%2\" in %3.\n"
-#~ "Do you want to reassign it from that action to the current one?"
-#~ msgstr ""
-#~ "Kombinacija tipki '%1' već je dodijeljena općoj aktivnosti \"%2 \" u "
-#~ "%3.\n"
-#~ "Želite li izmijeniti dodjelu iz te u trenutnu aktivnost?"
-
-#~ msgid ""
-#~ "The '%1' key combination is registered by application %2 for action %3:"
-#~ msgstr "Kombinacija '%1' je registrirana za aplikaciju %2 za radnju %3."
-
-#~ msgid "In context '%1' for action '%2'\n"
-#~ msgstr "U kontekstu '%1' za akciju '%2'\n"
-
-#~ msgid ""
-#~ "The '%1' key combination is registered by application %2.\n"
-#~ "%3"
-#~ msgstr ""
-#~ "Aplikacija %2 je registrirala kombinaciju tipaka '%1'.\n"
-#~ "%3"
-
-#~ msgid "Conflict With Registered Global Shortcut"
-#~ msgstr "Sukob s registriranim općim prečacem"
-
-#~ msgctxt "@action"
-#~ msgid "Open"
-#~ msgstr "Otvori"
-
-#~ msgctxt "@action"
-#~ msgid "New"
-#~ msgstr "Novo"
-
-#~ msgctxt "@action"
-#~ msgid "Close"
-#~ msgstr "Zatvori"
-
-#~ msgctxt "@action"
-#~ msgid "Save"
-#~ msgstr "Spremi"
-
-#~ msgctxt "@action"
-#~ msgid "Print"
-#~ msgstr "Ispis"
-
-#~ msgctxt "@action"
-#~ msgid "Quit"
-#~ msgstr "Izlaz"
-
-#~ msgctxt "@action"
-#~ msgid "Undo"
-#~ msgstr "Vrati"
-
-#~ msgctxt "@action"
-#~ msgid "Redo"
-#~ msgstr "Ponovi"
-
-#~ msgctxt "@action"
-#~ msgid "Cut"
-#~ msgstr "Izreži"
-
-#~ msgctxt "@action"
-#~ msgid "Copy"
-#~ msgstr "Kopiraj"
-
-#~ msgctxt "@action"
-#~ msgid "Paste"
-#~ msgstr "Umetni"
-
-#~ msgctxt "@action"
-#~ msgid "Paste Selection"
-#~ msgstr "Zalijepi odabir"
-
-#~ msgctxt "@action"
-#~ msgid "Select All"
-#~ msgstr "Označi sve"
-
-#~ msgctxt "@action"
-#~ msgid "Deselect"
-#~ msgstr "Ukloni odabir"
-
-#~ msgctxt "@action"
-#~ msgid "Delete Word Backwards"
-#~ msgstr "Riječ izbriši unazad"
-
-#~ msgctxt "@action"
-#~ msgid "Delete Word Forward"
-#~ msgstr "Riječ izbriši prema naprijed"
-
-#~ msgctxt "@action"
-#~ msgid "Find"
-#~ msgstr "Traži"
-
-#~ msgctxt "@action"
-#~ msgid "Find Next"
-#~ msgstr "Traži sljedeće"
-
-#~ msgctxt "@action"
-#~ msgid "Find Prev"
-#~ msgstr "Traži prethodno"
-
-#~ msgctxt "@action"
-#~ msgid "Replace"
-#~ msgstr "Zamijeni"
-
-#~ msgctxt "@action Go to main page"
-#~ msgid "Home"
-#~ msgstr "Kućni telefon"
-
-#~ msgctxt "@action Beginning of document"
-#~ msgid "Begin"
-#~ msgstr "Početak"
-
-#~ msgctxt "@action End of document"
-#~ msgid "End"
-#~ msgstr "Završetak"
-
-#~ msgctxt "@action"
-#~ msgid "Prior"
-#~ msgstr "Prijašnji"
-
-#~ msgctxt "@action Opposite to Prior"
-#~ msgid "Next"
-#~ msgstr "Sljedeće"
-
-#~ msgctxt "@action"
-#~ msgid "Up"
-#~ msgstr "Gore"
-
-#~ msgctxt "@action"
-#~ msgid "Back"
-#~ msgstr "Nazad"
-
-#~ msgctxt "@action"
-#~ msgid "Forward"
-#~ msgstr "Naprijed"
-
-#~ msgctxt "@action"
-#~ msgid "Reload"
-#~ msgstr "Osvježi"
-
-#~ msgctxt "@action"
-#~ msgid "Beginning of Line"
-#~ msgstr "Početak retka"
-
-#~ msgctxt "@action"
-#~ msgid "End of Line"
-#~ msgstr "Završetak retka"
-
-#~ msgctxt "@action"
-#~ msgid "Go to Line"
-#~ msgstr "Kreni na redak"
-
-#~ msgctxt "@action"
-#~ msgid "Backward Word"
-#~ msgstr "Riječ nazad"
-
-#~ msgctxt "@action"
-#~ msgid "Forward Word"
-#~ msgstr "Riječ naprijed"
-
-#~ msgctxt "@action"
-#~ msgid "Add Bookmark"
-#~ msgstr "Dodaj oznaku"
-
-#~ msgctxt "@action"
-#~ msgid "Zoom In"
-#~ msgstr "Uvećaj"
-
-#~ msgctxt "@action"
-#~ msgid "Zoom Out"
-#~ msgstr "Umanji"
-
-#~ msgctxt "@action"
-#~ msgid "Full Screen Mode"
-#~ msgstr "Preko punog zaslona"
-
-#~ msgctxt "@action"
-#~ msgid "Show Menu Bar"
-#~ msgstr "Prikaži traku s izbornikom"
-
-#~ msgctxt "@action"
-#~ msgid "Activate Next Tab"
-#~ msgstr "Aktiviraj sljedeću karticu"
-
-#~ msgctxt "@action"
-#~ msgid "Activate Previous Tab"
-#~ msgstr "Aktiviraj prethodnu karticu"
-
-#~ msgctxt "@action"
-#~ msgid "Help"
-#~ msgstr "Pomoć"
-
-#~ msgctxt "@action"
-#~ msgid "What's This"
-#~ msgstr "Što je ovo?"
-
-#~ msgctxt "@action"
-#~ msgid "Text Completion"
-#~ msgstr "Dovršavanje teksta"
-
-#~ msgctxt "@action"
-#~ msgid "Previous Completion Match"
-#~ msgstr "Prethodno dovršavanje"
-
-#~ msgctxt "@action"
-#~ msgid "Next Completion Match"
-#~ msgstr "Sljedeće dovršavanje"
-
-#~ msgctxt "@action"
-#~ msgid "Substring Completion"
-#~ msgstr "Dovršavanje podniza"
-
-#~ msgctxt "@action"
-#~ msgid "Previous Item in List"
-#~ msgstr "Prethodna stavka s popisa"
-
-#~ msgctxt "@action"
-#~ msgid "Next Item in List"
-#~ msgstr "Sljedeća stavka s popisa"
-
-#~ msgctxt "@action"
-#~ msgid "Open Recent"
-#~ msgstr "Otvori &nedavno"
-
-#~ msgctxt "@action"
-#~ msgid "Save As"
-#~ msgstr "Spremi kao"
-
-#~ msgctxt "@action"
-#~ msgid "Revert"
-#~ msgstr "Vrati izvorno"
-
-#~ msgctxt "@action"
-#~ msgid "Print Preview"
-#~ msgstr "Pregled prije ispisa"
-
-#~ msgctxt "@action"
-#~ msgid "Mail"
-#~ msgstr "Pošta"
-
-#~ msgctxt "@action"
-#~ msgid "Clear"
-#~ msgstr "Izbriši"
-
-#~ msgctxt "@action"
-#~ msgid "Actual Size"
-#~ msgstr "Stvarna veličina"
-
-#~ msgctxt "@action"
-#~ msgid "Fit To Page"
-#~ msgstr "Podesi prema veličini stranice"
-
-#~ msgctxt "@action"
-#~ msgid "Fit To Width"
-#~ msgstr "Podesi prema širini"
-
-#~ msgctxt "@action"
-#~ msgid "Fit To Height"
-#~ msgstr "Podesi prema visini"
-
-#~ msgctxt "@action"
-#~ msgid "Zoom"
-#~ msgstr "Zumiraj"
-
-#~ msgctxt "@action"
-#~ msgid "Goto"
-#~ msgstr "Idi na"
-
-#~ msgctxt "@action"
-#~ msgid "Goto Page"
-#~ msgstr "Idi na stranicu"
-
-#~ msgctxt "@action"
-#~ msgid "Document Back"
-#~ msgstr "Prethodni dokument"
-
-#~ msgctxt "@action"
-#~ msgid "Document Forward"
-#~ msgstr "Slijedeći dokument"
-
-#~ msgctxt "@action"
-#~ msgid "Edit Bookmarks"
-#~ msgstr "Uredi knjiške oznake…"
-
-#~ msgctxt "@action"
-#~ msgid "Spelling"
-#~ msgstr "Pravopis"
-
-#~ msgctxt "@action"
-#~ msgid "Show Toolbar"
-#~ msgstr "Prikaži alatnu traku"
-
-#~ msgctxt "@action"
-#~ msgid "Show Statusbar"
-#~ msgstr "Prikaži traku stanja"
-
-#~ msgctxt "@action"
-#~ msgid "Save Options"
-#~ msgstr "Spremi opcije"
-
-#~ msgctxt "@action"
-#~ msgid "Key Bindings"
-#~ msgstr "&Vezanje tipki"
-
-#~ msgctxt "@action"
-#~ msgid "Preferences"
-#~ msgstr "Osobitosti"
-
-#~ msgctxt "@action"
-#~ msgid "Configure Toolbars"
-#~ msgstr "Konfiguriranje alatnih traka"
-
-#~ msgctxt "@action"
-#~ msgid "Configure Notifications"
-#~ msgstr "Konfiguriranje obavijesti…"
-
-#~ msgctxt "@action"
-#~ msgid "Tip Of Day"
-#~ msgstr "Savjet dana"
-
-#~ msgctxt "@action"
-#~ msgid "Report Bug"
-#~ msgstr "Prijava greške"
-
-#~ msgctxt "@action"
-#~ msgid "Switch Application Language"
-#~ msgstr "Promijeni aplikacije."
-
-#~ msgctxt "@action"
-#~ msgid "About Application"
-#~ msgstr "O aplikaciji"
-
-#~ msgctxt "@action"
-#~ msgid "About KDE"
-#~ msgstr "O okruženju KDE"
-
-#~ msgctxt "@title:window"
-#~ msgid "Check Spelling"
-#~ msgstr "Provjeri pravopis"
-
-#~ msgctxt "@action:button"
-#~ msgid "&Finished"
-#~ msgstr "&Završeno"
-
-#~ msgctxt "progress label"
-#~ msgid "Spell checking in progress..."
-#~ msgstr "Provjera pravopisa u tijeku…"
-
-#~ msgid "Spell check stopped."
-#~ msgstr "Zaustavljena provjera pravopisa."
-
-#~ msgid "Spell check canceled."
-#~ msgstr "Prekinuta provjera pravopisa."
-
-#~ msgid "Spell check complete."
-#~ msgstr "Završena provjera pravopisa."
-
-#~ msgid "Spell Checking Configuration"
-#~ msgstr "Konfiguracija provjere pravopisa"
-
-#~ msgid ""
-#~ "You reached the end of the list\n"
-#~ "of matching items.\n"
-#~ msgstr ""
-#~ "Stigli ste do završetka popisa\n"
-#~ "podudarnih stavki.\n"
-
-#~ msgid ""
-#~ "The completion is ambiguous, more than one\n"
-#~ "match is available.\n"
-#~ msgstr ""
-#~ "Nadopuna je nepravilna, postoji više od \n"
-#~ "jednog podudarnog rješenja.\n"
-
-#~ msgid "There is no matching item available.\n"
-#~ msgstr "Nema raspoložive podudarne stavke.\n"
-
-#~ msgid "Backspace"
-#~ msgstr "Backspace"
-
-#~ msgid "SysReq"
-#~ msgstr "SysReq"
-
-#~ msgid "CapsLock"
-#~ msgstr "CapsLock"
-
-#~ msgid "NumLock"
-#~ msgstr "NumLock"
-
-#~ msgid "ScrollLock"
-#~ msgstr "ScrollLock"
-
-#~ msgid "PageUp"
-#~ msgstr "PageUp"
-
-#~ msgid "PageDown"
-#~ msgstr "PageDown"
-
-#~ msgid "Again"
-#~ msgstr "Ponovo"
-
-#~ msgid "Props"
-#~ msgstr "Osobine"
-
-#~ msgid "Undo"
-#~ msgstr "Vrati"
-
-#~ msgid "Front"
-#~ msgstr "Front"
-
-#~ msgid "Copy"
-#~ msgstr "Kopiraj"
-
-#~ msgid "Open"
-#~ msgstr "Otvori"
-
-#~ msgid "Paste"
-#~ msgstr "Umetni"
-
-#~ msgid "Find"
-#~ msgstr "Traži"
-
-#~ msgid "Cut"
-#~ msgstr "Izreži"
-
-#~ msgid "&OK"
-#~ msgstr "&U redu"
-
-#~ msgid "&Cancel"
-#~ msgstr "&Odustani"
-
-#~ msgid "&Yes"
-#~ msgstr "&Da"
-
-#~ msgid "Yes"
-#~ msgstr "Da"
-
-#~ msgid "&No"
-#~ msgstr "&Ne"
-
-#~ msgid "No"
-#~ msgstr "Ne"
-
-#~ msgid "&Discard"
-#~ msgstr "&Odbaci"
-
-#~ msgid "Discard changes"
-#~ msgstr "Odbaci izmjene"
-
-#~ msgid ""
-#~ "Pressing this button will discard all recent changes made in this dialog."
-#~ msgstr "Klikanjem ovog gumba odbacuju se sve izmjene u ovom dijalogu."
-
-#~ msgid "&Save"
-#~ msgstr "&Spremi"
-
-#~ msgid "Save data"
-#~ msgstr "Spremi podatke"
-
-#~ msgid "&Do Not Save"
-#~ msgstr "&Nemoj spremiti"
-
-#~ msgid "Do not save data"
-#~ msgstr "Ne spremaj podatke"
-
-#~ msgid "Save &As..."
-#~ msgstr "Spremi &kao…"
-
-#~ msgid "Save file with another name"
-#~ msgstr "Spremanje datoteke pod drugim nazivom"
-
-#~ msgid "&Apply"
-#~ msgstr "&Primijeni"
-
-#~ msgid "Apply changes"
-#~ msgstr "Primijeni izmjene"
-
-#~ msgid ""
-#~ "When you click Apply , the settings will be handed over to the "
-#~ "program, but the dialog will not be closed.\n"
-#~ "Use this to try different settings."
-#~ msgstr ""
-#~ "Kada kliknete na Prihvati , postavke će biti poslane programu, ali "
-#~ "dijaloški prozor neće biti zatvoren.\n"
-#~ "Ovo koristite kako biste isprobali različite postavke."
-
-#~ msgid "Administrator &Mode..."
-#~ msgstr "Administratorski &način rada…"
-
-#~ msgid "Enter Administrator Mode"
-#~ msgstr "Ulaz u administratorski način rada"
-
-#~ msgid ""
-#~ "When you click Administrator Mode you will be prompted for the "
-#~ "administrator (root) password in order to make changes which require root "
-#~ "privileges."
-#~ msgstr ""
-#~ "Kada kliknete na Administratorski način rada , trebat ćete unijeti "
-#~ "administratorsku (root) zaporku kako bi mogli napraviti promjene koje "
-#~ "zahtijevaju root ovlasti."
-
-#~ msgid "Clear input"
-#~ msgstr "Isprazni unos"
-
-#~ msgid "Clear the input in the edit field"
-#~ msgstr "Brisanje unosa u polju za izmjene"
-
-#~ msgid "Show help"
-#~ msgstr "Prikazivanje pomoći"
-
-#~ msgid "Close the current window or document"
-#~ msgstr "Zatvaranje aktivnog prozora ili dokumenta"
-
-#~ msgid "&Close Window"
-#~ msgstr "&Zatvoriti prozor?"
-
-#~ msgid "Close the current window."
-#~ msgstr "Zatvori trenutni prozor."
-
-#~ msgid "&Close Document"
-#~ msgstr "&Zatvori dokument"
-
-#~ msgid "Close the current document."
-#~ msgstr "Zatvori trenutni dokument."
-
-#~ msgid "&Defaults"
-#~ msgstr "&Uobičajeno"
-
-#~ msgid "Reset all items to their default values"
-#~ msgstr "Povratak svih stavki na uobičajene vrijednosti"
-
-#~ msgid "Go back one step"
-#~ msgstr "Povratak za jedan korak"
-
-#~ msgid "Go forward one step"
-#~ msgstr "Kretanje naprijed za jedan korak"
-
-#~ msgid "&Print..."
-#~ msgstr "&Ispis…"
-
-#~ msgid "Opens the print dialog to print the current document"
-#~ msgstr "Otvaranje dijaloga za ispis trenutnog dokumenta"
-
-#~ msgid "C&ontinue"
-#~ msgstr "&Nastavi"
-
-#~ msgid "Continue operation"
-#~ msgstr "Nastavi operaciju"
-
-#~ msgid "&Delete"
-#~ msgstr "&Izbriši"
-
-#~ msgid "Delete item(s)"
-#~ msgstr "Izbriši stavku(e)"
-
-#~ msgid "&Open..."
-#~ msgstr "&Otvori…"
-
-#~ msgid "Open file"
-#~ msgstr "Otvori datoteku"
-
-#~ msgid "&Quit"
-#~ msgstr "&Izlaz"
-
-#~ msgid "Quit application"
-#~ msgstr "Izlazak iz programa"
-
-#~ msgid "&Reset"
-#~ msgstr "&Poništi"
-
-#~ msgid "Reset configuration"
-#~ msgstr "Vrati konfiguraciju na početno stanje."
-
-#~ msgctxt "Verb"
-#~ msgid "&Insert"
-#~ msgstr "&Ubaci"
-
-#~ msgid "Confi&gure..."
-#~ msgstr "Konfi&guriranje…"
-
-#~ msgid "Add"
-#~ msgstr "Dodaj"
-
-#~ msgid "Test"
-#~ msgstr "Test"
-
-#~ msgid "Properties"
-#~ msgstr "Svojstva"
-
-#~ msgid "&Overwrite"
-#~ msgstr "&Prepisati"
-
-#~ msgid "Redo"
-#~ msgstr "Ponovi"
-
-#~ msgid "&Available:"
-#~ msgstr "&Raspoloživo:"
-
-#~ msgid "&Selected:"
-#~ msgstr "&Odabrano:"
-
-#~ msgctxt "KCharSelect section name"
-#~ msgid "European Alphabets"
-#~ msgstr "Europski alfabeti"
-
-#~ msgctxt "KCharSelect section name"
-#~ msgid "African Scripts"
-#~ msgstr "Afričke skripte"
-
-#~ msgctxt "KCharSelect section name"
-#~ msgid "Middle Eastern Scripts"
-#~ msgstr "Srednjeevropske skripte"
-
-#~ msgctxt "KCharSelect section name"
-#~ msgid "South Asian Scripts"
-#~ msgstr "Južne azijske skripte"
-
-#~ msgctxt "KCharSelect section name"
-#~ msgid "Philippine Scripts"
-#~ msgstr "Filipinske skripte"
-
-#~ msgctxt "KCharSelect section name"
-#~ msgid "South East Asian Scripts"
-#~ msgstr "Južnoistočno azijske skripte"
-
-#~ msgctxt "KCharSelect section name"
-#~ msgid "East Asian Scripts"
-#~ msgstr "Istočno azijske skripte"
-
-#~ msgctxt "KCharSelect section name"
-#~ msgid "Central Asian Scripts"
-#~ msgstr "Srednje azijske skripte"
-
-#~ msgctxt "KCharSelect section name"
-#~ msgid "Other Scripts"
-#~ msgstr "Ostale skripte"
-
-#~ msgctxt "KCharSelect section name"
-#~ msgid "Symbols"
-#~ msgstr "Znakovi"
-
-#~ msgctxt "KCharSelect section name"
-#~ msgid "Mathematical Symbols"
-#~ msgstr "Matematički znakovi"
-
-#~ msgctxt "KCharSelect section name"
-#~ msgid "Phonetic Symbols"
-#~ msgstr "Fonetski znakovi"
-
-#~ msgctxt "KCharSelect section name"
-#~ msgid "Combining Diacritical Marks"
-#~ msgstr "Dijakritičke oznake"
-
-#~ msgctxt "KCharSelect section name"
-#~ msgid "Other"
-#~ msgstr "Ostalo"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Basic Latin"
-#~ msgstr "Osnovni latinski"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Latin-1 Supplement"
-#~ msgstr "Latin-1 dopunjeno"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Latin Extended-A"
-#~ msgstr "Latinica, proširena-A"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Latin Extended-B"
-#~ msgstr "Latinica, proširena-B"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "IPA Extensions"
-#~ msgstr "IPA nastavci"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Spacing Modifier Letters"
-#~ msgstr "Slova promjenljivog razmaka"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Combining Diacritical Marks"
-#~ msgstr "Kombinirane dijakritičke oznake"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Greek and Coptic"
-#~ msgstr "Grčki i koptski"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Cyrillic"
-#~ msgstr "Ćirilica"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Cyrillic Supplement"
-#~ msgstr "Ćirilica dopunjeno"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Armenian"
-#~ msgstr "Armenski"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Hebrew"
-#~ msgstr "Hebrejski"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Arabic"
-#~ msgstr "Arapski"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Syriac"
-#~ msgstr "Sirijski"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Arabic Supplement"
-#~ msgstr "Arapski dopunjeno"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Thaana"
-#~ msgstr "Thaana"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "NKo"
-#~ msgstr "NKo"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Samaritan"
-#~ msgstr "Samaritanski"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Devanagari"
-#~ msgstr "Devanagari"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Bengali"
-#~ msgstr "Bengalski"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Gurmukhi"
-#~ msgstr "Gurmuki"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Gujarati"
-#~ msgstr "Gudžarati"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Oriya"
-#~ msgstr "Oriya"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Tamil"
-#~ msgstr "Tamilski"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Telugu"
-#~ msgstr "Telugu"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Kannada"
-#~ msgstr "Kannada"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Malayalam"
-#~ msgstr "Malajski"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Sinhala"
-#~ msgstr "Sinhala"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Thai"
-#~ msgstr "Thai"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Lao"
-#~ msgstr "Lao"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Tibetan"
-#~ msgstr "Tibetanski"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Myanmar"
-#~ msgstr "Mjanmarski"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Georgian"
-#~ msgstr "Gruzijski"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Hangul Jamo"
-#~ msgstr "Hangul"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Ethiopic"
-#~ msgstr "Etiopski"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Ethiopic Supplement"
-#~ msgstr "Etiopski dopunjeno"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Cherokee"
-#~ msgstr "Cherokee"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Unified Canadian Aboriginal Syllabics"
-#~ msgstr "Unificirani kanadski nativni znakovi"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Ogham"
-#~ msgstr "Ogham"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Runic"
-#~ msgstr "Rune"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Tagalog"
-#~ msgstr "Tamilsko"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Hanunoo"
-#~ msgstr "Hansko"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Buhid"
-#~ msgstr "Tajlandsko"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Tagbanwa"
-#~ msgstr "Thaansko"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Khmer"
-#~ msgstr "Kmerski"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Mongolian"
-#~ msgstr "Mongolski"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Unified Canadian Aboriginal Syllabics Extended"
-#~ msgstr "Unificirani kanadski nativni znakovi, prošireni"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Limbu"
-#~ msgstr "Limbu"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Tai Le"
-#~ msgstr "Thai Le"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "New Tai Lue"
-#~ msgstr "Novi Thai Lue"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Khmer Symbols"
-#~ msgstr "Kmerski geometrijski simboli"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Buginese"
-#~ msgstr "Buginski"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Tai Tham"
-#~ msgstr "Tai Tham"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Balinese"
-#~ msgstr "Balineski"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Sundanese"
-#~ msgstr "Sundanese"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Lepcha"
-#~ msgstr "Lepcha"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Ol Chiki"
-#~ msgstr "Ol Chiki"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Vedic Extensions"
-#~ msgstr "Vedski, prošireni"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Phonetic Extensions"
-#~ msgstr "Fonetska proširenja"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Phonetic Extensions Supplement"
-#~ msgstr "Fonetska proširenja dopunjeno"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Combining Diacritical Marks Supplement"
-#~ msgstr "Kombinirane dijakritičke oznake dopunjeno"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Latin Extended Additional"
-#~ msgstr "Latinica, dodatno prošireni"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Greek Extended"
-#~ msgstr "Grčki, prošireni"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "General Punctuation"
-#~ msgstr "Opće punkcije"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Superscripts and Subscripts"
-#~ msgstr "Potencije i indeksi"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Currency Symbols"
-#~ msgstr "Znakovi valuta"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Combining Diacritical Marks for Symbols"
-#~ msgstr "Kombinirane dijakritičke oznake za simbole"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Letterlike Symbols"
-#~ msgstr "Simboli slični slovima"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Number Forms"
-#~ msgstr "Brojčane forme"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Arrows"
-#~ msgstr "Strelice"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Mathematical Operators"
-#~ msgstr "Matematički operatori"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Miscellaneous Technical"
-#~ msgstr "Razni tehnički"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Control Pictures"
-#~ msgstr "Kontrolne slike"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Optical Character Recognition"
-#~ msgstr "Prepoznavač optičkih znakova"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Enclosed Alphanumerics"
-#~ msgstr "Uključeni alfanumerici"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Box Drawing"
-#~ msgstr "Crtanje kutije"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Block Elements"
-#~ msgstr "Blokovni elementi"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Geometric Shapes"
-#~ msgstr "Geometrijski oblici"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Miscellaneous Symbols"
-#~ msgstr "Razni simboli"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Dingbats"
-#~ msgstr "Dingbati"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Miscellaneous Mathematical Symbols-A"
-#~ msgstr "Razni matematički simboli-A"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Supplemental Arrows-A"
-#~ msgstr "Dopunjene strelice-A"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Braille Patterns"
-#~ msgstr "Braille uzorci"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Supplemental Arrows-B"
-#~ msgstr "Dopunjene strelice-B"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Miscellaneous Mathematical Symbols-B"
-#~ msgstr "Razni matematički simboli-B"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Supplemental Mathematical Operators"
-#~ msgstr "Dopunjeni matematički operatori"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Miscellaneous Symbols and Arrows"
-#~ msgstr "Razni simboli i strelice"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Glagolitic"
-#~ msgstr "Glagoljski"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Latin Extended-C"
-#~ msgstr "Latinica, proširena-C"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Coptic"
-#~ msgstr "Koptski"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Georgian Supplement"
-#~ msgstr "Gruzijski dopunjeno"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Tifinagh"
-#~ msgstr "Tifinaški"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Ethiopic Extended"
-#~ msgstr "Etiopski, prošireni"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Cyrillic Extended-A"
-#~ msgstr "Ćirilica, proširena-A"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Supplemental Punctuation"
-#~ msgstr "Dopunjene punkcije"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "CJK Radicals Supplement"
-#~ msgstr "CJK korjeni dopunjeno"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Kangxi Radicals"
-#~ msgstr "Kangxi korjeni"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Ideographic Description Characters"
-#~ msgstr "Ideografski opisni znakovi"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "CJK Symbols and Punctuation"
-#~ msgstr "CJK simboli i interpunkcija"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Hiragana"
-#~ msgstr "Hiragana"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Katakana"
-#~ msgstr "Katakana"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Bopomofo"
-#~ msgstr "Bopomofo"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Hangul Compatibility Jamo"
-#~ msgstr "Hangul kompatibilni Jamo"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Kanbun"
-#~ msgstr "Kanbun"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Bopomofo Extended"
-#~ msgstr "Bopomofo, prošireni"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "CJK Strokes"
-#~ msgstr "CJK potezi"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Katakana Phonetic Extensions"
-#~ msgstr "Katakana zvučni dodaci"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Enclosed CJK Letters and Months"
-#~ msgstr "Ugrađena CJK slova i mjeseci"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "CJK Compatibility"
-#~ msgstr "CJK kompatibilnost"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "CJK Unified Ideographs Extension A"
-#~ msgstr "CJK unificirani ideografi proširenje A"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Yijing Hexagram Symbols"
-#~ msgstr "Yijing simboli heksagrama"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "CJK Unified Ideographs"
-#~ msgstr "CJK ujedinjeni ideografi"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Yi Syllables"
-#~ msgstr "Yi slogovi"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Yi Radicals"
-#~ msgstr "Yi korjeni"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Lisu"
-#~ msgstr "Lisu"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Vai"
-#~ msgstr "Vai"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Cyrillic Extended-B"
-#~ msgstr "Ćirilica, proširena-B"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Bamum"
-#~ msgstr "Bamum"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Modifier Tone Letters"
-#~ msgstr "Modifikator Boje Slova"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Latin Extended-D"
-#~ msgstr "Latinica, proširena-D"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Syloti Nagri"
-#~ msgstr "Syloti Nagri"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Common Indic Number Forms"
-#~ msgstr "Zajednički indijski brojevni oblik"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Phags-pa"
-#~ msgstr "Phags-pa"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Saurashtra"
-#~ msgstr "Saurashtra"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Devanagari Extended"
-#~ msgstr "Devanagari, prošireni"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Kayah Li"
-#~ msgstr "Kayah Li"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Rejang"
-#~ msgstr "Rejang"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Hangul Jamo Extended-A"
-#~ msgstr "Hangul Jamo, prođireni-A"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Javanese"
-#~ msgstr "Javanski"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Cham"
-#~ msgstr "Cham"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Myanmar Extended-A"
-#~ msgstr "Mijanmarsko, prošireno-A"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Tai Viet"
-#~ msgstr "Tai Viet"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Meetei Mayek"
-#~ msgstr "Meetei Mayek"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Hangul Syllables"
-#~ msgstr "Hangul slogovi"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Hangul Jamo Extended-B"
-#~ msgstr "Hangul Jamo, prođireni-B"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "High Surrogates"
-#~ msgstr "Visoki nadomjesci"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "High Private Use Surrogates"
-#~ msgstr "Visoko privatno koristi surogate"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Low Surrogates"
-#~ msgstr "Niski nadomjesci"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Private Use Area"
-#~ msgstr "Privatno područje"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "CJK Compatibility Ideographs"
-#~ msgstr "CJK kompatibilni ideografi"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Alphabetic Presentation Forms"
-#~ msgstr "Arapske prezentacijske forme"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Arabic Presentation Forms-A"
-#~ msgstr "Arapske prezentacijske forme A."
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Variation Selectors"
-#~ msgstr "Odabiri varijacija"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Vertical Forms"
-#~ msgstr "Uspravne forme"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Combining Half Marks"
-#~ msgstr "Kombiniraj polu oznake"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "CJK Compatibility Forms"
-#~ msgstr "CJK kompatibilne forme"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Small Form Variants"
-#~ msgstr "Male varijante forme."
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Arabic Presentation Forms-B"
-#~ msgstr "Arapske prezentacijske forme B."
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Halfwidth and Fullwidth Forms"
-#~ msgstr "Obrasci polovične i pune širine"
-
-#~ msgctxt "KCharselect unicode block name"
-#~ msgid "Specials"
-#~ msgstr "Posebni"
-
-#~ msgid "Enter a search term or character here"
-#~ msgstr "Ovdje unesite pojam ili znak za traženje"
-
-#~ msgctxt "Goes to previous character"
-#~ msgid "Previous in History"
-#~ msgstr "Prethodna stavka iz povijesti"
-
-#~ msgid "Previous Character in History"
-#~ msgstr "Prethodni znak iz povijesti"
-
-#~ msgctxt "Goes to next character"
-#~ msgid "Next in History"
-#~ msgstr "Sljedeća stavka iz povijesti"
-
-#~ msgid "Next Character in History"
-#~ msgstr "Slijedeći znak iz povijesti"
-
-#~ msgid "Select a category"
-#~ msgstr "Odaberite kategoriju"
-
-#~ msgid "Select a block to be displayed"
-#~ msgstr "Odaberite blok koji će biti prikazan"
-
-#~ msgid "Set font"
-#~ msgstr "Postavi pismo"
-
-#~ msgid "Set font size"
-#~ msgstr "Postavi veličinu pisma"
-
-#~ msgid "Character:"
-#~ msgstr "Znak:"
-
-#~ msgid "Name: "
-#~ msgstr "Naziv:"
-
-#~ msgid "Annotations and Cross References"
-#~ msgstr "Napomene i unakrsne reference"
-
-#~ msgid "Alias names:"
-#~ msgstr "Druga imena:"
-
-#~ msgid "Notes:"
-#~ msgstr "Napomene:"
-
-#~ msgid "See also:"
-#~ msgstr "Također pogledajte:"
-
-#~ msgid "Equivalents:"
-#~ msgstr "Ekvivalenti:"
-
-#~ msgid "Approximate equivalents:"
-#~ msgstr "Približni ekvivalenti:"
-
-#~ msgid "CJK Ideograph Information"
-#~ msgstr "CJK ideografska informacija"
-
-#~ msgid "Definition in English: "
-#~ msgstr "Definicija na engleskom:"
-
-#~ msgid "Mandarin Pronunciation: "
-#~ msgstr "Mandarijanski izgovor:"
-
-#~ msgid "Cantonese Pronunciation: "
-#~ msgstr "Kantoneški izgovor:"
-
-#~ msgid "Japanese On Pronunciation: "
-#~ msgstr "Japanski On izgovor:"
-
-#~ msgid "Japanese Kun Pronunciation: "
-#~ msgstr "Japanski Kun izgovor:"
-
-#~ msgid "Tang Pronunciation: "
-#~ msgstr "Tanški izgovor:"
-
-#~ msgid "Korean Pronunciation: "
-#~ msgstr "Korejski izgovor:"
-
-#~ msgid "General Character Properties"
-#~ msgstr "Opća znakovna svojstva"
-
-#~ msgid "Block: "
-#~ msgstr "Blokirano:"
-
-#~ msgid "Unicode category: "
-#~ msgstr "Kategorija univerzalnog skupa znakova:"
-
-#~ msgid "Various Useful Representations"
-#~ msgstr "Razni korisni prikazi"
-
-#~ msgid "UTF-8:"
-#~ msgstr "UTF-8:"
-
-#~ msgid "UTF-16: "
-#~ msgstr "UTF-16:"
-
-#~ msgid "C octal escaped UTF-8: "
-#~ msgstr "C oktalno zapisano u UTF-8:"
-
-#~ msgid "XML decimal entity:"
-#~ msgstr "Decimalni XML unos:"
-
-#~ msgid "Unicode code point:"
-#~ msgstr "Kod točke u Unicode-u:"
-
-#~ msgctxt "Character"
-#~ msgid "In decimal:"
-#~ msgstr "U decimalnom zapisu:"
-
-#~ msgid ""
-#~ msgstr ""
-
-#~ msgid ""
-#~ msgstr ""
-
-#~ msgid ""
-#~ msgstr ""
-
-#~ msgid ""
-#~ msgstr ""
-
-#~ msgid ""
-#~ msgstr ""
-
-#~ msgid "Non-printable"
-#~ msgstr "Neispisivo"
-
-#~ msgid "Other, Control"
-#~ msgstr "Ostalo, kontrola"
-
-#~ msgid "Other, Format"
-#~ msgstr "Ostalo, oblik"
-
-#~ msgid "Other, Not Assigned"
-#~ msgstr "Ostalo, nedodijeljeno"
-
-#~ msgid "Other, Private Use"
-#~ msgstr "Drugo, privatno korištenje"
-
-#~ msgid "Other, Surrogate"
-#~ msgstr "Drugo, nadomjestak"
-
-#~ msgid "Letter, Lowercase"
-#~ msgstr "Slovo, malo slovo"
-
-#~ msgid "Letter, Modifier"
-#~ msgstr "Slovo, izmjena"
-
-#~ msgid "Letter, Other"
-#~ msgstr "Slovo, ostalo"
-
-#~ msgid "Letter, Titlecase"
-#~ msgstr "Slovo, naslovno"
-
-#~ msgid "Letter, Uppercase"
-#~ msgstr "Slovo, veliko slovo"
-
-#~ msgid "Mark, Spacing Combining"
-#~ msgstr "Oznaka, kombiniravši razmake"
-
-#~ msgid "Mark, Enclosing"
-#~ msgstr "Oznaka, ograđivanje"
-
-#~ msgid "Mark, Non-Spacing"
-#~ msgstr "Oznaka, bez razmaka"
-
-#~ msgid "Number, Decimal Digit"
-#~ msgstr "Broj, decimalne znamenke"
-
-#~ msgid "Number, Letter"
-#~ msgstr "Broj, slovo"
-
-#~ msgid "Number, Other"
-#~ msgstr "Broj, ostalo"
-
-#~ msgid "Punctuation, Connector"
-#~ msgstr "Interpunkcija, spojnica"
-
-#~ msgid "Punctuation, Dash"
-#~ msgstr "Interpunkcija, crta"
-
-#~ msgid "Punctuation, Close"
-#~ msgstr "Interpunkcija, Kraj"
-
-#~ msgid "Punctuation, Final Quote"
-#~ msgstr "Interpunkcija, završni navodnik"
-
-#~ msgid "Punctuation, Initial Quote"
-#~ msgstr "Interpunkcija, početni navodnik"
-
-#~ msgid "Punctuation, Other"
-#~ msgstr "Interpunkcija, ostalo"
-
-#~ msgid "Punctuation, Open"
-#~ msgstr "Interpunkcija, Otvoren"
-
-#~ msgid "Symbol, Currency"
-#~ msgstr "Simboli, valute"
-
-#~ msgid "Symbol, Modifier"
-#~ msgstr "Simbol, Mjenjač"
-
-#~ msgid "Symbol, Math"
-#~ msgstr "Simbol, matematički"
-
-#~ msgid "Symbol, Other"
-#~ msgstr "Simboli, ostali"
-
-#~ msgid "Separator, Line"
-#~ msgstr "Razdjelnik, linija"
-
-#~ msgid "Separator, Paragraph"
-#~ msgstr "Razdjelnik, paragraf"
-
-#~ msgid "Separator, Space"
-#~ msgstr "Razdjelnik, razmaknica"
-
-#~ msgid "You will be asked to authenticate before saving"
-#~ msgstr "Pitat će se Vas za prijavu prije spremanja"
-
-#~ msgid "You are not allowed to save the configuration"
-#~ msgstr "Nije Vam dozvoljeno spremati postavu"
-
-#~ msgid "Week %1"
-#~ msgstr "Tjedan %1"
-
-#~ msgid "Next year"
-#~ msgstr "Sljedeća godina"
-
-#~ msgid "Previous year"
-#~ msgstr "Prethodna godina"
-
-#~ msgid "Next month"
-#~ msgstr "Sljedeći mjesec"
-
-#~ msgid "Previous month"
-#~ msgstr "Prethodni mjesec"
-
-#~ msgid "Select a week"
-#~ msgstr "Odaberite tjedan"
-
-#~ msgid "Select a month"
-#~ msgstr "Odaberite mjesec"
-
-#~ msgid "Select a year"
-#~ msgstr "Odaberite godinu"
-
-#~ msgid "Select the current day"
-#~ msgstr "Odaberite trenutni dan"
-
-#~ msgid "&Add"
-#~ msgstr "&Dodaj"
-
-#~ msgid "&Remove"
-#~ msgstr "&Ukloni"
-
-#~ msgid "Move &Up"
-#~ msgstr "Prema &vrhu"
-
-#~ msgid "Move &Down"
-#~ msgstr "Prema &dnu"
-
-#~ msgid "%1 &Handbook"
-#~ msgstr "&Priručnik %1 |/| &Priručnik za $[aku %1]"
-
-#~ msgid "What's &This"
-#~ msgstr "Što je &ovo"
-
-#~ msgid "&Report Bug..."
-#~ msgstr "&Prijava nedostatka…"
-
-#~ msgid "Switch Application &Language..."
-#~ msgstr "Promijeni &jezik aplikacije"
-
-#~ msgid "&About %1"
-#~ msgstr "&O programu %1"
-
-#~ msgid "About &KDE"
-#~ msgstr "O okruženju &KDE"
-
-#~ msgid "Clear &History"
-#~ msgstr "Izbriši &povijest"
-
-#~ msgid "No further items in the history."
-#~ msgstr "Nema daljnjih stavki u povijesti."
-
-#~ msgid "Shortcut '%1' in Application %2 for action %3\n"
-#~ msgstr "Prečak '%1' u aplikaciji %2 za akciju %3\n"
-
-#~ msgctxt ""
-#~ "%1 is the number of conflicts (hidden), %2 is the key sequence of the "
-#~ "shortcut that is problematic"
-#~ msgid "The shortcut '%2' conflicts with the following key combination:\n"
-#~ msgid_plural ""
-#~ "The shortcut '%2' conflicts with the following key combinations:\n"
-#~ msgstr[0] "Prečac '%2' u konfliktu je s sljedećim kombinacijama tipaka:\n"
-#~ msgstr[1] "Prečac '%2' u konfliktima je s sljedećim kombinacijama tipaka:\n"
-#~ msgstr[2] "Prečac '%2' u konfliktima je s sljedećim kombinacijama tipaka:\n"
-
-#~ msgctxt "%1 is the number of shortcuts with which there is a conflict"
-#~ msgid "Conflict with Registered Global Shortcut"
-#~ msgid_plural "Conflict with Registered Global Shortcuts"
-#~ msgstr[0] "Konflikt s registriranim globalnim prečacem"
-#~ msgstr[1] "Konflikt s registriranim globalnim prečacima"
-#~ msgstr[2] "Konflikt s registriranim globalnim prečacima"
-
-#~ msgctxt "%1 is the number of conflicts"
-#~ msgid "Shortcut Conflict"
-#~ msgid_plural "Shortcut Conflicts"
-#~ msgstr[0] "Konflikt prečaca"
-#~ msgstr[1] "Konflikti prečaca"
-#~ msgstr[2] "Konflikti prečaca"
-
-#~ msgid "Shortcut '%1' for action '%2'\n"
-#~ msgstr "Prečica '%1' za radnju '%2'\n"
-
-#~ msgctxt "%1 is the number of ambigious shortcut clashes (hidden)"
-#~ msgid ""
-#~ "The \"%2\" shortcut is ambiguous with the following shortcut.\n"
-#~ "Do you want to assign an empty shortcut to this action?\n"
-#~ "%3"
-#~ msgid_plural ""
-#~ "The \"%2\" shortcut is ambiguous with the following shortcuts.\n"
-#~ "Do you want to assign an empty shortcut to these actions?\n"
-#~ "%3"
-#~ msgstr[0] ""
-#~ "\"%2\" je prečac u koliziji sa sljedećim prečacem.\n"
-#~ "Želite li dodijeliti prazan prečac ovoj radnji?\n"
-#~ "%3"
-#~ msgstr[1] ""
-#~ "\"%2\" je prečac u koliziji sa sljedećim prečacima.\n"
-#~ "Želite li dodijeliti prazan prečac ovoj radnji?\n"
-#~ "%3"
-#~ msgstr[2] ""
-#~ "\"%2\" je prečac u koliziji sa sljedećim prečacima.\n"
-#~ "Želite li dodijeliti prazan prečac ovoj radnji?\n"
-#~ "%3"
-
-#~ msgid "Shortcut conflict"
-#~ msgstr "Sukob s prečicom"
-
-#~ msgid ""
-#~ "The '%1' key combination is already used by the %2 action."
-#~ " Please select a different one. "
-#~ msgstr ""
-#~ "Kombinacija tipki '%1' je dodijeljena aktivnosti %2 ."
-#~ " Odaberite drugu kombinaciju tipki. "
-
-#~ msgid ""
-#~ "Click on the button, then enter the shortcut like you would in the "
-#~ "program.\n"
-#~ "Example for Ctrl+a: hold the Ctrl key and press a."
-#~ msgstr ""
-#~ "Pritisnite gumb, zatim unesite prečac kao što bi napravili u samom "
-#~ "programu.\\ Primjer za Ctrl+a: držite tipku Ctrl i pritisnite a."
-
-#~ msgid "Reserved Shortcut"
-#~ msgstr "Rezervirani prečaci"
-
-#~ msgid ""
-#~ "The F12 key is reserved on Windows, so cannot be used for a global "
-#~ "shortcut.\n"
-#~ "Please choose another one."
-#~ msgstr ""
-#~ "Tipka F12 rezervirana je na Windowsima i ne može biti korištena kao "
-#~ "globalni prečac.\n"
-#~ "Molim da izaberete drugu tipku."
-
-#~ msgid "Conflict with Standard Application Shortcut"
-#~ msgstr "Sukob sa zadanim prečacem aplikacije"
-
-#~ msgid ""
-#~ "The '%1' key combination is also used for the standard action \"%2\" that "
-#~ "some applications use.\n"
-#~ "Do you really want to use it as a global shortcut as well?"
-#~ msgstr ""
-#~ "Kombinacija tipki '%1' već je dodijeljena standardnoj aktivnosti \"%2\" "
-#~ "koju neka aplikacija koristi.\n"
-#~ "Želite li je zaista koristiti kao opći prečac? "
-
-#~ msgctxt "What the user inputs now will be taken as the new shortcut"
-#~ msgid "Input"
-#~ msgstr "Ulaz"
-
-#~ msgid "The key you just pressed is not supported by Qt."
-#~ msgstr "Qt ne podržava tipku koju ste upravo pritisnuli."
-
-#~ msgid "Unsupported Key"
-#~ msgstr "Nepodržana tipka"
-
-#~ msgid "without name"
-#~ msgstr "Bez naziva"
-
-#~ msgctxt "Italic placeholder text in line edits: 0 no, 1 yes"
-#~ msgid "1"
-#~ msgstr "1"
-
-#~ msgctxt "@action:button Clear current text in the line edit"
-#~ msgid "Clear text"
-#~ msgstr "Izbriši tekst"
-
-#~ msgctxt "@title:menu"
-#~ msgid "Text Completion"
-#~ msgstr "Dovršavanje teksta"
-
-#~ msgctxt "@item:inmenu Text Completion"
-#~ msgid "None"
-#~ msgstr "Bez"
-
-#~ msgctxt "@item:inmenu Text Completion"
-#~ msgid "Manual"
-#~ msgstr "Ručno"
-
-#~ msgctxt "@item:inmenu Text Completion"
-#~ msgid "Automatic"
-#~ msgstr "Automatski"
-
-#~ msgctxt "@item:inmenu Text Completion"
-#~ msgid "Dropdown List"
-#~ msgstr "Padajuća lista"
-
-#~ msgctxt "@item:inmenu Text Completion"
-#~ msgid "Short Automatic"
-#~ msgstr "Kratko automatski"
-
-#~ msgctxt "@item:inmenu Text Completion"
-#~ msgid "Dropdown List && Automatic"
-#~ msgstr "Padajuća lista && automatski"
-
-#~ msgctxt "@item:inmenu Text Completion"
-#~ msgid "Default"
-#~ msgstr "Uobičajeno"
-
-#~ msgid "Image Operations"
-#~ msgstr "Slikovne operacije"
-
-#~ msgid "&Rotate Clockwise"
-#~ msgstr "&Rotiraj u smjeru kazaljke na satu"
-
-#~ msgid "Rotate &Counterclockwise"
-#~ msgstr "Rotiraj &obrnuto od smjera kazaljke na satu"
-
-#~ msgctxt "@action"
-#~ msgid "Text &Color..."
-#~ msgstr "&Boja teksta"
-
-#~ msgctxt "@label stroke color"
-#~ msgid "Color"
-#~ msgstr "Boja"
-
-#~ msgctxt "@action"
-#~ msgid "Text &Highlight..."
-#~ msgstr "&Istakni tekst…"
-
-#~ msgctxt "@action"
-#~ msgid "&Font"
-#~ msgstr "&Pismo"
-
-#~ msgctxt "@action"
-#~ msgid "Font &Size"
-#~ msgstr "&Veličina pisma"
-
-#~ msgctxt "@action boldify selected text"
-#~ msgid "&Bold"
-#~ msgstr "Pode&bljan"
-
-#~ msgctxt "@action italicize selected text"
-#~ msgid "&Italic"
-#~ msgstr "Kurz&iv"
-
-#~ msgctxt "@action underline selected text"
-#~ msgid "&Underline"
-#~ msgstr "Podv&učeno"
-
-#~ msgctxt "@action"
-#~ msgid "&Strike Out"
-#~ msgstr "&Precrtano"
-
-#~ msgctxt "@action"
-#~ msgid "Align &Left"
-#~ msgstr "Poravnaj &Lijevo"
-
-#~ msgctxt "@label left justify"
-#~ msgid "Left"
-#~ msgstr "Lijevo"
-
-#~ msgctxt "@action"
-#~ msgid "Align &Center"
-#~ msgstr "Poravnaj po &Sredini"
-
-#~ msgctxt "@label center justify"
-#~ msgid "Center"
-#~ msgstr "U centru"
-
-#~ msgctxt "@action"
-#~ msgid "Align &Right"
-#~ msgstr "Poravnaj &Desno"
-
-#~ msgctxt "@label right justify"
-#~ msgid "Right"
-#~ msgstr "Desno"
-
-#~ msgctxt "@action"
-#~ msgid "&Justify"
-#~ msgstr "&Obostrano poravnaj"
-
-#~ msgctxt "@label justify fill"
-#~ msgid "Justify"
-#~ msgstr "Obostrano poravnaj"
-
-#~ msgctxt "@action"
-#~ msgid "Left-to-Right"
-#~ msgstr "S lijeva nadesno"
-
-#~ msgctxt "@label left-to-right"
-#~ msgid "Left-to-Right"
-#~ msgstr "S lijeva nadesno"
-
-#~ msgctxt "@action"
-#~ msgid "Right-to-Left"
-#~ msgstr "S desna nalijevo"
-
-#~ msgctxt "@label right-to-left"
-#~ msgid "Right-to-Left"
-#~ msgstr "S desna nalijevo"
-
-#~ msgctxt "@title:menu"
-#~ msgid "List Style"
-#~ msgstr "Stil liste"
-
-#~ msgctxt "@item:inmenu no list style"
-#~ msgid "None"
-#~ msgstr "Bez"
-
-#~ msgctxt "@item:inmenu disc list style"
-#~ msgid "Disc"
-#~ msgstr "Disk"
-
-#~ msgctxt "@item:inmenu circle list style"
-#~ msgid "Circle"
-#~ msgstr "Krug"
-
-#~ msgctxt "@item:inmenu square list style"
-#~ msgid "Square"
-#~ msgstr "Kvadrat"
-
-#~ msgctxt "@item:inmenu numbered lists"
-#~ msgid "123"
-#~ msgstr "123"
-
-#~ msgctxt "@item:inmenu lowercase abc lists"
-#~ msgid "abc"
-#~ msgstr "abc"
-
-#~ msgctxt "@item:inmenu uppercase abc lists"
-#~ msgid "ABC"
-#~ msgstr "ABC"
-
-#~ msgctxt "@action"
-#~ msgid "Increase Indent"
-#~ msgstr "Povećaj uvlaku"
-
-#~ msgctxt "@action"
-#~ msgid "Decrease Indent"
-#~ msgstr "Smanji uvlaku"
-
-#~ msgctxt "@action"
-#~ msgid "Insert Rule Line"
-#~ msgstr "Ubaci ravnalnu liniju"
-
-#~ msgctxt "@action"
-#~ msgid "Link"
-#~ msgstr "Poveznica"
-
-#~ msgctxt "@action"
-#~ msgid "Format Painter"
-#~ msgstr "Urednik oblika"
-
-#~ msgctxt "@action"
-#~ msgid "To Plain Text"
-#~ msgstr "U jednostavni tekst"
-
-#~ msgctxt "@action"
-#~ msgid "Subscript"
-#~ msgstr "&Indeks"
-
-#~ msgctxt "@action"
-#~ msgid "Superscript"
-#~ msgstr "&Eksponent"
-
-#~ msgid "&Copy Full Text"
-#~ msgstr "&Kopiraj cijeli tekst"
-
-#~ msgid "Speak Text"
-#~ msgstr "Izgovori tekst"
-
-#~ msgid "Starting Jovie Text-to-Speech Service Failed"
-#~ msgstr "Neuspjelo pokretanje usluge Jovie za pretvorbu teksta u govor"
-
-#~ msgid "No suggestions for %1"
-#~ msgstr "Bez prijedloga za %1"
-
-#~ msgid "Ignore"
-#~ msgstr "Zanemari"
-
-#~ msgid "Add to Dictionary"
-#~ msgstr "Dodaj u rječnik"
-
-#~ msgid "Nothing to spell check."
-#~ msgstr "Ništa za provjeru pravopisa."
-
-#~ msgctxt "Define an area in the time zone, like a town area"
-#~ msgid "Area"
-#~ msgstr "Područje"
-
-#~ msgctxt "Time zone"
-#~ msgid "Region"
-#~ msgstr "Regija"
-
-#~ msgid "Comment"
-#~ msgstr "Komentar"
-
-#~ msgctxt "@title:menu"
-#~ msgid "Show Text"
-#~ msgstr "Prikaži tekst"
-
-#~ msgctxt "@title:menu"
-#~ msgid "Toolbar Settings"
-#~ msgstr "Postavke alatnih traka"
-
-#~ msgid "Orientation"
-#~ msgstr "Orijentacija"
-
-#~ msgctxt "toolbar position string"
-#~ msgid "Top"
-#~ msgstr "Pri vrhu"
-
-#~ msgctxt "toolbar position string"
-#~ msgid "Left"
-#~ msgstr "Lijevo"
-
-#~ msgctxt "toolbar position string"
-#~ msgid "Right"
-#~ msgstr "Desno"
-
-#~ msgctxt "toolbar position string"
-#~ msgid "Bottom"
-#~ msgstr "Pri dnu"
-
-#~ msgid "Text Position"
-#~ msgstr "Položaj teksta"
-
-#~ msgid "Icons Only"
-#~ msgstr "Samo ikone"
-
-#~ msgid "Text Only"
-#~ msgstr "Samo tekst"
-
-#~ msgid "Text Alongside Icons"
-#~ msgstr "Tekst uz ikone"
-
-#~ msgid "Text Under Icons"
-#~ msgstr "Tekst ispod ikona"
-
-#~ msgid "Icon Size"
-#~ msgstr "Veličina ikone"
-
-#~ msgctxt "@item:inmenu Icon size"
-#~ msgid "Default"
-#~ msgstr "Uobičajeno"
-
-#~ msgid "Small (%1x%2)"
-#~ msgstr "Mala (%1x%2)"
-
-#~ msgid "Medium (%1x%2)"
-#~ msgstr "Srednja (%1x%2)"
-
-#~ msgid "Large (%1x%2)"
-#~ msgstr "Velika (%1x%2)"
-
-#~ msgid "Huge (%1x%2)"
-#~ msgstr "Ogroman (%1x%2)"
-
-#~ msgid "Lock Toolbar Positions"
-#~ msgstr "Zaključavanje pozicija alatnih traka"
-
-#~ msgctxt "@action:intoolbar Text label of toolbar button"
-#~ msgid "%1"
-#~ msgstr "%1"
-
-#~ msgctxt "@info:tooltip Tooltip of toolbar button"
-#~ msgid "%1"
-#~ msgstr "%1"
-
-#~ msgctxt "@option next year"
-#~ msgid "Next Year"
-#~ msgstr "Sljedeća godina"
-
-#~ msgctxt "@option next month"
-#~ msgid "Next Month"
-#~ msgstr "Sljedeći mjesec"
-
-#~ msgctxt "@option next week"
-#~ msgid "Next Week"
-#~ msgstr "Sljedeći tjedan"
-
-#~ msgctxt "@option tomorrow"
-#~ msgid "Tomorrow"
-#~ msgstr "Sutra"
-
-#~ msgctxt "@option today"
-#~ msgid "Today"
-#~ msgstr "Danas"
-
-#~ msgctxt "@option yesterday"
-#~ msgid "Yesterday"
-#~ msgstr "Jučer"
-
-#~ msgctxt "@option last week"
-#~ msgid "Last Week"
-#~ msgstr "Prošli tjedan"
-
-#~ msgctxt "@option last month"
-#~ msgid "Last Month"
-#~ msgstr "Prošli mjesec"
-
-#~ msgctxt "@option last year"
-#~ msgid "Last Year"
-#~ msgstr "Prošle godine"
-
-#~ msgctxt "@option do not specify a date"
-#~ msgid "No Date"
-#~ msgstr "Bez datuma"
-
-#~ msgctxt "@info"
-#~ msgid "The date you entered is invalid"
-#~ msgstr "Datum koji ste unijeli nije ispravan"
-
-#~ msgctxt "@info"
-#~ msgid "Date cannot be earlier than %1"
-#~ msgstr "Datum ne može biti raniji od %1"
-
-#~ msgctxt "@info"
-#~ msgid "Date cannot be later than %1"
-#~ msgstr "Datum ne može biti kasniji od %1"
-
-#~ msgctxt "UTC time zone"
-#~ msgid "UTC"
-#~ msgstr "UTC"
-
-#~ msgctxt "No specific time zone"
-#~ msgid "Floating"
-#~ msgstr "Lebdjenje"
-
-#~ msgctxt "@info"
-#~ msgid ""
-#~ "The entered date and time is before the minimum allowed date and time."
-#~ msgstr ""
-#~ "Unešen je datum i vrijeme manje od minimalno dozvoljenog datuma i vremena."
-
-#~ msgctxt "@info"
-#~ msgid ""
-#~ "The entered date and time is after the maximum allowed date and time."
-#~ msgstr ""
-#~ "Unešen je datum i vrijeme veće od maksimalno dozvoljenog datuma i vremena."
-
-#~ msgctxt "@info"
-#~ msgid "The time you entered is invalid"
-#~ msgstr "Unešeno vrijeme nije ispravno"
-
-#~ msgctxt "@info"
-#~ msgid "Time cannot be earlier than %1"
-#~ msgstr "Datum ne može biti raniji od %1"
-
-#~ msgctxt "@info"
-#~ msgid "Time cannot be later than %1"
-#~ msgstr "Datum ne može biti kasniji od %1"
-
-#~ msgid "Desktop %1"
-#~ msgstr "Radna površina %1"
-
-#~ msgid "Add to Toolbar"
-#~ msgstr "Dodaj na alatnu traku"
-
-#~ msgid "Configure Shortcut..."
-#~ msgstr "Podešavanje prečaca"
-
-#~ msgid "Toolbars Shown"
-#~ msgstr "Prikazane alatne trake"
-
-#~ msgid "No text"
-#~ msgstr "Nema teksta"
-
-#~ msgid "Overwrite File?"
-#~ msgstr "Prepisati datoteku?"
-
-#~ msgid "Builds Qt widget plugins from an ini style description file."
-#~ msgstr "Izrađuje Qt widget iz datoteke opisa stila \"ini\"."
-
-#~ msgid "Input file"
-#~ msgstr "Ulazna datoteka"
-
-#~ msgid "Output file"
-#~ msgstr "Izlazna datoteka"
-
-#~ msgid "Name of the plugin class to generate"
-#~ msgstr "Naziv klase dodatka koju je potrebno generirati"
-
-#~ msgid "Default widget group name to display in designer"
-#~ msgstr "Uobičajeni naziv grupe widgeta koja se prikazuje u dizajneru"
-
-#~ msgid "makekdewidgets"
-#~ msgstr "makekdewidgets"
-
-#~ msgid "(C) 2004-2005 Ian Reinhart Geiser"
-#~ msgstr "© 2004–2005 Ian Reinhart Geiser"
-
-#~ msgid "Ian Reinhart Geiser"
-#~ msgstr "Ian Reinhart Geiser"
-
-#~ msgid "Daniel Molkentin"
-#~ msgstr "Daniel Molkentin"
-
-#~ msgid "&Copy Text"
-#~ msgstr "&Kopiraj tekst"
-
-#~ msgid "Open '%1'"
-#~ msgstr "Otvori '%1'"
-
-#~ msgid "&Copy Email Address"
-#~ msgstr "&Kopiraj adresu e-pošte"
-
-#~ msgid "&Save Link As..."
-#~ msgstr "&Spremi vezu kao…"
-
-#~ msgid "&Copy Link Address"
-#~ msgstr "&Kopiraj adresu poveznice"
-
-#~ msgctxt "@title:menu HTML frame/iframe"
-#~ msgid "Frame"
-#~ msgstr "Okvir"
-
-#~ msgid "Open in New &Window"
-#~ msgstr "Otvori u novom &prozoru"
-
-#~ msgid "Open in &This Window"
-#~ msgstr "Otvori u &ovom prozoru"
-
-#~ msgid "Open in &New Tab"
-#~ msgstr "Otvori u novoj &kartici"
-
-#~ msgid "Reload Frame"
-#~ msgstr "Osvježi okvir"
-
-#~ msgid "Print Frame..."
-#~ msgstr "Ispiši okvir…"
-
-#~ msgid "Save &Frame As..."
-#~ msgstr "Spremi &okvir kao…"
-
-#~ msgid "View Frame Source"
-#~ msgstr "Prikaži izvorni kod okvira"
-
-#~ msgid "View Frame Information"
-#~ msgstr "Prikaži podatke o okviru"
-
-#~ msgid "Block IFrame..."
-#~ msgstr "Blokiraj IFrame…"
-
-#~ msgid "Save Image As..."
-#~ msgstr "Spremi sliku kao…"
-
-#~ msgid "Send Image..."
-#~ msgstr "Pošalji sliku…"
-
-#~ msgid "Copy Image"
-#~ msgstr "Kopiraj sliku"
-
-#~ msgid "Copy Image Location"
-#~ msgstr "Kopiraj lokaciju slike"
-
-#~ msgid "View Image (%1)"
-#~ msgstr "Prikaži sliku (%1)"
-
-#~ msgid "Block Image..."
-#~ msgstr "Blokiraj sliku…"
-
-#~ msgid "Block Images From %1"
-#~ msgstr "Blokiraj slike s %1"
-
-#~ msgid "Stop Animations"
-#~ msgstr "Zaustavi animacije"
-
-#~ msgid "Search for '%1' with %2"
-#~ msgstr "Zamijeni '%1' sa '%2'"
-
-#~ msgid "Search for '%1' with"
-#~ msgstr "Zamijeni '%1' sa"
-
-#~ msgid "Save Link As"
-#~ msgstr "Spremi vezu kao"
-
-#~ msgid "Save Image As"
-#~ msgstr "Spremi sliku kao"
-
-#~ msgid "Add URL to Filter"
-#~ msgstr "Dodaj URL u filter"
-
-#~ msgid "Enter the URL:"
-#~ msgstr "Unesi URL:"
-
-#~ msgid ""
-#~ "A file named \"%1\" already exists. Are you sure you want to overwrite it?"
-#~ msgstr ""
-#~ "Datoteka naziva \"%1\" već postoji. Jeste li sigurni da je želite "
-#~ "prepisati?"
-
-#~ msgid "Overwrite"
-#~ msgstr "Prepisati"
-
-#~ msgid "The Download Manager (%1) could not be found in your $PATH "
-#~ msgstr "Upravitelj preuzimanja (%1) nije pronađen u vašoj putanji $PATH."
-
-#~ msgid ""
-#~ "Try to reinstall it \n"
-#~ "\n"
-#~ "The integration with Konqueror will be disabled."
-#~ msgstr ""
-#~ "Pokušaj ponovo instalirati \n"
-#~ "\n"
-#~ "Integracija s Konquerorom bit će onemogućena."
-
-#~ msgid "Default Font Size (100%)"
-#~ msgstr "Uobičajena veličina pisma"
-
-#~ msgid "KHTML"
-#~ msgstr "KHTML"
-
-#~ msgid "Embeddable HTML component"
-#~ msgstr "Ugradiva HTML komponenta"
-
-#~ msgid "Lars Knoll"
-#~ msgstr "Lars Knoll"
-
-#~ msgid "Antti Koivisto"
-#~ msgstr "Antti Koivisto"
-
-#~ msgid "Dirk Mueller"
-#~ msgstr "Dirk Mueller"
-
-#~ msgid "Peter Kelly"
-#~ msgstr "Peter Kelly"
-
-#~ msgid "Torben Weis"
-#~ msgstr "Torben Weis"
-
-#~ msgid "Martin Jones"
-#~ msgstr "Martin Jones"
-
-#~ msgid "Simon Hausmann"
-#~ msgstr "Simon Hausmann"
-
-#~ msgid "Tobias Anton"
-#~ msgstr "Tobias Anton"
-
-#~ msgid ""
-#~ "'Print images'
If this checkbox is enabled, "
-#~ "images contained in the HTML page will be printed. Printing may take "
-#~ "longer and use more ink or toner.
If this checkbox is disabled, "
-#~ "only the text of the HTML page will be printed, without the included "
-#~ "images. Printing will be faster and use less ink or toner.
"
-#~ msgstr ""
-#~ "'Ispis slika'
ako je ovaj odabirni okvir "
-#~ "omogućen, ispisati će se slike sadržane na HTML stranici
Ako je "
-#~ "onemogućen, ispisati će se samo tekst, bez slika. Ispisivanje će ići brže "
-#~ "i potrošiti će se manje tinte ili tonera.
"
-
-#~ msgid ""
-#~ "'Print header'
If this checkbox is enabled, "
-#~ "the printout of the HTML document will contain a header line at the top "
-#~ "of each page. This header contains the current date, the location URL of "
-#~ "the printed page and the page number.
If this checkbox is disabled, "
-#~ "the printout of the HTML document will not contain such a header line."
-#~ "p>
"
-#~ msgstr ""
-#~ "'Ispis zaglavlja'
Ako je ova kućica "
-#~ "omogućena, ispis HTML dokumenta će sadržavati zaglavlje na vrhu svake "
-#~ "stranice. To zaglavlje sadrži trenutni datum, URL lokacije ispisane "
-#~ "stranice i redni broj stranice.
Ako je ova kućica onemogućena, "
-#~ "ispis HTML dokumenta neće sadržavati navedeno zaglavlje.
"
-
-#~ msgid ""
-#~ "'Printerfriendly mode'
If this checkbox is "
-#~ "enabled, the printout of the HTML document will be black and white only, "
-#~ "and all colored background will be converted into white. Printout will be "
-#~ "faster and use less ink or toner.
If this checkbox is disabled, the "
-#~ "printout of the HTML document will happen in the original color settings "
-#~ "as you see in your application. This may result in areas of full-page "
-#~ "color (or grayscale, if you use a black+white printer). Printout will "
-#~ "possibly happen more slowly and will probably use more toner or ink.
"
-#~ " "
-#~ msgstr ""
-#~ "'Način prijateljski pisaču'
Ako je ovaj "
-#~ "odabirni okvir omogućen, ispis HTML dokumenta bit će samo crno-bijeli, a "
-#~ "sve pozadine u boji pretvorit će se u bijele. Ispis će biti brži i "
-#~ "potrošiti će se manje tinte ili tonera.
Ako je onemogućen, ispis "
-#~ "HTML dokumenta bit će u originalnim bojama kao što ih vidite u vašoj "
-#~ "aplikaciji. Ovo može rezultirati područjima stranice potpuno prekrivenim "
-#~ "bojom (ili sivim tonovima ako koristite crno-bijeli pisač). Ispis će "
-#~ "vjerojatno biti sporiji i vjerojatno će se potrošit više tinte ili tonera."
-#~ "
"
-
-#~ msgid "HTML Settings"
-#~ msgstr "HTML postavke"
-
-#~ msgid "Printer friendly mode (black text, no background)"
-#~ msgstr "Prikaz prilagođen ispisu (crni tekst, bez pozadine)"
-
-#~ msgid "Print images"
-#~ msgstr "Ispiši slike"
-
-#~ msgid "Print header"
-#~ msgstr "Ispiši zaglavlje"
-
-#~ msgid "Save As"
-#~ msgstr "Spremi kao"
-
-#~ msgid "Inactive"
-#~ msgstr "Neaktivno"
-
-#~ msgid "%1 (%2 - %3x%4 Pixels)"
-#~ msgstr "%1 (%2 – %3x%4 piksela)"
-
-#~ msgid "%1 - %2x%3 Pixels"
-#~ msgstr "%1 – %2x%3 piksela"
-
-#~ msgid "%1 (%2x%3 Pixels)"
-#~ msgstr "%1 (%2x%3 piksela)"
-
-#~ msgid "Image - %1x%2 Pixels"
-#~ msgstr "Slika – %1x%2 piksela"
-
-#~ msgid "Done."
-#~ msgstr "Gotovo."
-
-#~ msgid "TestRegressionGui"
-#~ msgstr "TestRegressionGui"
-
-#~ msgid "GUI for the khtml regression tester"
-#~ msgstr "Grafičko sučelje za ispitivač regresije za KHTML"
-
-#~ msgid "URL to open"
-#~ msgstr "Otvoriti URL"
-
-#~ msgid "Testkhtml"
-#~ msgstr "Testkhtml"
-
-#~ msgid "a basic web browser using the KHTML library"
-#~ msgstr "osnovni pretraživač weba koji koristi biblioteku KHTML"
-
-#~ msgid "Accept"
-#~ msgstr "Prihvati"
-
-#~ msgid "Reject"
-#~ msgstr "Odbaci"
-
-#~ msgid "Filter error"
-#~ msgstr "Pogreška filtra"
-
-#~ msgid "Access Keys activated"
-#~ msgstr "Pristupne tipke su aktivirane"
-
-#~ msgid "Submit"
-#~ msgstr "Pošalji"
-
-#~ msgid "Directory containing tests, basedir and output directories."
-#~ msgstr ""
-#~ "Direktorij sadrži testove, osnovni direktorij i izlazne direktorije."
-
-#~ msgid "Do not suppress debug output"
-#~ msgstr "Prikaži debug izlaz"
-
-#~ msgid "Regenerate baseline (instead of checking)"
-#~ msgstr "Ponovno izgeneriraj osnovicu (umjesto provjeravanja)"
-
-#~ msgid "Do not show the window while running tests"
-#~ msgstr "Nemoj prikazati prozor za vrijeme testova"
-
-#~ msgid "Only run a single test. Multiple options allowed."
-#~ msgstr "Izvrši samo jedan test. Višestruke opcije su dozvoljene."
-
-#~ msgid "Only run .js tests"
-#~ msgstr "Izvrši samo testove s .js"
-
-#~ msgid "Only run .html tests"
-#~ msgstr "Izvrši samo testove s .html"
-
-#~ msgid "Put output in <directory> instead of <base_dir>/output"
-#~ msgstr "Stavite izlaz u <directory> umjesto u <base_dir>/output"
-
-#~ msgid ""
-#~ "Use <directory> as reference instead of <base_dir>/baseline"
-#~ msgstr ""
-#~ "Koristite <directory> kao referencu umjesto <base_dir>/"
-#~ "baseline"
-
-#~ msgid ""
-#~ "Directory containing tests, basedir and output directories. Only regarded "
-#~ "if -b is not specified."
-#~ msgstr ""
-#~ "Direktorij koji sadrži testove, osnovicu i direktorije izlaza. Uzet u "
-#~ "obzir ako -b nije naveden."
-
-#~ msgid ""
-#~ "Relative path to testcase, or directory of testcases to be run "
-#~ "(equivalent to -t)."
-#~ msgstr ""
-#~ "Relativna putanja do testnih slučajeva, ili direktorija koji sadrži "
-#~ "testne slučajeve koji trebaju biti pokrenuti (ekvivalent -t)."
-
-#~ msgid "TestRegression"
-#~ msgstr "TestRegression"
-
-#~ msgid "Regression tester for khtml"
-#~ msgstr "Ispitivač regresije za KHTML."
-
-#~ msgid "Available Tests: 0"
-#~ msgstr "Raspoloživih testova: 0"
-
-#~ msgid "Please choose a valid 'khtmltests/regression/' directory."
-#~ msgstr "Molim vas, izaberite valjan 'khtmltests/regression/' direktorij."
-
-#~ msgid "Please choose a valid 'khtml/' build directory."
-#~ msgstr "Molim vas, izaberite valjan 'khtml/' direktorij za izgradnju."
-
-#~ msgid "Available Tests: %1 (ignored: %2)"
-#~ msgstr "Dostupni testovi: %1 (ignorirano: %2)"
-
-#~ msgid "Continue"
-#~ msgstr "Nastavi"
-
-#~ msgid "Cannot find testregression executable."
-#~ msgstr "Nije moguće pronaći izvršni testregression."
-
-#~ msgid "Run test..."
-#~ msgstr "Pokreni test…"
-
-#~ msgid "Add to ignores..."
-#~ msgstr "Dodaj u zanemareno…"
-
-#~ msgid "Remove from ignores..."
-#~ msgstr "Ukloni iz ignoriranih…"
-
-#~ msgid "View Do&cument Source"
-#~ msgstr "&Prikaži izvorni kod dokumenta"
-
-#~ msgid "View Document Information"
-#~ msgstr "Prikaz informacija o dokumentu"
-
-#~ msgid "Save &Background Image As..."
-#~ msgstr "Spremi &pozadinsku sliku kao…"
-
-#~ msgid "SSL"
-#~ msgstr "SSL"
-
-#~ msgid "Print Rendering Tree to STDOUT"
-#~ msgstr "Ispiši stablo iscrtavanja na standardni izlaz"
-
-#~ msgid "Print DOM Tree to STDOUT"
-#~ msgstr "Ispiši DOM stablo na standardni izlaz "
-
-#~ msgid "Print frame tree to STDOUT"
-#~ msgstr "Ispiši stablo ovkira na standardni izlaz"
-
-#~ msgid "Stop Animated Images"
-#~ msgstr "Zaustavi animirane slike"
-
-#~ msgid "Set &Encoding"
-#~ msgstr "Postavi &kodiranje"
-
-#~ msgid "Use S&tylesheet"
-#~ msgstr "&Upotrebljavaj stilske listove"
-
-#~ msgid "Enlarge Font"
-#~ msgstr "Povećaj pismo"
-
-#~ msgid ""
-#~ "Enlarge Font Make the font in this window bigger. Click "
-#~ "and hold down the mouse button for a menu with all available font sizes."
-#~ "qt>"
-#~ msgstr ""
-#~ "Povećaj pismo Povećajte pismo u ovom prozoru. Kliknite i "
-#~ "držite pritisnutim gumb miša za prikaz izbornika sa svim dostupnim "
-#~ "veličinama pisma. "
-
-#~ msgid "Shrink Font"
-#~ msgstr "Skupi pismo"
-
-#~ msgid ""
-#~ "Shrink Font Make the font in this window smaller. Click "
-#~ "and hold down the mouse button for a menu with all available font sizes."
-#~ "qt>"
-#~ msgstr ""
-#~ "Stisni pismo Učini pismo ovog prozora manjim. Kliknite i "
-#~ "držite pritisnutim gumb miša za prikaz izbornika sa svim dostupnim "
-#~ "veličinama pisama. "
-
-#~ msgid ""
-#~ "Find text Shows a dialog that allows you to find text on "
-#~ "the displayed page. "
-#~ msgstr ""
-#~ "Nađi tekst Prikaži dijalog koji vam omogućuje traženje "
-#~ "teksta na prikazanoj stranici. "
-
-#~ msgid ""
-#~ "Find next Find the next occurrence of the text that you "
-#~ "have found using the Find Text function. "
-#~ msgstr ""
-#~ "Traži sljedeće Traženje sljedećeg pojavljivanja teksta "
-#~ "koji je pronađen funkcijom Pronađi tekst . "
-
-#~ msgid ""
-#~ "Find previous Find the previous occurrence of the text "
-#~ "that you have found using the Find Text function. "
-#~ msgstr ""
-#~ "Traži prethodni Traženje prethodnog pojavljivanja teksta "
-#~ "koji je pronađen funkcijom Pronađi tekst . "
-
-#~ msgid "Find Text as You Type"
-#~ msgstr "Pronađi tekst kako pišeš"
-
-#~ msgid ""
-#~ "This shortcut shows the find bar, for finding text in the displayed page. "
-#~ "It cancels the effect of \"Find Links as You Type\", which sets the "
-#~ "\"Find links only\" option."
-#~ msgstr ""
-#~ "Prečac prikazuje traku za pretraživanje teksta u prikazanoj stranici. "
-#~ "Prekida učinak \"Traži linkove kako pišete\" te postavlja opciju \"Traži "
-#~ "samo linkove\"."
-
-#~ msgid "Find Links as You Type"
-#~ msgstr "Traži linkove kako pišete"
-
-#~ msgid ""
-#~ "This shortcut shows the find bar, and sets the option \"Find links only\"."
-#~ msgstr ""
-#~ "Ovaj prečac prikazuje samo traku za pretraživanje i postavlja opciju "
-#~ "\"Traži samo linkove\"."
-
-#~ msgid ""
-#~ "Print Frame Some pages have several frames. To print only "
-#~ "a single frame, click on it and then use this function. "
-#~ msgstr ""
-#~ "Okvir ispisa Neke stranice imaju više okvira. Da biste "
-#~ "ispisali pojedini okvir, kliknite na njega i zatim iskoristite ovu "
-#~ "funkciju. "
-
-#~ msgid "Toggle Caret Mode"
-#~ msgstr "Uključi/isključi pokazivač unosa"
-
-#~ msgid "The fake user-agent '%1' is in use."
-#~ msgstr "Lažni korisnički agent '%1' se koristi."
-
-#~ msgid "This web page contains coding errors."
-#~ msgstr "Ova web-stranica sadrži pogreške u kodiranju."
-
-#~ msgid "&Hide Errors"
-#~ msgstr "&Sakrij pogreške"
-
-#~ msgid "&Disable Error Reporting"
-#~ msgstr "&Onemogući prijavljivanje pogrešaka"
-
-#~ msgid "Error : %1: %2 "
-#~ msgstr "Greška : %1: %2 "
-
-#~ msgid "Error : node %1: %2 "
-#~ msgstr "Greška : čvor %1: %2 "
-
-#~ msgid "Display Images on Page"
-#~ msgstr "Prikaži slike na stranici"
-
-#~ msgid "Error: %1 - %2"
-#~ msgstr "Pogreška: %1 – %2"
-
-#~ msgid "The requested operation could not be completed"
-#~ msgstr "Zahtjevanu operaciju nije moguće dovršiti"
-
-#~ msgid "Technical Reason: "
-#~ msgstr "Tehnički razlog: "
-
-#~ msgid "Details of the Request:"
-#~ msgstr "Detalji zahtjeva:"
-
-#~ msgid "URL: %1"
-#~ msgstr "URL: %1"
-
-#~ msgid "Protocol: %1"
-#~ msgstr "Protokol: %1"
-
-#~ msgid "Date and Time: %1"
-#~ msgstr "Datum i vrijeme: %1"
-
-#~ msgid "Additional Information: %1"
-#~ msgstr "Dodatni podaci: %1"
-
-#~ msgid "Possible Causes:"
-#~ msgstr "Mogući uzroci:"
-
-#~ msgid "Possible Solutions:"
-#~ msgstr "Moguća rješenja:"
-
-#~ msgid "Page loaded."
-#~ msgstr "Stranica je učitana."
-
-#~ msgid "%1 Image of %2 loaded."
-#~ msgid_plural "%1 Images of %2 loaded."
-#~ msgstr[0] "%1 slika od %2 učitana."
-#~ msgstr[1] "%1 slike od %2 učitane."
-#~ msgstr[2] "%1 slika od %2 učitanih."
-
-#~ msgid "Automatic Detection"
-#~ msgstr "Automatski odabir"
-
-#~ msgid " (In new window)"
-#~ msgstr " (U novom prozoru)"
-
-#~ msgid "Symbolic Link"
-#~ msgstr "Simbolička veza"
-
-#~ msgid "%1 (Link)"
-#~ msgstr "%1 (veza)"
-
-#~ msgid "%2 (%1 byte)"
-#~ msgid_plural "%2 (%1 bytes)"
-#~ msgstr[0] "%2 (%1 bajt)"
-#~ msgstr[1] "%2 (%1 bajta)"
-#~ msgstr[2] "%2 (%1 bajtova)"
-
-#~ msgid "%2 (%1 K)"
-#~ msgstr "%2 (%1 kB)"
-
-#~ msgid " (In other frame)"
-#~ msgstr " (U drugom okviru)"
-
-#~ msgid "Email to: "
-#~ msgstr "E-pošta za:"
-
-#~ msgid " - Subject: "
-#~ msgstr " – predmet : "
-
-#~ msgid " - CC: "
-#~ msgstr " – kopija: "
-
-#~ msgid " - BCC: "
-#~ msgstr " – skrivena kopija: "
-
-#~ msgid ""
-#~ "This untrusted page links to%1 . Do you want to "
-#~ "follow the link? "
-#~ msgstr ""
-#~ "Ova nepovjerljiva stranica se povezuje na %1 . Želite li slijediti poveznicu? "
-
-#~ msgid "Follow"
-#~ msgstr "Slijedi"
-
-#~ msgid "Frame Information"
-#~ msgstr "Podaci okvira"
-
-#~ msgid " [Properties] "
-#~ msgstr " [Svojstva] "
-
-#~ msgctxt "HTML rendering mode (see http://en.wikipedia.org/wiki/Quirks_mode)"
-#~ msgid "Quirks"
-#~ msgstr "Quirks"
-
-#~ msgctxt "HTML rendering mode (see http://en.wikipedia.org/wiki/Quirks_mode)"
-#~ msgid "Almost standards"
-#~ msgstr "Gotovo standardi"
-
-#~ msgctxt "HTML rendering mode (see http://en.wikipedia.org/wiki/Quirks_mode)"
-#~ msgid "Strict"
-#~ msgstr "Strogi"
-
-#~ msgid "Save Background Image As"
-#~ msgstr "Spremi pozadinsku sliku kao"
-
-#~ msgid "The peer SSL certificate chain appears to be corrupt."
-#~ msgstr "Čini se da je ogranak certifikacijskog lanca SSL-a pokvaren."
-
-#~ msgid "Save Frame As"
-#~ msgstr "Spremi okvir kao"
-
-#~ msgid "&Find in Frame..."
-#~ msgstr "Traži unutar &okvira…"
-
-#~ msgid "&Find..."
-#~ msgstr "&Traži…"
-
-#~ msgid ""
-#~ "Warning: This is a secure form but it is attempting to send your data "
-#~ "back unencrypted.\n"
-#~ "A third party may be able to intercept and view this information.\n"
-#~ "Are you sure you wish to continue?"
-#~ msgstr ""
-#~ "Upozorenje: Ovo je osiguran obrazac, ali vaše podatke pokušava vratiti u "
-#~ "nezaštićenom obliku.\n"
-#~ "Treća osoba može presresti i pročitati ovakve podatke.\n"
-#~ "Jeste li sigurni da želite li nastaviti?"
-
-#~ msgid "Network Transmission"
-#~ msgstr "Mrežno odašiljanje"
-
-#~ msgid "&Send Unencrypted"
-#~ msgstr "&Šalji nezaštičeno"
-
-#~ msgid ""
-#~ "Warning: Your data is about to be transmitted across the network "
-#~ "unencrypted.\n"
-#~ "Are you sure you wish to continue?"
-#~ msgstr ""
-#~ "Upozorenje. Vaši će podaci biti poslani preko mreže u nezaštićenom "
-#~ "obliku.\n"
-#~ "Jeste li sigurni da želite li nastaviti?"
-
-#~ msgid ""
-#~ "This site is attempting to submit form data via email.\n"
-#~ "Do you want to continue?"
-#~ msgstr ""
-#~ "Ova stranica pokušava poslati podatke obrasca putem e-pošte.\n"
-#~ "Želite li nastaviti?"
-
-#~ msgid "&Send Email"
-#~ msgstr "%Pošalji e-poštu"
-
-#~ msgid ""
-#~ "The form will be submitted to %1 on your local "
-#~ "filesystem. Do you want to submit the form? "
-#~ msgstr ""
-#~ "Forma će biti poslana na %1 u vaš lokalni datotečni "
-#~ "sustav. Želite li poslati formu? "
-
-#~ msgid ""
-#~ "This site attempted to attach a file from your computer in the form "
-#~ "submission. The attachment was removed for your protection."
-#~ msgstr ""
-#~ "Ova je lokacija pokušala pridodati datoteku s vašeg računala i poslati ju "
-#~ "uz obrazac. Privitak je uklonjen radi vaše zaštite."
-
-#~ msgid "(%1/s)"
-#~ msgstr "(%1/s)"
-
-#~ msgid "Security Warning"
-#~ msgstr "Sigurnosno upozorenje"
-
-#~ msgid "Access by untrusted page to%1 denied. "
-#~ msgstr ""
-#~ "Pristup nepovjerljive stranice do %1 zabranjen."
-#~ "qt>"
-
-#~ msgid "Security Alert"
-#~ msgstr "Sigurnosna uzbuna"
-
-#~ msgid "The wallet '%1' is open and being used for form data and passwords."
-#~ msgstr ""
-#~ "Lisnica '%1' je otvorena i upotrebljava se za podatke obrazaca i zaporki."
-
-#~ msgid "&Close Wallet"
-#~ msgstr "&Zatvori lisnicu"
-
-#~ msgid "&Allow storing passwords for this site"
-#~ msgstr "&Dozvoli spremanje zaporki za ovu stranicu"
-
-#~ msgid "Remove password for form %1"
-#~ msgstr "Makni lozinku za formu %1"
-
-#~ msgid "JavaScript &Debugger"
-#~ msgstr "JavaScript uklanjanje &nedostataka"
-
-#~ msgid "This page was prevented from opening a new window via JavaScript."
-#~ msgstr "Ova stranica pokušava otvoriti novi prozor pomoću JavaScript-a."
-
-#~ msgid "Popup Window Blocked"
-#~ msgstr "Popup prozor blokiran"
-
-#~ msgid ""
-#~ "This page has attempted to open a popup window but was blocked.\n"
-#~ "You can click on this icon in the status bar to control this behavior\n"
-#~ "or to open the popup."
-#~ msgstr ""
-#~ "Ova stranica je pokušala otvoriti skočni prozor koji je blokiran.\n"
-#~ "Možete klinuti na ovu ikonicu u statusnoj traci da bi upravljali ovim\n"
-#~ "ponašanjem ili otvorili skočni prozor."
-
-#~ msgid "&Show Blocked Popup Window"
-#~ msgid_plural "&Show %1 Blocked Popup Windows"
-#~ msgstr[0] "&Pokaži %1 blokirani popup prozor"
-#~ msgstr[1] "&Pokaži %1 blokirana popup prozora"
-#~ msgstr[2] "&Pokaži %1 blokiranih popup prozora"
-
-#~ msgid "Show Blocked Window Passive Popup &Notification"
-#~ msgstr "Pokaži blokiranu pasivnu popup &obavijest"
-
-#~ msgid "&Configure JavaScript New Window Policies..."
-#~ msgstr "&Podesi politiku JavaScripte za otvaranje novih prozora"
-
-#~ msgid ""
-#~ "A script on this page is causing KHTML to freeze. If it continues to run, "
-#~ "other applications may become less responsive.\n"
-#~ "Do you want to stop the script?"
-#~ msgstr ""
-#~ "Skripta na ovoj stranici uzrokuje zamrzavanje KHTML-a. Ako se nastavi "
-#~ "izvršavati ostale bi aplikacije mogle slabije reagirati.\n"
-#~ "Želite li odustati od izvršenja skripte?"
-
-#~ msgid "JavaScript"
-#~ msgstr "JavaScript"
-
-#~ msgid "&Stop Script"
-#~ msgstr "Zau&stavi skriptu"
-
-#~ msgid "Confirmation: JavaScript Popup"
-#~ msgstr "Potvrda: JavaScript skočni prozor"
-
-#~ msgid ""
-#~ "This site is submitting a form which will open up a new browser window "
-#~ "via JavaScript.\n"
-#~ "Do you want to allow the form to be submitted?"
-#~ msgstr ""
-#~ "Ova web lokacija šalje obrazac koji će otvoriti novi prozor putem "
-#~ "JavaScripta.\n"
-#~ "Želite li dopustiti slanje obrasca?"
-
-#~ msgid ""
-#~ "This site is submitting a form which will open %1
in a new "
-#~ "browser window via JavaScript. Do you want to allow the form to be "
-#~ "submitted? "
-#~ msgstr ""
-#~ "Ova stranica šalje formu koja će otvoriti %1
u novom prozoru "
-#~ "preglednika pomoću JavaScripta. Želite li dozvoliti slanje forme?"
-#~ "qt>"
-
-#~ msgid "Allow"
-#~ msgstr "Dopustiti"
-
-#~ msgid "Do Not Allow"
-#~ msgstr "Nemoj dopustiti"
-
-#~ msgid ""
-#~ "This site is requesting to open up a new browser window via JavaScript.\n"
-#~ "Do you want to allow this?"
-#~ msgstr ""
-#~ "Ova stranica pokušava otvoriti novi prozor pomoću JavaScript-a.\n"
-#~ "Želite li to dopustiti?"
-
-#~ msgid ""
-#~ "This site is requesting to open%1
in a new browser window via "
-#~ "JavaScript. Do you want to allow this? "
-#~ msgstr ""
-#~ "Ova se stranica želi otvoriti%1
u novom prozoru preglednika "
-#~ "preko JavaScript-a. Želite li to dozvoliti? "
-
-#~ msgid "Close window?"
-#~ msgstr "Zatvoriti prozor?"
-
-#~ msgid "Confirmation Required"
-#~ msgstr "Potrebna je potvrda"
-
-#~ msgid ""
-#~ "Do you want a bookmark pointing to the location \"%1\" to be added to "
-#~ "your collection?"
-#~ msgstr ""
-#~ "Želite li u vašu zbirku dodati oznaku koja pokazuje prema lokaciju \"%1\"?"
-
-#~ msgid ""
-#~ "Do you want a bookmark pointing to the location \"%1\" titled \"%2\" to "
-#~ "be added to your collection?"
-#~ msgstr ""
-#~ "Želite li u vašu zbirku dodati oznaku naziva \"%2\", a koja pokazuje "
-#~ "prema lokaciju \"%1\"?"
-
-#~ msgid "JavaScript Attempted Bookmark Insert"
-#~ msgstr "JavaScript je pokušao umetnuti oznaku"
-
-#~ msgid "Insert"
-#~ msgstr "Umetni"
-
-#~ msgid "Disallow"
-#~ msgstr "Ne dopuštaj"
-
-#~ msgid "Console"
-#~ msgstr "Konzola"
-
-#~ msgid "Enter"
-#~ msgstr "Ulaz"
-
-#~ msgid ""
-#~ "Unable to find the Kate editor component;\n"
-#~ "please check your KDE installation."
-#~ msgstr ""
-#~ "Nije moguće pronaći komponentu Kate editora;\n"
-#~ "molim provjerite vašu instalaciju KDE-a."
-
-#~ msgid "Breakpoint"
-#~ msgstr "Prekidna točka"
-
-#~ msgid "JavaScript Debugger"
-#~ msgstr "JavaScript uklanjanje nedostataka"
-
-#~ msgid "&Break at Next Statement"
-#~ msgstr "&Prekini kod slijedećeg izraza"
-
-#~ msgid "Break at Next"
-#~ msgstr "Prekini kod slijedećeg izraza"
-
-#~ msgid "Step Over"
-#~ msgstr "Korak preko"
-
-#~ msgid "Step Into"
-#~ msgstr "Korak u"
-
-#~ msgid "Step Out"
-#~ msgstr "Korak iz"
-
-#~ msgid "Reindent Sources"
-#~ msgstr "Ponovna identifikacija izvora"
-
-#~ msgid "Report Exceptions"
-#~ msgstr "Prijavi izuzetke"
-
-#~ msgid "&Debug"
-#~ msgstr "&Debugiraj"
-
-#~ msgid "Close source"
-#~ msgstr "Zatvori izvor"
-
-#~ msgid "Ready"
-#~ msgstr "Spreman"
-
-#~ msgid "Parse error at %1 line %2"
-#~ msgstr "Pogreška raščlanjivanja u %1, redak %2"
-
-#~ msgid ""
-#~ "An error occurred while attempting to run a script on this page.\n"
-#~ "\n"
-#~ "%1 line %2:\n"
-#~ "%3"
-#~ msgstr ""
-#~ "Tijekom pokušaja pokretanja skripte na ovoj stranici došlo je do "
-#~ "pogreške.\n"
-#~ "\n"
-#~ "%1, redak %2:\n"
-#~ "%3"
-
-#~ msgid ""
-#~ "Do not know where to evaluate the expression. Please pause a script or "
-#~ "open a source file."
-#~ msgstr ""
-#~ "Ne znam gdje evaluirati izraz. Molim zaustavite skriptu ili otvorite "
-#~ "datoteku izvornog koda."
-
-#~ msgid "Evaluation threw an exception %1"
-#~ msgstr "Evaluacija je izbacila iznimku %1."
-
-#~ msgid "JavaScript Error"
-#~ msgstr "JavaScript pogreška"
-
-#~ msgid "&Do not show this message again"
-#~ msgstr "Ne prikazuj ponovno &ovu poruku"
-
-#~ msgid "Local Variables"
-#~ msgstr "Lokalne varijable"
-
-#~ msgid "Reference"
-#~ msgstr "Reference"
-
-#~ msgid "Loaded Scripts"
-#~ msgstr "Učitane skripte"
-
-#~ msgid "Call Stack"
-#~ msgstr "Stog poziva"
-
-#~ msgid "Call"
-#~ msgstr "Poziv"
-
-#~ msgid "Line"
-#~ msgstr "Linija"
-
-#~ msgid ""
-#~ "No plugin found for '%1'.\n"
-#~ "Do you want to download one from %2?"
-#~ msgstr ""
-#~ "Dodatak za '%1' nije pronađen.\n"
-#~ "Želite li preuzeti jedan s adrese %2?"
-
-#~ msgid "Missing Plugin"
-#~ msgstr "Nedostaje dodatak"
-
-#~ msgid "Download"
-#~ msgstr "Preuzmi"
-
-#~ msgid "Do Not Download"
-#~ msgstr "Nemoj preuzeti"
-
-#~ msgid "This is a searchable index. Enter search keywords: "
-#~ msgstr "Ovo kazalo je pretraživo. Za pretraživanje unesite ključne riječi: "
-
-#~ msgid ""
-#~ "The following files will not be uploaded because they could not be "
-#~ "found.\n"
-#~ "Do you want to continue?"
-#~ msgstr ""
-#~ "Sljedeće datoteke neće biti poslane zato što ne mogu biti pronađene.\n"
-#~ "Želite li nastaviti?"
-
-#~ msgid "Submit Confirmation"
-#~ msgstr "Prihvati potvdu"
-
-#~ msgid "&Submit Anyway"
-#~ msgstr "&Svakako prihvati"
-
-#~ msgid ""
-#~ "You are about to transfer the following files from your local computer to "
-#~ "the Internet.\n"
-#~ "Do you really want to continue?"
-#~ msgstr ""
-#~ "Sljedeće datoteke prenijet ćete sa svojeg računala na Internet.\n"
-#~ "Želite li zaista nastaviti?"
-
-#~ msgid "Send Confirmation"
-#~ msgstr "Pošalji potvrdu"
-
-#~ msgid "&Send File"
-#~ msgid_plural "&Send Files"
-#~ msgstr[0] "&Pošalji datoteku"
-#~ msgstr[1] "&Pošalji datoteke"
-#~ msgstr[2] "&Pošalji datoteke"
-
-#~ msgid "Key Generator"
-#~ msgstr "Generator tipke"
-
-#~ msgid "Initializing Applet \"%1\"..."
-#~ msgstr "Inicijalizacija apleta \"%1\"…"
-
-#~ msgid "Starting Applet \"%1\"..."
-#~ msgstr "Pokretanje apleta \"%1\"…"
-
-#~ msgid "Applet \"%1\" started"
-#~ msgstr "Aplet \"%1\" je pokrenut"
-
-#~ msgid "Applet \"%1\" stopped"
-#~ msgstr "Aplet \"%1\" je zaustavljen"
-
-#~ msgid "Loading Applet"
-#~ msgstr "Učitavanje apleta"
-
-#~ msgid "Error: java executable not found"
-#~ msgstr "Pogreška: izvršna java datoteka nije pronađena"
-
-#~ msgid "Signed by (validation: %1)"
-#~ msgstr "Potpisao (potvrda valjanosti: %1)"
-
-#~ msgid "Certificate (validation: %1)"
-#~ msgstr "Certifikat (provjera: %1)"
-
-#~ msgid "Do you grant Java applet with certificate(s):"
-#~ msgstr "Želite li dati Java-appletu certifikat(e):"
-
-#~ msgid "the following permission"
-#~ msgstr "sljedeća dopuštenja"
-
-#~ msgid "&Reject All"
-#~ msgstr "&Odbaci sve"
-
-#~ msgid "&Grant All"
-#~ msgstr "&Dopusti sve"
-
-#~ msgid "Applet Parameters"
-#~ msgstr "Parametri apleta"
-
-#~ msgid "Parameter"
-#~ msgstr "Parametar"
-
-#~ msgid "Class"
-#~ msgstr "Klasa"
-
-#~ msgid "Base URL"
-#~ msgstr "Osnovni URL"
-
-#~ msgid "Archives"
-#~ msgstr "Arhive"
-
-#~ msgid "KDE Java Applet Plugin"
-#~ msgstr "KDE dodatak Java apleta"
-
-#~ msgid "KMultiPart"
-#~ msgstr "KMultiPart"
-
-#~ msgid "Embeddable component for multipart/mixed"
-#~ msgstr "Ugradiva komponenta za multipart/mixed"
-
-#~ msgid "Copyright 2001-2011, David Faure faure@kde.org "
-#~ msgstr "Copyright 2001. – 2011., David Faure faure@kde.org "
-
-#~ msgid "No handler found for %1."
-#~ msgstr "Rukovatelj za %1 nije pronađen."
-
-#~ msgid "Play"
-#~ msgstr "Reproduciraj"
-
-#~ msgid "New Web Shortcut"
-#~ msgstr "Nova Web prečica"
-
-#~ msgid "%1 is already assigned to %2"
-#~ msgstr "%1 je već dodijeljen %2"
-
-#~ msgid "Search &provider name:"
-#~ msgstr "Traži naziv &pružatelja usluga:"
-
-#~ msgid "New search provider"
-#~ msgstr "Nova pretraga za pružateljem usluga"
-
-#~ msgid "UR&I shortcuts:"
-#~ msgstr "UR&I prečice:"
-
-#~ msgid "Create Web Shortcut"
-#~ msgstr "Stvori web prečicu"
-
-#~ msgid "Find &links only"
-#~ msgstr "Traži samo &linkove"
-
-#~ msgid "Not found"
-#~ msgstr "Nije nađeno"
-
-#~ msgid "No more matches for this search direction."
-#~ msgstr "Nema više podudarnosti za ovaj smjer pretrage."
-
-#~ msgid "Do you want to store this password for %1?"
-#~ msgstr "Želite li pohraniti ovu zaporku od %1?"
-
-#~ msgid "the document is not in the correct file format"
-#~ msgstr "dokument nije u ispravnom datotečnom obliku"
-
-#~ msgid "fatal parsing error: %1 in line %2, column %3"
-#~ msgstr "ozbiljna pogreška raščlanjivanja: %1 u retku %2, stupac %3"
-
-#~ msgid "XML parsing error"
-#~ msgstr "XML pogreška raščlanjivanja"
-
-#~ msgid "Basic Page Style"
-#~ msgstr "Osnovni stil stranice"
-
-#~ msgid ""
-#~ "Unable to start new process.\n"
-#~ "The system may have reached the maximum number of open files possible or "
-#~ "the maximum number of open files that you are allowed to use has been "
-#~ "reached."
-#~ msgstr ""
-#~ "Nemoguće pokrenuti novi proces.\n"
-#~ "Možda je sustav dosegnuo maksimalni broj mogućih otvorenih datoteka ili "
-#~ "je dosegnut maksimalni dozvoljen broj otvorenih datoteka."
-
-#~ msgid ""
-#~ "Unable to create new process.\n"
-#~ "The system may have reached the maximum number of processes possible or "
-#~ "the maximum number of processes that you are allowed to use has been "
-#~ "reached."
-#~ msgstr ""
-#~ "Nemoguće stvoriti novi proces.\n"
-#~ "Možda je sustav dosegnuo maksimalan broj mogućih procesa ili je dosegnut "
-#~ "maksimalan dozvoljen broj procesa."
-
-#~ msgid "Could not find '%1' executable."
-#~ msgstr "Nije moguće pronaći izvršnu datoteku '%1'."
-
-#~ msgid ""
-#~ "Could not open library '%1'.\n"
-#~ "%2"
-#~ msgstr ""
-#~ "Nije moguće otvoriti biblioteku '%1'.\n"
-#~ "%2"
-
-#~ msgid ""
-#~ "Could not find 'kdemain' in '%1'.\n"
-#~ "%2"
-#~ msgstr ""
-#~ "Nije moguće pronaći 'kdemain' unutar '%1'.\n"
-#~ "%2"
-
-#~ msgid ""
-#~ "klauncher: This program is not supposed to be started manually.\n"
-#~ "klauncher: It is started automatically by kdeinit4.\n"
-#~ msgstr ""
-#~ "klauncher: Ovaj program nije predviđen za ručno pokretanje.\n"
-#~ "klauncher: Njega automatski pokreće program kdeinit4.\n"
-
-#~ msgid "KDEInit could not launch '%1'."
-#~ msgstr "KDEInit ne može pokrenuti '%1'"
-
-#~ msgid "Could not find service '%1'."
-#~ msgstr "Nije moguće pronaći uslugu '%1'."
-
-#~ msgid "Service '%1' must be executable to run."
-#~ msgstr "Usluga '%1' mora biti izvršnog tipa da bi se pokrenula."
-
-#~ msgid "Service '%1' is malformatted."
-#~ msgstr "Usluga '%1' nije pravilno oblikovana."
-
-#~ msgid "Launching %1"
-#~ msgstr "Pokretanje %1"
-
-#~ msgid "Unknown protocol '%1'.\n"
-#~ msgstr "Nepoznati protokol '%1'.\n"
-
-#~ msgid "Error loading '%1'.\n"
-#~ msgstr "Pogreška tijekom učitavanja '%1'.\n"
-
-#~ msgid "Evaluation error"
-#~ msgstr "Pogreška pri ispitivanju"
-
-#~ msgid "Range error"
-#~ msgstr "Pogreška raspona"
-
-#~ msgid "Reference error"
-#~ msgstr "Pogreška reference"
-
-#~ msgid "Syntax error"
-#~ msgstr "Pogreška sintakse"
-
-#~ msgid "Type error"
-#~ msgstr "Pogreška vrste"
-
-#~ msgid "URI error"
-#~ msgstr "URI pogreška"
-
-#~ msgid "KJSCmd"
-#~ msgstr "KJSCmd"
-
-#~ msgid "Utility for running KJSEmbed scripts \n"
-#~ msgstr "Alat za pokretanje KJSEmbed skripti \n"
-
-#~ msgid "(C) 2005-2006 The KJSEmbed Authors"
-#~ msgstr "© 2005–2006 The KJSEmbed Authors"
-
-#~ msgid "Execute script without gui support"
-#~ msgstr "Izvrši skriptu bez grafičke potpore"
-
-#~ msgid "start interactive kjs interpreter"
-#~ msgstr "pokreni interaktivni kjs tumač"
-
-#~ msgid "start without KDE KApplication support."
-#~ msgstr "pokreni bez podrške za KDE KApplication."
-
-#~ msgid "Script to execute"
-#~ msgstr "Skripta za izvršavanje"
-
-#~ msgid "Error encountered while processing include '%1' line %2: %3"
-#~ msgstr "Došlo je do greške prilikom obrade priključka '%1' na liniji %2: %3"
-
-#~ msgid "include only takes 1 argument, not %1."
-#~ msgstr "uključak treba samo 1 argument, a ne %1"
-
-#~ msgid "File %1 not found."
-#~ msgstr "Datoteka %1 nije pronađena."
-
-#~ msgid "library only takes 1 argument, not %1."
-#~ msgstr "biblioteka treba samo 1 argument, a ne %1"
-
-#~ msgid "Alert"
-#~ msgstr "Uzbuna"
-
-#~ msgid "Confirm"
-#~ msgstr "Prihvati"
-
-#~ msgid "Bad event handler: Object %1 Identifier %2 Method %3 Type: %4."
-#~ msgstr "Loš hvatač događaja: Objekt %1 Identifikator %2 Metoda %3 Tip: %4"
-
-#~ msgid "Exception calling '%1' function from %2:%3:%4"
-#~ msgstr "Iznimka pri pozivu funkcije '%1' iz %2:%3:%4"
-
-#~ msgid "Could not open file '%1'"
-#~ msgstr "Nije moguće otvoriti datoteku '%1'"
-
-#~ msgid "Could not create temporary file."
-#~ msgstr "Nije moguće stvoriti privremenu datoteku."
-
-#~ msgid "%1 is not a function and cannot be called."
-#~ msgstr "%1 nije funkcija te ne može biti pozvana."
-
-#~ msgid "Action takes 2 args."
-#~ msgstr "Radnja zahtjeva 2 argumenta."
-
-#~ msgid "ActionGroup takes 2 args."
-#~ msgstr "ActionGroup uzima 2 argumenta."
-
-#~ msgid "Must supply a valid parent."
-#~ msgstr "Navedite ispravnog roditelja."
-
-#~ msgid "There was an error reading the file '%1'"
-#~ msgstr "Dogodila se pogreška prilikom čitanja datoteke '%1'"
-
-#~ msgid "Could not read file '%1'"
-#~ msgstr "Nije moguće pročitati datoteku '%1'"
-
-#~ msgid "Must supply a filename."
-#~ msgstr "Navedite naziv datoteke."
-
-#~ msgid "'%1' is not a valid QLayout."
-#~ msgstr "'%1' nije valjani QLayout."
-
-#~ msgid "Must supply a layout name."
-#~ msgstr "Navedite naziv prikaza."
-
-#~ msgid "Wrong object type."
-#~ msgstr "Krivi tip objekta."
-
-#~ msgid "First argument must be a QObject."
-#~ msgstr "Prvi argument mora biti QObject."
-
-#~ msgid "Incorrect number of arguments."
-#~ msgstr "Pogrešan broj argumenata."
-
-#~ msgid "The slot asked for %1 argument"
-#~ msgid_plural "The slot asked for %1 arguments"
-#~ msgstr[0] "Priključnica traži %1 argument"
-#~ msgstr[1] "Priključnica traži %1 argumenta"
-#~ msgstr[2] "Priključnica traži %1 argumenata"
-
-#~ msgid "but there is only %1 available"
-#~ msgid_plural "but there are only %1 available"
-#~ msgstr[0] "ali samo je %1 dostupan"
-#~ msgstr[1] "ali samo su %1 dostupna"
-#~ msgstr[2] "ali samo je %1 dostupnih"
-
-#~ msgctxt ""
-#~ "%1 is 'the slot asked for foo arguments', %2 is 'but there are only bar "
-#~ "available'"
-#~ msgid "%1, %2."
-#~ msgstr "%1, %2."
-
-#~ msgid "Failure to cast to %1 value from Type %2 (%3)"
-#~ msgstr "Nemoguće je pretvoriti u %1 vrijednost tipa %2 (%3)"
-
-#~ msgid "No such method '%1'."
-#~ msgstr "Nema takve metode '%1'."
-
-#~ msgid "Call to method '%1' failed, unable to get argument %2: %3"
-#~ msgstr ""
-#~ "Pozivanje metode '%1' nije uspjelo, nije moguće dobiti argument %2: %3"
-
-#~ msgid "Call to '%1' failed."
-#~ msgstr "Poziv od '%1' nije uspio."
-
-#~ msgid "%1 is not an Object type"
-#~ msgstr "%1 nije Object tip"
-
-#~ msgid "Could not construct value"
-#~ msgstr "Nije moguće konstruirati vrijednost"
-
-#~ msgid "Not enough arguments."
-#~ msgstr "Nema dovoljno argumenata."
-
-#~ msgid "Failed to create Action."
-#~ msgstr "Nije moguće stvoriti Akciju."
-
-#~ msgid "Failed to create ActionGroup."
-#~ msgstr "Nije moguće stvoriti AkcijskuGrupu."
-
-#~ msgid "No classname specified"
-#~ msgstr "Nije dodijeljen naziv klase"
-
-#~ msgid "Failed to create Layout."
-#~ msgstr "Neuspjelo stvaranje izgleda."
-
-#~ msgid "No classname specified."
-#~ msgstr "No classname specified."
-
-#~ msgid "Failed to create Widget."
-#~ msgstr "Nije uspjelo stvaranje widgeta."
-
-#~ msgid "Could not open file '%1': %2"
-#~ msgstr "Nije moguće otvoriti datoteku ''%1': %2"
-
-#~ msgid "Failed to load file '%1'"
-#~ msgstr "Neuspjelo učitavanje datoteke '%1'"
-
-#~ msgid "'%1' is not a valid QWidget."
-#~ msgstr "'%1' nije valjani QWidget."
-
-#~ msgid "Must supply a widget name."
-#~ msgstr "Navedite naziv widgeta."
-
-#~ msgid "Bad slot handler: Object %1 Identifier %2 Method %3 Signature: %4."
-#~ msgstr ""
-#~ "Loš držač priključnice: Objekt %1 Identifikator %2 Metoda %3 Potpis: %4"
-
-#~ msgid "Exception calling '%1' slot from %2:%3:%4"
-#~ msgstr "Iznimka pri pozivu priključnice '%1' iz %2:%3:%4"
-
-#~ msgid "loading %1"
-#~ msgstr "učitavam %1"
-
-#~ msgctxt "describes the feed of the latest posted entries"
-#~ msgid "Latest"
-#~ msgstr "Najnovije"
-
-#~ msgid "Highest Rated"
-#~ msgstr "Najviše ocjene"
-
-#~ msgid "Most Downloads"
-#~ msgstr "Najviše preuzimanja"
-
-#~ msgid ""
-#~ "Cannot start gpg and retrieve the available keys. Make sure "
-#~ "that gpg is installed, otherwise verification of downloaded "
-#~ "resources will not be possible. "
-#~ msgstr ""
-#~ "Ne mogu pokrenuti gpg i dobaviti dostupne ključeve . "
-#~ "Provjerite da li je gpg instaliran, u protivnom provjera preuzetih "
-#~ "podataka neće biti moguća. "
-
-#~ msgid ""
-#~ "Enter passphrase for key 0x%1 , belonging to%2<"
-#~ "%3> : "
-#~ msgstr ""
-#~ "Unesi frazu zaporke za ključ 0x%1 , pripada%2<%3>"
-#~ " : "
-
-#~ msgid ""
-#~ "Cannot start gpg and check the validity of the file. Make sure "
-#~ "that gpg is installed, otherwise verification of downloaded "
-#~ "resources will not be possible. "
-#~ msgstr ""
-#~ "Ne mogu pokrenuti gpg i provjeriti valjanost datoteke. "
-#~ "Provjerite da li je gpg instaliran, u protivnom provjera preuzetih "
-#~ "podataka neće biti moguća. "
-
-#~ msgid "Select Signing Key"
-#~ msgstr "Izaberite ključ za potpis"
-
-#~ msgid "Key used for signing:"
-#~ msgstr "Ključ za potpisivanje:"
-
-#~ msgid ""
-#~ "Cannot start gpg and sign the file. Make sure that gpg "
-#~ "is installed, otherwise signing of the resources will not be possible."
-#~ "qt>"
-#~ msgstr ""
-#~ "Ne mogu pokrenuti gpg i potpisati datoteku. Provjrite da li je "
-#~ "gpg instaliran, u protivnom neću biti u mogućnosti potpisati "
-#~ "podatke. "
-
-#~ msgid "Get Hot New Stuff"
-#~ msgstr "Nabavi nove sadržaje"
-
-#~ msgctxt "Program name followed by 'Add On Installer'"
-#~ msgid "%1 Add-On Installer"
-#~ msgstr "Instalacijska rutina za dodatke za %1"
-
-#~ msgid "Add Rating"
-#~ msgstr "Ocijeni"
-
-#~ msgid "Add Comment"
-#~ msgstr "Dodaj komentar"
-
-#~ msgid "View Comments"
-#~ msgstr "Pregledaj komentare"
-
-#~ msgid "Timeout. Check Internet connection."
-#~ msgstr "Vrijeme isteklo. Provjerite vezu na internet."
-
-#~ msgid "Entries failed to load"
-#~ msgstr "Unosi se nisu uspjeli učitati"
-
-#~ msgid "Server: %1"
-#~ msgstr "Poslužitelj: %1"
-
-#~ msgid " Provider: %1"
-#~ msgstr " Pružatelj usluge: %1"
-
-#~ msgid " Version: %1"
-#~ msgstr " Verzija: %1"
-
-#~ msgid "Provider information"
-#~ msgstr "Informacije o pružatelju usluge"
-
-#~ msgid "Could not install %1"
-#~ msgstr "Nije moguće instalirati %1"
-
-#~ msgid "Get Hot New Stuff!"
-#~ msgstr "Nabavi nove sadržaje!"
-
-#~ msgid "There was an error loading data providers."
-#~ msgstr "Pojavila se pogreška prilikom učitavanja pružatelja usluga."
-
-#~ msgid "A protocol fault has occurred. The request has failed."
-#~ msgstr "Problem s protokolom. Zahtjev bezuspješan."
-
-#~ msgid "Desktop Exchange Service"
-#~ msgstr "Servis razmjene radne površine"
-
-#~ msgid "A network error has occurred. The request has failed."
-#~ msgstr "Problem s mrežom. Zahtjev bezuspješan."
-
-#~ msgid "Rating: "
-#~ msgstr "Ocjena:"
-
-#~ msgid "Downloads: "
-#~ msgstr "Preuzimanja:"
-
-#~ msgid "No Downloads
"
-#~ msgstr "Nema preuzimanja
"
-
-#~ msgid "Downloads: %1
\n"
-#~ msgstr "Preuzimanja: %1
\n"
-
-#~ msgid "Rating: %1"
-#~ msgstr "Ocjena: %1"
-
-#~ msgid "No Preview"
-#~ msgstr "Nema pregleda"
-
-#~ msgid "Loading Preview"
-#~ msgstr "Učitavam pregled"
-
-#~ msgid "Comments"
-#~ msgstr "Komentari"
-
-#~ msgid "Changelog"
-#~ msgstr "Dnevnik promjena"
-
-#~ msgid "Switch version"
-#~ msgstr "Zamijeni verziju"
-
-#~ msgid "Contact author"
-#~ msgstr "Kontaktiraj autora"
-
-#~ msgid "Collaboration"
-#~ msgstr "Suradnja"
-
-#~ msgid "Translate"
-#~ msgstr "Prijevod"
-
-#~ msgid "Subscribe"
-#~ msgstr "Pretplati se"
-
-#~ msgid "Report bad entry"
-#~ msgstr "Prijavi loš unos"
-
-#~ msgid "Send Mail"
-#~ msgstr "Pošalji poštu"
-
-#~ msgid "Contact on Jabber"
-#~ msgstr "Kontaktiraj putem Jabbera"
-
-#~ msgid "Provider: %1"
-#~ msgstr "Pružatelj usluge: %1"
-
-#~ msgid "Version: %1"
-#~ msgstr "Verzija: %1"
-
-#~ msgid "The removal request was successfully registered."
-#~ msgstr "Zahtjev za uklanjanjem je uspješno registriran."
-
-#~ msgid "Removal of entry"
-#~ msgstr "Ukloni unos"
-
-#~ msgid "The removal request failed."
-#~ msgstr "Nije uspjelo uklanjanje zahtjeva."
-
-#~ msgid "The subscription was successfully completed."
-#~ msgstr "Pretplata je uspješno obavljena."
-
-#~ msgid "Subscription to entry"
-#~ msgstr "Pretplati se na unos"
-
-#~ msgid "The subscription request failed."
-#~ msgstr "Zahtjev za pretplatom bezuspješan."
-
-#~ msgid "The rating was submitted successfully."
-#~ msgstr "Ocjena je uspješno prihvaćena."
-
-#~ msgid "Rating for entry"
-#~ msgstr "Ocjena unosa"
-
-#~ msgid "The rating could not be submitted."
-#~ msgstr "Ocjenu nije moguće prihvatiti"
-
-#~ msgid "The comment was submitted successfully."
-#~ msgstr "Komentar je uspješno prihvaćen."
-
-#~ msgid "Comment on entry"
-#~ msgstr "Komentar unosa"
-
-#~ msgid "The comment could not be submitted."
-#~ msgstr "Nije moguće poslati komentar."
-
-#~ msgid "KNewStuff contributions"
-#~ msgstr "KNewStuff doprinosi"
-
-#~ msgid "This operation requires authentication."
-#~ msgstr "Ova operacija zahtjeva autorizaciju."
-
-#~ msgid "Version %1"
-#~ msgstr "Verzija %1"
-
-#~ msgid "Leave a comment"
-#~ msgstr "Ostavi komentar."
-
-#~ msgid "User comments"
-#~ msgstr "Komentari korisnika"
-
-#~ msgid "Rate this entry"
-#~ msgstr "Ocijeni ovaj unos"
-
-#~ msgid "Translate this entry"
-#~ msgstr "Prevedi ovo"
-
-#~ msgid "Payload"
-#~ msgstr "Teret"
-
-#~ msgid "Download New Stuff..."
-#~ msgstr "Preuzmite nove sadržaje…"
-
-#~ msgid "Hot New Stuff Providers"
-#~ msgstr "Provideri svježih novina"
-
-#~ msgid "Please select one of the providers listed below:"
-#~ msgstr "Molim odaberite jednog providera iz liste:"
-
-#~ msgid "No provider selected."
-#~ msgstr "Nije odabran provider."
-
-#~ msgctxt "Program name followed by 'Add On Uploader'"
-#~ msgid "%1 Add-On Uploader"
-#~ msgstr "%1 dodatak za slanje"
-
-#~ msgid "Please put in a name."
-#~ msgstr "Unesite ime."
-
-#~ msgid "Old upload information found, fill out fields?"
-#~ msgstr "Pronađena je informacija o starom slanju, treba li ispuniti polja?"
-
-#~ msgid "Fill Out"
-#~ msgstr "Ispunite"
-
-#~ msgid "Do Not Fill Out"
-#~ msgstr "Ne ispunjavajte"
-
-#~ msgid "Icons view mode"
-#~ msgstr "Način prikaza s ikonama"
-
-#~ msgid "Details view mode"
-#~ msgstr "Način detaljnog prikaza"
-
-#~ msgid "All Providers"
-#~ msgstr "Svi pružatelji"
-
-#~ msgid "All Categories"
-#~ msgstr "Sve kategorije"
-
-#~ msgid "Fetching license data from server..."
-#~ msgstr "Dohvati podatke o licenci s poslužitelja…"
-
-#~ msgid "Fetching content data from server..."
-#~ msgstr "Dohvaćam sadržaj s poslužitelja…"
-
-#~ msgid "Checking login..."
-#~ msgstr "Provjeravam prijavu…"
-
-#~ msgid "Fetching your previously updated content..."
-#~ msgstr "Dohvaćam Vaš prethodno ažuriran sadržaj…"
-
-#~ msgid "Could not verify login, please try again."
-#~ msgstr "Nije moguće provjeriti prijavu, molim pokušajte ponovno."
-
-#~ msgid "Fetching your previously updated content finished."
-#~ msgstr "Završilo je dohvaćanje Vašeg prethodno ažuriranog sadržaja."
-
-#~ msgid "Fetching content data from server finished."
-#~ msgstr "Završilo je dohvaćanje sadržaja s poslužitelja."
-
-#~ msgctxt ""
-#~ "A link to the website where the get hot new stuff upload can be seen"
-#~ msgid "Visit website"
-#~ msgstr "Posjetite web-stranicu"
-
-#~ msgid "File not found: %1"
-#~ msgstr "Datoteka nije pronađena: %1"
-
-#~ msgid "Upload Failed"
-#~ msgstr "Neuspjelo slanje"
-
-#~ msgid ""
-#~ "The server does not recognize the category %2 to which you are trying to "
-#~ "upload."
-#~ msgid_plural ""
-#~ "The server does not recognize any of the categories to which you are "
-#~ "trying to upload: %2"
-#~ msgstr[0] ""
-#~ "Poslužitelj ne prepoznaje kategoriju %2 u koju pokušavate poslati."
-#~ msgstr[1] ""
-#~ "Poslužitelj ne prepoznaje ni jednu od kategorija u koje pokušavate "
-#~ "poslati: %2"
-#~ msgstr[2] ""
-#~ "Poslužitelj ne prepoznaje ni jednu od kategorija u koje pokušavate "
-#~ "poslati: %2"
-
-#~ msgid "The selected category \"%1\" is invalid."
-#~ msgstr "Odabrana kategorija \"%1\" je nevaljana."
-
-#~ msgid "Select preview image"
-#~ msgstr "Odaberi preglednu sliku"
-
-#~ msgid "There was a network error."
-#~ msgstr "Dogodila se mrežna pogreška."
-
-#~ msgid "Uploading Failed"
-#~ msgstr "Slanje nije uspjelo"
-
-#~ msgid "Authentication error."
-#~ msgstr "Autentifikacijska pogreška."
-
-#~ msgid "Upload failed: %1"
-#~ msgstr "Neuspjelo slanje: %1"
-
-#~ msgctxt ""
-#~ "the price of a download item, parameter 1 is the currency, 2 is the price"
-#~ msgid ""
-#~ "This items costs %1 %2.\n"
-#~ "Do you want to buy it?"
-#~ msgstr ""
-#~ "Ova stavka košta %1 %2.\n"
-#~ "Želite li je kupiti?"
-
-#~ msgid ""
-#~ "Your account balance is too low:\n"
-#~ "Your balance: %1\n"
-#~ "Price: %2"
-#~ msgstr ""
-#~ "Vaše stanje računa je prenisko:\n"
-#~ "Vaše stanje: %1\n"
-#~ "Cijena: %2"
-
-#~ msgctxt "voting for an item (good/bad)"
-#~ msgid "Your vote was recorded."
-#~ msgstr "Vaš glas je zabilježen."
-
-#~ msgid "You are now a fan."
-#~ msgstr "Sad ste obožavatelj/ica."
-
-#~ msgid "Network error. (%1)"
-#~ msgstr "Mrežna pogreška. (%1)"
-
-#~ msgid "Too many requests to server. Please try again in a few minutes."
-#~ msgstr ""
-#~ "Previše zahtjeva prema poslužitelju. Molim pokušajte ponovno za nekoliko "
-#~ "minuta."
-
-#~ msgid "Unknown Open Collaboration Service API error. (%1)"
-#~ msgstr "Nepoznata pogreška API-ja Open Collaboration Servicea. (%1)"
-
-#~ msgid "Invalid item."
-#~ msgstr "Neispravna stavka."
-
-#~ msgid "Download of item failed: no download URL for \"%1\"."
-#~ msgstr "Neuspjelo preuzimanje stavke: nema URL-a preuzimanja za \"%1\"."
-
-#~ msgid "Download of \"%1\" failed, error: %2"
-#~ msgstr "Neuspjelo preuzimanje za \"%1\", pogreška: %2"
-
-#~ msgid ""
-#~ "The downloaded file is a html file. This indicates a link to a website "
-#~ "instead of the actual download. Would you like to open the site with a "
-#~ "browser instead?"
-#~ msgstr ""
-#~ "Preuzeta datoteka je html datoteka. Ovo označuje link na web-stranicu "
-#~ "umjesto stvarnog preuzimanja. Želite li umjesto toga otvoriti stranicu u "
-#~ "pregledniku?"
-
-#~ msgid "Possibly bad download link"
-#~ msgstr "Potencijalno nevaljani link za preuzimanje"
-
-#~ msgid "Downloaded file was a HTML file. Opened in browser."
-#~ msgstr "Preuzeta datoteka je HTML datoteka. Otvorena je u pregledniku."
-
-#~ msgid "Could not install \"%1\": file not found."
-#~ msgstr "Nije moguće instalirati \"%1\": datoteka nije pronađena."
-
-#~ msgid "Overwrite existing file?"
-#~ msgstr "Prepisati postojeću datoteku?"
-
-#~ msgid "Download File:"
-#~ msgstr "Preuzmite datoteku:"
-
-#~ msgid "Initializing"
-#~ msgstr "Inicijaliziram"
-
-#~ msgid "Configuration file not found: \"%1\""
-#~ msgstr "Nije pronađena konfiguracijska datoteka: \"%1\""
-
-#~ msgid "Configuration file is invalid: \"%1\""
-#~ msgstr "Konfiguracijska datoteka je neispravna: \"%1\""
-
-#~ msgid "Loading provider information"
-#~ msgstr "Učitavam informacije o pružatelju"
-
-#~ msgid "Could not load get hot new stuff providers from file: %1"
-#~ msgstr "Nije moguće učitati pružatelje Nabavi nove sadržaje iz datoteke: %1"
-
-#~ msgid "Error initializing provider."
-#~ msgstr "Pogreška pri inicijalizaciji pružatelja."
-
-#~ msgid "Loading data"
-#~ msgstr "Učitavam podatke"
-
-#~ msgid "Loading data from provider"
-#~ msgstr "Učitavanje podataka s pružatelja usluge"
-
-#~ msgid "Loading of providers from file: %1 failed"
-#~ msgstr "Učitavanje pružatelja usluge iz datoteke: %1 nije uspjelo"
-
-#~ msgid "Loading one preview"
-#~ msgid_plural "Loading %1 previews"
-#~ msgstr[0] "Učitavam %1 pregled"
-#~ msgstr[1] "Učitavam %1 pregleda"
-#~ msgstr[2] "Učitavam %1 pregleda"
-
-#~ msgid "Installing"
-#~ msgstr "Instaliranje"
-
-#~ msgid "Details for %1"
-#~ msgstr "Detalji za %1"
-
-#~ msgctxt "A link to the description of this Get Hot New Stuff item"
-#~ msgid "Homepage"
-#~ msgstr "Osobna stranica"
-
-#~ msgctxt ""
-#~ "A link to make a donation for a Get Hot New Stuff item (opens a web "
-#~ "browser)"
-#~ msgid "Make a donation"
-#~ msgstr "Donirajte"
-
-#~ msgctxt "A link to the knowledgebase (like a forum) (opens a web browser)"
-#~ msgid "Knowledgebase (no entries)"
-#~ msgid_plural "Knowledgebase (%1 entries)"
-#~ msgstr[0] "Baza znanja (nema unosa (%1 zapisa))"
-#~ msgstr[1] "Baza znanja (zapisa: %1)"
-#~ msgstr[2] "Baza znanja (zapisa: %1)"
-
-#~ msgctxt "Tooltip for a link in a dialog"
-#~ msgid "Opens in a browser window"
-#~ msgstr "Otvora u prozoru pretraživača"
-
-#~ msgid "Rating: %1%"
-#~ msgstr "Ocjena: %1%"
-
-#~ msgctxt "Show the author of this item in a list"
-#~ msgid "By %1 "
-#~ msgstr "Od %1 "
-
-#~ msgctxt "fan as in supporter"
-#~ msgid "1 fan"
-#~ msgid_plural "%1 fans"
-#~ msgstr[0] "%1 fan"
-#~ msgstr[1] "%1 fana"
-#~ msgstr[2] "%1 fanova"
-
-#~ msgid "1 download"
-#~ msgid_plural "%1 downloads"
-#~ msgstr[0] "%1 preuzimanje"
-#~ msgstr[1] "%1 preuzimanja"
-#~ msgstr[2] "%1 preuzimanja"
-
-#~ msgid "Updating"
-#~ msgstr "Ažuriranje"
-
-#~ msgid "Install Again"
-#~ msgstr "Ponovno instaliraj"
-
-#~ msgid "Configure Notifications"
-#~ msgstr "Podešavanje obavijesti…"
-
-#~ msgctxt "State of the notified event"
-#~ msgid "State"
-#~ msgstr "Stanje"
-
-#~ msgctxt "Title of the notified event"
-#~ msgid "Title"
-#~ msgstr "Naslov"
-
-#~ msgctxt "Description of the notified event"
-#~ msgid "Description"
-#~ msgstr "Opis"
-
-#~ msgid "Untitled"
-#~ msgstr "Bez naslova"
-
-#~ msgid ""
-#~ "The document \"%1\" has been modified.\n"
-#~ "Do you want to save your changes or discard them?"
-#~ msgstr ""
-#~ "Dokument \"%1\" je mijenjan.\n"
-#~ "Želite li ga spremiti promjene?"
-
-#~ msgid "Close Document"
-#~ msgstr "Zatvori dokument"
-
-#~ msgid "Do you want to search the Internet for %1 ? "
-#~ msgstr "Želite li pretražiti Internet za %1 ? "
-
-#~ msgid "Internet Search"
-#~ msgstr "Pretraživanje na Internetu"
-
-#~ msgid "&Search"
-#~ msgstr "&Traži"
-
-#~ msgid "Do you really want to execute '%1'?"
-#~ msgstr "Želite li zaista izvršiti '%1'?"
-
-#~ msgid "Execute File?"
-#~ msgstr "Izvrši datoteku?"
-
-#~ msgctxt "@label Type of file"
-#~ msgid "Type: %1"
-#~ msgstr "Vrsta: %1"
-
-#~ msgctxt "@label:checkbox"
-#~ msgid "Remember action for files of this type"
-#~ msgstr "Zapamti radnju za datoteke ove vrste"
-
-#~ msgctxt "@label:button"
-#~ msgid "&Open with %1"
-#~ msgstr "&Otvori s %1|/|&Otvori s $[ins %1]"
-
-#~ msgctxt "@action:inmenu"
-#~ msgid "Open &with %1"
-#~ msgstr "Ot&vori s %1"
-
-#~ msgctxt "@info"
-#~ msgid "Open '%1'?"
-#~ msgstr "Otvoriti '%1'?"
-
-#~ msgctxt "@label:button"
-#~ msgid "&Open with..."
-#~ msgstr "&Otvori s…"
-
-#~ msgctxt "@label:button"
-#~ msgid "&Open with"
-#~ msgstr "&Otvori s"
-
-#~ msgctxt "@label:button"
-#~ msgid "&Open"
-#~ msgstr "&Otvori"
-
-#~ msgctxt "@label File name"
-#~ msgid "Name: %1"
-#~ msgstr "Naziv: %1"
-
-#~ msgctxt "@info:whatsthis"
-#~ msgid "This is the file name suggested by the server"
-#~ msgstr "Ovo je naziv datoteke koji je predložio poslužitelj"
-
-#~ msgid "Error reading from PTY"
-#~ msgstr "Pogreška kod čitanja iz PTY"
-
-#~ msgid "Error writing to PTY"
-#~ msgstr "Pogreška kod pisanja u PTY"
-
-#~ msgid "PTY operation timed out"
-#~ msgstr "Isteklo vrijeme za PTY operaciju"
-
-#~ msgid "Error opening PTY"
-#~ msgstr "Pogreška kod otvaranja PTY "
-
-#~ msgid "Kross"
-#~ msgstr "Kross"
-
-#~ msgid "KDE application to run Kross scripts."
-#~ msgstr "KDE aplikacija za pokretanje Kross skripata."
-
-#~ msgid "(C) 2006 Sebastian Sauer"
-#~ msgstr "© 2006 Sebastian Sauer"
-
-#~ msgid "Run Kross scripts."
-#~ msgstr "Pokreni Kross skripte."
-
-#~ msgid "Sebastian Sauer"
-#~ msgstr "Sebastian Sauer"
-
-#~ msgid "Scriptfile"
-#~ msgstr "Datoteka skripte"
-
-#~ msgid "Scriptfile \"%1\" does not exist."
-#~ msgstr "Datoteka skripte %1 ne postoji."
-
-#~ msgid "Failed to determine interpreter for scriptfile \"%1\""
-#~ msgstr "Neuspjelo određivanje interpretatora za skriptnu datoteku \"%1\"."
-
-#~ msgid "Failed to open scriptfile \"%1\""
-#~ msgstr "Neuspjelo otvaranje skriptne datoteke \"%1\""
-
-#~ msgid "Failed to load interpreter \"%1\""
-#~ msgstr "Neuspjelo učitavanje interpretatora \"%1\"."
-
-#~ msgid "No such interpreter \"%1\""
-#~ msgstr "Nema takvog tumača \"%1\""
-
-#~ msgid "Failed to create script for interpreter \"%1\""
-#~ msgstr "Nije uspjelo stvaranje skripte za interpretator \"%1\"."
-
-#~ msgid "Level of safety of the Ruby interpreter"
-#~ msgstr "Razina sigurnosti interpretera Rubyja"
-
-#~ msgid "Cancel?"
-#~ msgstr "Odustati?"
-
-#~ msgid "Text:"
-#~ msgstr "Tekst:"
-
-#~ msgid "Comment:"
-#~ msgstr "Komentar:"
-
-#~ msgid "Icon:"
-#~ msgstr "Ikona:"
-
-#~ msgid "Interpreter:"
-#~ msgstr "Tumač:"
-
-#~ msgid "File:"
-#~ msgstr "Datoteka:"
-
-#~ msgid "Execute the selected script."
-#~ msgstr "Izvrši odabranu skriptu."
-
-#~ msgid "Stop execution of the selected script."
-#~ msgstr "Prekini izvršavanje odabrane skripte."
-
-#~ msgid "Edit..."
-#~ msgstr "Uredi…"
-
-#~ msgid "Edit selected script."
-#~ msgstr "Promijeni odabranu skriptu."
-
-#~ msgid "Add..."
-#~ msgstr "Dodaj…"
-
-#~ msgid "Add a new script."
-#~ msgstr "Dodaj novu skriptu."
-
-#~ msgid "Remove selected script."
-#~ msgstr "Ukloni odabranu skriptu."
-
-#~ msgid "Edit"
-#~ msgstr "Uredi"
-
-#~ msgctxt "@title:group Script properties"
-#~ msgid "General"
-#~ msgstr "Opće"
-
-#~ msgid "The module %1 could not be found."
-#~ msgstr "Modul %1 ne može biti pronađen."
-
-#~ msgid ""
-#~ "The diagnosis is: The desktop file %1 could not be found."
-#~ "p>
"
-#~ msgstr ""
-#~ "Dijagnoza je: Nije moguće pronači datoteku radne površine %1."
-#~ "
"
-
-#~ msgid "The module %1 is disabled."
-#~ msgstr "Modul %1 je onemogućen."
-
-#~ msgid ""
-#~ "Either the hardware/software the module configures is not "
-#~ "available or the module has been disabled by the administrator.
"
-#~ msgstr ""
-#~ "Ili hardver/softver kojeg modul podešava nije dostupan ili je "
-#~ "modul onemogućen od strane administratora.
"
-
-#~ msgid "The module %1 is not a valid configuration module."
-#~ msgstr "Modul %1 nije važeći konfiguracijski modul."
-
-#~ msgid ""
-#~ "The diagnosis is: The desktop file %1 does not specify a library."
-#~ " "
-#~ msgstr ""
-#~ "Dijagnoza je: Datoteka radne površine %1 ne određuje biblioteku."
-#~ " "
-
-#~ msgid "There was an error loading the module."
-#~ msgstr "Pojavila se pogreška prilikom učitavanju modula"
-
-#~ msgid ""
-#~ "The diagnosis is: %1Possible reasons:
An error "
-#~ "occurred during your last KDE upgrade leaving an orphaned control module"
-#~ "li> You have old third party modules lying around. Check "
-#~ "these points carefully and try to remove the module mentioned in the "
-#~ "error message. If this fails, consider contacting your distributor or "
-#~ "packager.
"
-#~ msgstr ""
-#~ "Dijagnoza je: %1Mogući razlozi:
Pojava pogreške "
-#~ "prilikom zadnjeg ažuriranja KDE-a ostavila je napušteni kontrolni modul"
-#~ "li> Imate stare module neke treće strane koji su postavljeni uokolo."
-#~ "li> Pažljivo provjerite ove stavke i pokušajte ukloniti spomenuti "
-#~ "modul u poruci o pogrešci. Ako to ne uspije, kontaktirajte svojeg "
-#~ "distributora ili paketara
"
-
-#~ msgid ""
-#~ "Possible reasons:
An error occurred during your last KDE "
-#~ "upgrade leaving an orphaned control module You have old third "
-#~ "party modules lying around.
Check these points carefully "
-#~ "and try to remove the module mentioned in the error message. If this "
-#~ "fails, consider contacting your distributor or packager.
"
-#~ msgstr ""
-#~ "Mogući razlozi:
Pojava greške prilikom zadnjeg "
-#~ "ažuriranja KDE-a ostavila je zaboravljeni kontrolni modul Imate "
-#~ "zaostale stare, tuđe module. Provjerite ove stavke pažljivo i "
-#~ "pokušajte ukloniti spomenuti modul u poruci o grešci. Ako to ne uspije, "
-#~ "kontaktirajte svojeg distributora ili paketara
"
-
-#~ msgctxt "Argument is application name"
-#~ msgid "This configuration section is already opened in %1"
-#~ msgstr "Ova konfiguracijska sekcija je već otvorena u %1"
-
-#~ msgid ""
-#~ "The settings of the current module have changed.\n"
-#~ "Do you want to apply the changes or discard them?"
-#~ msgstr ""
-#~ "Postavke trenutnog modula su promijenjene.\n"
-#~ "Želite li spremiti promjene ili ih odbaciti?"
-
-#~ msgid "Apply Settings"
-#~ msgstr "Primijeni postavke"
-
-#~ msgid "Could not load print preview part"
-#~ msgstr "Nije moguće učitati dio za pregled ispisa"
-
-#~ msgid "Print Preview"
-#~ msgstr "Pregled prije ispisa"
-
-#~ msgid ""
-#~ "Automatic changes have been performed due to plugin dependencies. Click "
-#~ "here for further information"
-#~ msgstr ""
-#~ "Izvedene su automatske promjene zbog zahtjeva priključka. Kliknite ovdje "
-#~ "za više informacija"
-
-#~ msgid ""
-#~ "Automatic changes have been performed in order to satisfy plugin "
-#~ "dependencies:\n"
-#~ msgstr ""
-#~ "Napravljene su automatske promjene da bi zadovoljile ovisnosti "
-#~ "priključaka:\n"
-
-#~ msgid ""
-#~ "\n"
-#~ " %1 plugin has been automatically checked because of the dependency of "
-#~ "%2 plugin"
-#~ msgstr ""
-#~ "\n"
-#~ " %1 priključak je automatski odabran zbog zahtjeva priključka %2"
-
-#~ msgid ""
-#~ "\n"
-#~ " %1 plugin has been automatically unchecked because of its dependency "
-#~ "on %2 plugin"
-#~ msgstr ""
-#~ "\n"
-#~ " %1 priključaj je automatski maknut zbog zahtjevanja od priključka %2"
-
-#~ msgid "Dependency Check"
-#~ msgstr "Provjera ovisnosti"
-
-#~ msgid "%1 plugin automatically added due to plugin dependencies"
-#~ msgid_plural "%1 plugins automatically added due to plugin dependencies"
-#~ msgstr[0] "%1 priključak je automatski dodan zbog zahtjeva priključaka"
-#~ msgstr[1] "%1 priključka su automatski dodani zbog zahtjeva priključaka"
-#~ msgstr[2] "%1 priključaka je automatski dodano zbog zahtjeva priključaka"
-
-#~ msgid ", "
-#~ msgstr ","
-
-#~ msgid "%1 plugin automatically removed due to plugin dependencies"
-#~ msgid_plural "%1 plugins automatically removed due to plugin dependencies"
-#~ msgstr[0] "%1 priključak je automatski maknut zbog zahtjeva priključaka"
-#~ msgstr[1] "%1 priključka su automatski maknuta zbog zahtjeva priključaka"
-#~ msgstr[2] "%1 priključaka je automatski maknuto zbog zahtjeva priključaka"
-
-#~ msgid "Search Plugins"
-#~ msgstr "Traži priključke"
-
-#~ msgctxt "Used only for plugins"
-#~ msgid "About %1"
-#~ msgstr "O programu %1"
-
-#~ msgid "Select Components"
-#~ msgstr "Odaberi komponente"
-
-#~ msgid "Enable component"
-#~ msgstr "Omogući komponentu"
-
-#~ msgid "Success"
-#~ msgstr "Uspjeh"
-
-#~ msgid "Communication error"
-#~ msgstr "Pogreška u komunikaciji"
-
-#~ msgid "Invalid type in Database"
-#~ msgstr "Neispravni tip u bazi podataka"
-
-#~ msgctxt ""
-#~ "Boolean AND keyword in desktop search strings. You can add several "
-#~ "variants separated by spaces, e.g. retain the English one alongside the "
-#~ "translation; keywords are not case sensitive. Make sure there is no "
-#~ "conflict with the OR keyword."
-#~ msgid "and"
-#~ msgstr "i"
-
-#~ msgctxt ""
-#~ "Boolean OR keyword in desktop search strings. You can add several "
-#~ "variants separated by spaces, e.g. retain the English one alongside the "
-#~ "translation; keywords are not case sensitive. Make sure there is no "
-#~ "conflict with the AND keyword."
-#~ msgid "or"
-#~ msgstr "ili"
-
-#~ msgctxt ""
-#~ "@title UDS_DISPLAY_NAME for a KIO directory listing. %1 is the query the "
-#~ "user entered."
-#~ msgid "Query Results from '%1'"
-#~ msgstr "Rezultati pretraživanja za '%1'"
-
-#~ msgctxt "@title UDS_DISPLAY_NAME for a KIO directory listing."
-#~ msgid "Query Results"
-#~ msgstr "Rezultati upita"
-
-#~ msgid "Nepomuk Resource Class Generator"
-#~ msgstr "Nepomuk Resource Class Generator"
-
-#~ msgid "(c) 2006-2009, Sebastian Trüg"
-#~ msgstr "© 2006–2009 Sebastian Trüg"
-
-#~ msgid "Sebastian Trüg"
-#~ msgstr "Sebastian Trüg"
-
-#~ msgid "Maintainer"
-#~ msgstr "Održavač"
-
-#~ msgid "Tobias Koenig"
-#~ msgstr "Tobias Koenig"
-
-#~ msgid "Major cleanup - Personal hero of maintainer"
-#~ msgstr "Glavno pospremanje – osobni heroj održavanja"
-
-#~ msgid "Verbose output debugging mode."
-#~ msgstr "Opširan ispis u načinu za ispravljanje pogrešaka."
-
-#~ msgid ""
-#~ "Generate simple and fast wrapper classes not based on Nepomuk::Resource "
-#~ "which do not provide any data integrity checking"
-#~ msgstr ""
-#~ "Generiranje jednostavnih i brzih omotačkih klasa koje nisu bazirane na "
-#~ "Nepomuku::Resurs koji ne omogućuje nikakvu provjeru integriteta podataka"
-
-#~ msgid "Actually generate the code."
-#~ msgstr "Zapravo generira kod."
-
-#~ msgid "List all includes (deprecated)."
-#~ msgstr "Izlistaj sve uključke (napušteno)."
-
-#~ msgid ""
-#~ "List all header files that will be generated via the --writeall command."
-#~ msgstr ""
-#~ "Izlistaj sva zaglavlja datoteka koje će biti generirane s naredbom --"
-#~ "writeall."
-
-#~ msgid ""
-#~ "List all source files that will be generated via the --writeall command."
-#~ msgstr ""
-#~ "Izlistaj sve izvorne datoteke koje će biti generirane s naredbom --"
-#~ "writeall."
-
-#~ msgid ""
-#~ "The ontology files containing the ontologies to be generated, a space "
-#~ "separated list (deprecated: use arguments instead.)"
-#~ msgstr ""
-#~ "Ontologijske datoteke sadrže ontologije koje će biti generirane; lista "
-#~ "odvojena razmacima (napušteno: umjesto toga koristite argumente.)"
-
-#~ msgid "Include path prefix (deprecated)"
-#~ msgstr "Uključi prefiks u put (napušteno)"
-
-#~ msgid "Specify the target folder to store generated files into."
-#~ msgstr ""
-#~ "Potrebno je odrediti ciljani direktorij u koji će se spremiti generirane "
-#~ "datoteke."
-
-#~ msgid "Templates to be used (deprecated)."
-#~ msgstr "Predlošci koji će biti korišteni (napušteno)."
-
-#~ msgid ""
-#~ "Optionally specify the classes to be generated. Use option multiple times "
-#~ "(defaults to all classes)"
-#~ msgstr ""
-#~ "Opcijonalno je moguće odrediti klase koje će biti generirane. Koristite "
-#~ "opciju višestruko (zadano u svim klasama)"
-
-#~ msgid ""
-#~ "Serialization used in the ontology files. Will default to primitive file "
-#~ "extension detection."
-#~ msgstr ""
-#~ "Serijalizacija korištena u onologijskim datotekama. Bit će zadano "
-#~ "osnovnoj detekciji datotečnih nastavaka."
-
-#~ msgid ""
-#~ "Set the used visibility in case the classes are to be used in public API. "
-#~ " will be used to construct the export macro name and the "
-#~ "export header. By default classes will not be exported."
-#~ msgstr ""
-#~ "Postavljanje korištene vidljivosti u slučaju kada će klase biti korištene "
-#~ "u javnom API-ju. bit će korišten za konstrukciju "
-#~ "izvoznog makro naziva i za izvozno zaglavlje. Inače klase neće biti "
-#~ "izvezene."
-
-#~ msgid "The ontology files containing the ontologies to be generated."
-#~ msgstr "Ontologijske datoteke sadrže ontologije koje će biti generirane."
-
-#~ msgid "Changing annotations"
-#~ msgstr "Promijeni opaske"
-
-#~ msgctxt "@label"
-#~ msgid "Show all tags..."
-#~ msgstr "Prikaži sve oznake…"
-
-#~ msgctxt "@label"
-#~ msgid "Add Tags..."
-#~ msgstr "Dodaj oznake…"
-
-#~ msgctxt "@label"
-#~ msgid "Change..."
-#~ msgstr "Promijeni…"
-
-#~ msgctxt "@title:window"
-#~ msgid "Change Tags"
-#~ msgstr "Promijeni oznake"
-
-#~ msgctxt "@title:window"
-#~ msgid "Add Tags"
-#~ msgstr "Dodaj oznake"
-
-#~ msgctxt "@label:textbox"
-#~ msgid "Configure which tags should be applied."
-#~ msgstr "Podesi koje bi se oznake trebale primijeniti."
-
-#~ msgctxt "@label"
-#~ msgid "Create new tag:"
-#~ msgstr "Stvori novu oznaku:"
-
-#~ msgctxt "@info"
-#~ msgid "Delete tag"
-#~ msgstr "Izbriši oznaku"
-
-#~ msgctxt "@info"
-#~ msgid ""
-#~ "Should the tag %1 really be deleted for all files?"
-#~ msgstr ""
-#~ "Treba li oznaka %1 zaista biti izbrisana za sve "
-#~ "datoteke?"
-
-#~ msgctxt "@title"
-#~ msgid "Delete tag"
-#~ msgstr "Izbriši oznaku"
-
-#~ msgctxt "@action:button"
-#~ msgid "Delete"
-#~ msgstr "Izbriši"
-
-#~ msgctxt "@action:button"
-#~ msgid "Cancel"
-#~ msgstr "Odustani"
-
-#~ msgid "This Week"
-#~ msgstr "Ovaj tjedan"
-
-#~ msgid "This Month"
-#~ msgstr "Ovaj mjesec"
-
-#~ msgctxt ""
-#~ "@option:check An item in a list of resources that allows to query for "
-#~ "more resources to put in the list"
-#~ msgid "More..."
-#~ msgstr "Više…"
-
-#~ msgctxt "@option:check A filter on file type"
-#~ msgid "Documents"
-#~ msgstr "Dokumenti"
-
-#~ msgctxt "@option:check A filter on file type - audio files"
-#~ msgid "Audio"
-#~ msgstr "Audio"
-
-#~ msgctxt "@option:check A filter on file type - media video"
-#~ msgid "Video"
-#~ msgstr "Video"
-
-#~ msgctxt "@option:check A filter on file type"
-#~ msgid "Images"
-#~ msgstr "Slike"
-
-#~ msgctxt ""
-#~ "@option:radio A filter on prioritizing/sorting a selection of resources"
-#~ msgid "No priority"
-#~ msgstr "Bez prioriteta"
-
-#~ msgctxt ""
-#~ "@option:radio A filter on prioritizing/sorting a selection of resources"
-#~ msgid "Last modified"
-#~ msgstr "Zadnji puta mijenjano"
-
-#~ msgctxt ""
-#~ "@option:radio A filter on prioritizing/sorting a selection of resources"
-#~ msgid "Most important"
-#~ msgstr "Najvažnije"
-
-#~ msgctxt ""
-#~ "@option:radio A filter on prioritizing/sorting a selection of resources"
-#~ msgid "Never opened"
-#~ msgstr "Nikad otvoreno"
-
-#~ msgctxt "@option:radio A filter on the rating of a resource"
-#~ msgid "Any Rating"
-#~ msgstr "Bilo koja ocjena"
-
-#~ msgctxt "@option:radio A filter on the rating of a resource"
-#~ msgid "1 or more"
-#~ msgstr "1 ili više"
-
-#~ msgctxt "@option:radio A filter on the rating of a resource"
-#~ msgid "2 or more"
-#~ msgstr "2 ili više"
-
-#~ msgctxt "@option:radio A filter on the rating of a resource"
-#~ msgid "3 or more"
-#~ msgstr "3 ili više"
-
-#~ msgctxt "@option:radio A filter on the rating of a resource"
-#~ msgid "4 or more"
-#~ msgstr "4 ili više"
-
-#~ msgctxt "@option:radio A filter on the rating of a resource"
-#~ msgid "Max Rating"
-#~ msgstr "Najviša ocjena"
-
-#~ msgctxt ""
-#~ "@title KCategorizedSortFilterProxyModel grouping for all Nepomukj "
-#~ "resources that are of type rdfs:Resource"
-#~ msgid "Miscellaneous"
-#~ msgstr "Razno"
-
-#~ msgctxt "@title:column The Nepomuk resource label and icon"
-#~ msgid "Resource"
-#~ msgstr "Resurs"
-
-#~ msgctxt "@title:column The Nepomuk resource's RDF type"
-#~ msgid "Resource Type"
-#~ msgstr "Tip resursa"
-
-#~ msgctxt "@option:check A filter on resource type"
-#~ msgid "Contacts"
-#~ msgstr "Kontakti"
-
-#~ msgctxt "@option:check A filter on resource type"
-#~ msgid "Emails"
-#~ msgstr "E-pošte"
-
-#~ msgctxt "@option:check A filter on resource type"
-#~ msgid "Tasks"
-#~ msgstr "Zadaci"
-
-#~ msgctxt "@option:check A filter on resource type"
-#~ msgid "Tags"
-#~ msgstr "Oznake"
-
-#~ msgctxt "@option:check Do filter on type - show only files"
-#~ msgid "Files"
-#~ msgstr "sDatoteke"
-
-#~ msgctxt "@option:check Do filter on type - show everything but files"
-#~ msgid "Other"
-#~ msgstr "Ostalo"
-
-#~ msgctxt ""
-#~ "referring to a filter on the modification and usage date of files/"
-#~ "resources"
-#~ msgid "Anytime"
-#~ msgstr "Bilo kad"
-
-#~ msgctxt ""
-#~ "referring to a filter on the modification and usage date of files/"
-#~ "resources"
-#~ msgid "Today"
-#~ msgstr "Danas"
-
-#~ msgctxt ""
-#~ "referring to a filter on the modification and usage date of files/"
-#~ "resources"
-#~ msgid "Yesterday"
-#~ msgstr "Jučer"
-
-#~ msgctxt ""
-#~ "referring to a filter on the modification and usage date of files/"
-#~ "resources"
-#~ msgid "This Week"
-#~ msgstr "Ovog tjedna"
-
-#~ msgctxt ""
-#~ "referring to a filter on the modification and usage date of files/"
-#~ "resources"
-#~ msgid "Last Week"
-#~ msgstr "Prošlog tjedna"
-
-#~ msgctxt ""
-#~ "referring to a filter on the modification and usage date of files/"
-#~ "resources"
-#~ msgid "This Month"
-#~ msgstr "Ovog mjeseca"
-
-#~ msgctxt ""
-#~ "referring to a filter on the modification and usage date of files/"
-#~ "resources"
-#~ msgid "Last Month"
-#~ msgstr "Prošlog mjeseca"
-
-#~ msgctxt ""
-#~ "referring to a filter on the modification and usage date of files/"
-#~ "resources"
-#~ msgid "This Year"
-#~ msgstr "Ove godine"
-
-#~ msgctxt ""
-#~ "referring to a filter on the modification and usage date of files/"
-#~ "resources"
-#~ msgid "Last Year"
-#~ msgstr "Prošle godine"
-
-#~ msgctxt ""
-#~ "referring to a filter on the modification and usage date of files/"
-#~ "resources that will open a dialog to choose a date range"
-#~ msgid "Custom..."
-#~ msgstr "Prilagođeno…"
-
-#~ msgid "Enter Search Terms..."
-#~ msgstr "Unesite termine za pretraživanje…"
-
-#~ msgctxt "Custom color"
-#~ msgid "Custom..."
-#~ msgstr "Prilagođeno…"
-
-#~ msgctxt "palette name"
-#~ msgid "* Recent Colors *"
-#~ msgstr "* Skorašnje boje *"
-
-#~ msgctxt "palette name"
-#~ msgid "* Custom Colors *"
-#~ msgstr "* Prilagođene boje *"
-
-#~ msgctxt "palette name"
-#~ msgid "Forty Colors"
-#~ msgstr "Forty boje"
-
-#~ msgctxt "palette name"
-#~ msgid "Oxygen Colors"
-#~ msgstr "Oxygen boje"
-
-#~ msgctxt "palette name"
-#~ msgid "Rainbow Colors"
-#~ msgstr "Dugine boje"
-
-#~ msgctxt "palette name"
-#~ msgid "Royal Colors"
-#~ msgstr "Royal boje"
-
-#~ msgctxt "palette name"
-#~ msgid "Web Colors"
-#~ msgstr "Web boje"
-
-#~ msgid "Named Colors"
-#~ msgstr "Boje s nazivima"
-
-#~ msgctxt ""
-#~ "%1 is the number of paths, %2 is the list of paths (with newlines between "
-#~ "them)"
-#~ msgid ""
-#~ "Unable to read X11 RGB color strings. The following file location was "
-#~ "examined:\n"
-#~ "%2"
-#~ msgid_plural ""
-#~ "Unable to read X11 RGB color strings. The following file locations were "
-#~ "examined:\n"
-#~ "%2"
-#~ msgstr[0] ""
-#~ "Nije moguće čitati X11 RGB stringove boje. Pregledane je sljedeća "
-#~ "lokacija datoteka:\n"
-#~ "%2"
-#~ msgstr[1] ""
-#~ "Nije moguće čitati X11 RGB stringove boje. Pregledane su sljedeće "
-#~ "lokacije datoteka:\n"
-#~ "%2"
-#~ msgstr[2] ""
-#~ "Nije moguće čitati X11 RGB stringove boje. Pregledane su sljedeće "
-#~ "lokacije datoteka:\n"
-#~ "%2"
-
-#~ msgid "Select Color"
-#~ msgstr "Odaberi boju"
-
-#~ msgid "Hue:"
-#~ msgstr "Nijansa:"
-
-#~ msgctxt "The angular degree unit (for hue)"
-#~ msgid "°"
-#~ msgstr "°"
-
-#~ msgid "Saturation:"
-#~ msgstr "Zasićenost:"
-
-#~ msgctxt "This is the V of HSV"
-#~ msgid "Value:"
-#~ msgstr "Vrijednost:"
-
-#~ msgid "Red:"
-#~ msgstr "Crvena:"
-
-#~ msgid "Green:"
-#~ msgstr "Zelena:"
-
-#~ msgid "Blue:"
-#~ msgstr "Plava:"
-
-#~ msgid "Alpha:"
-#~ msgstr "Alfa:"
-
-#~ msgid "&Add to Custom Colors"
-#~ msgstr "&Dodaj prilagođenim bojama"
-
-#~ msgid "HTML:"
-#~ msgstr "HTML:"
-
-#~ msgid "Default color"
-#~ msgstr "Uobičajena boja"
-
-#~ msgid "-default-"
-#~ msgstr "-zadano-"
-
-#~ msgid "-unnamed-"
-#~ msgstr "-bez naziva-"
-
-#~ msgid "No service matching the requirements was found"
-#~ msgstr "Usluga, koja se slaže sa zahtjevima, nije nađena"
-
-#~ msgid ""
-#~ "The service '%1' does not provide an interface '%2' with keyword '%3'"
-#~ msgstr "Usluga '%1' ne nudi sučelje '%2' s ključnom riječju '%3'"
-
-#~ msgid "KDE Test Program"
-#~ msgstr "KDE-ov pokusni program"
-
-#~ msgid "&New"
-#~ msgstr "&Novi"
-
-#~ msgid "Open &Recent"
-#~ msgstr "Otvori &nedavno"
-
-#~ msgid "Re&vert"
-#~ msgstr "Vrati &izvorno"
-
-#~ msgid "Print Previe&w"
-#~ msgstr "Preg&led prije ispisa…"
-
-#~ msgid "&Mail..."
-#~ msgstr "&Pošta…"
-
-#~ msgid "Re&do"
-#~ msgstr "Po&novi"
-
-#~ msgid "Cu&t"
-#~ msgstr "&Izreži"
-
-#~ msgid "&Copy"
-#~ msgstr "&Kopiraj"
-
-#~ msgid "&Paste"
-#~ msgstr "&Zalijepi"
-
-#~ msgid "Select &All"
-#~ msgstr "Označi &sve"
-
-#~ msgid "Dese&lect"
-#~ msgstr "Od&znači"
-
-#~ msgid "Find &Next"
-#~ msgstr "Nađi &sljedeći"
-
-#~ msgid "Find Pre&vious"
-#~ msgstr "Nađi &prethodni"
-
-#~ msgid "&Replace..."
-#~ msgstr "&Zamijeni…"
-
-#~ msgid "&Actual Size"
-#~ msgstr "St&varna veličina"
-
-#~ msgid "&Fit to Page"
-#~ msgstr "&Prilagodi prema stranici"
-
-#~ msgid "Fit to Page &Width"
-#~ msgstr "Prilagodi &prema širini stranice"
-
-#~ msgid "Fit to Page &Height"
-#~ msgstr "Prilagodi prema v&isini stranice"
-
-#~ msgid "Zoom &In"
-#~ msgstr "U&većaj"
-
-#~ msgid "Zoom &Out"
-#~ msgstr "U&manji"
-
-#~ msgid "&Zoom..."
-#~ msgstr "&Zumiraj…"
-
-#~ msgid "&Redisplay"
-#~ msgstr "Ponovno pri&kaži"
-
-#~ msgid "&Up"
-#~ msgstr "&Gore"
-
-#~ msgid "&Previous Page"
-#~ msgstr "P&rethodna stranica"
-
-#~ msgid "&Next Page"
-#~ msgstr "&Sljedeća stranica"
-
-#~ msgid "&Go To..."
-#~ msgstr "&Idi na…"
-
-#~ msgid "&Go to Page..."
-#~ msgstr "Idi &na stranicu…"
-
-#~ msgid "&Go to Line..."
-#~ msgstr "I&di na redak…"
-
-#~ msgid "&First Page"
-#~ msgstr "&Prva stranica"
-
-#~ msgid "&Last Page"
-#~ msgstr "&Zadnja stranica"
-
-#~ msgid "&Back in the Document"
-#~ msgstr "&Vrati u dokument"
-
-#~ msgid "&Forward in the Document"
-#~ msgstr "&Proslijedi u dokument"
-
-#~ msgid "&Add Bookmark"
-#~ msgstr "&Dodaj knjižnu oznaku"
-
-#~ msgid "&Edit Bookmarks..."
-#~ msgstr "&Uredi oznake…"
-
-#~ msgid "&Spelling..."
-#~ msgstr "&Pravopis…"
-
-#~ msgid "Show &Toolbar"
-#~ msgstr "Prikaži &alatnu traku"
-
-#~ msgid "&Save Settings"
-#~ msgstr "&Spremi postavke"
-
-#~ msgid "Configure S&hortcuts..."
-#~ msgstr "Podešavanje &prečaca…"
-
-#~ msgid "&Configure %1..."
-#~ msgstr "&Podešavanje %1… |/| &Podešavanje $[gen %1]"
-
-#~ msgid "Configure Tool&bars..."
-#~ msgstr "Podšavanje trake s &alatima…"
-
-#~ msgid "Configure &Notifications..."
-#~ msgstr "Podešava&nje obavijesti…"
-
-#~ msgid "What's &This?"
-#~ msgstr "Š&to je ovo?"
-
-#~ msgid "Tip of the &Day"
-#~ msgstr "Savjet &dana"
-
-#~ msgid "No such function \"%1\""
-#~ msgstr "Nema takve funkcije \"%1\""
-
-#~ msgid "am"
-#~ msgstr "am"
-
-#~ msgid "pm"
-#~ msgstr "pm"
-
-#~ msgctxt "@item font"
-#~ msgid "Regular"
-#~ msgstr "Običan"
-
-#, fuzzy
-#~| msgid "Next year"
-#~ msgctxt "@option next week"
-#~ msgid "Next week"
-#~ msgstr "Sljedeća godina"
-
-#, fuzzy
-#~| msgctxt ""
-#~| "referring to a filter on the modification and usage date of files/"
-#~| "resources"
-#~| msgid "Last Week"
-#~ msgctxt "@option last week"
-#~ msgid "Last week"
-#~ msgstr "Prošlog tjedna"
-
-#, fuzzy
-#~| msgid "Today"
-#~ msgctxt "@info/plain"
-#~ msgid "today"
-#~ msgstr "Danas"
diff -Nru kde-l10n-hr-4.12.97/messages/frameworks/kio5.po kde-l10n-hr-4.13.0/messages/frameworks/kio5.po
--- kde-l10n-hr-4.12.97/messages/frameworks/kio5.po 2014-01-25 21:41:22.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/frameworks/kio5.po 1970-01-01 00:00:00.000000000 +0000
@@ -1,8199 +0,0 @@
-# Translation of kio4 to Croatian
-#
-# Translators: Darko Bednjanec ,Denis Lackovic ,Diana Ćorluka ,Hrvoje Spoljar ,Igor Jagec ,Robert Pezer ,Vedran Rodic ,
-# Andrej Dundović , 2009, 2010.
-# DoDo , 2009.
-# Andrej Dundovic , 2009, 2010.
-# Marko Dimjasevic , 2009, 2010, 2011.
-# Marko Dimjašević , 2011.
-msgid ""
-msgstr ""
-"Project-Id-Version: kio4 0\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2014-01-24 18:50+0000\n"
-"PO-Revision-Date: 2011-07-22 16:13+0200\n"
-"Last-Translator: Marko Dimjašević \n"
-"Language-Team: Croatian \n"
-"Language: hr\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n"
-"%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"X-Generator: Lokalize 1.2\n"
-"X-Environment: kde\n"
-"X-Accelerator-Marker: &\n"
-"X-Text-Markup: kde4\n"
-
-#: autotests/jobtest.cpp:1035
-#, fuzzy
-#| msgid "1 day %2"
-#| msgid_plural "%1 days %2"
-msgid "1 day 23:59:00"
-msgstr "%1 dan %2"
-
-#: autotests/jobtest.cpp:1040
-msgid "00:00:50"
-msgstr ""
-
-#: src/core/chmodjob.cpp:204
-#, fuzzy, kde-format
-#| msgid "Could not change ownership for %1."
-msgid "Could not modify the ownership of file %1"
-msgstr "Nije moguće promijeniti vlasništvo od %1."
-
-#: src/core/chmodjob.cpp:206
-#, kde-format
-msgid ""
-"Could not modify the ownership of file %1 . You have insufficient "
-"access to the file to perform the change. "
-msgstr ""
-"Nije moguće promijeniti vlasništvo nad datotekom %1 . Nemate "
-"dovoljan pristup datoteci da bi učinili promjene. "
-
-#: src/core/copyjob.cpp:1081 src/core/job_error.cpp:503
-msgid "Folder Already Exists"
-msgstr "Direktorij već postoji"
-
-#: src/core/copyjob.cpp:1350 src/core/copyjob.cpp:1916
-#: src/core/filecopyjob.cpp:360 src/core/job_error.cpp:493
-#: src/widgets/paste.cpp:109
-msgid "File Already Exists"
-msgstr "Datoteka već postoji"
-
-#: src/core/copyjob.cpp:1350 src/core/copyjob.cpp:1916
-msgid "Already Exists as Folder"
-msgstr "Već postoji kao mapa"
-
-#: src/core/global.cpp:79
-#, kde-format
-msgctxt "size in bytes"
-msgid "%1 B"
-msgstr ""
-
-#: src/core/global.cpp:83
-#, fuzzy, kde-format
-#| msgid " %1 kB/s "
-msgctxt "size in 1000 bytes"
-msgid "%1 kB"
-msgstr " %1 kB/s "
-
-#: src/core/global.cpp:84
-#, fuzzy, kde-format
-#| msgid "%1 MB"
-msgctxt "size in 10^6 bytes"
-msgid "%1 MB"
-msgstr "%1 MB"
-
-#: src/core/global.cpp:85
-#, fuzzy, kde-format
-#| msgid "%1 GB"
-msgctxt "size in 10^9 bytes"
-msgid "%1 GB"
-msgstr "%1 GB"
-
-#: src/core/global.cpp:86
-#, fuzzy, kde-format
-#| msgid "%1 TB"
-msgctxt "size in 10^12 bytes"
-msgid "%1 TB"
-msgstr "%1 TB"
-
-#: src/core/global.cpp:87
-#, kde-format
-msgctxt "size in 10^15 bytes"
-msgid "%1 PB"
-msgstr ""
-
-#: src/core/global.cpp:88
-#, kde-format
-msgctxt "size in 10^18 bytes"
-msgid "%1 EB"
-msgstr ""
-
-#: src/core/global.cpp:89
-#, kde-format
-msgctxt "size in 10^21 bytes"
-msgid "%1 ZB"
-msgstr ""
-
-#: src/core/global.cpp:90
-#, kde-format
-msgctxt "size in 10^24 bytes"
-msgid "%1 YB"
-msgstr ""
-
-#: src/core/global.cpp:94
-#, fuzzy, kde-format
-#| msgid "%1 KB"
-msgctxt "memory size in 1024 bytes"
-msgid "%1 KB"
-msgstr "%1 KB"
-
-#: src/core/global.cpp:95
-#, fuzzy, kde-format
-#| msgid "%1 MB"
-msgctxt "memory size in 2^20 bytes"
-msgid "%1 MB"
-msgstr "%1 MB"
-
-#: src/core/global.cpp:96
-#, fuzzy, kde-format
-#| msgid "%1 GB"
-msgctxt "memory size in 2^30 bytes"
-msgid "%1 GB"
-msgstr "%1 GB"
-
-#: src/core/global.cpp:97
-#, fuzzy, kde-format
-#| msgid "%1 TB"
-msgctxt "memory size in 2^40 bytes"
-msgid "%1 TB"
-msgstr "%1 TB"
-
-#: src/core/global.cpp:98
-#, kde-format
-msgctxt "memory size in 2^50 bytes"
-msgid "%1 PB"
-msgstr ""
-
-#: src/core/global.cpp:99
-#, kde-format
-msgctxt "memory size in 2^60 bytes"
-msgid "%1 EB"
-msgstr ""
-
-#: src/core/global.cpp:100
-#, kde-format
-msgctxt "memory size in 2^70 bytes"
-msgid "%1 ZB"
-msgstr ""
-
-#: src/core/global.cpp:101
-#, kde-format
-msgctxt "memory size in 2^80 bytes"
-msgid "%1 YB"
-msgstr ""
-
-#: src/core/global.cpp:106
-#, fuzzy, kde-format
-#| msgid "%1 KB"
-msgctxt "size in 1024 bytes"
-msgid "%1 KiB"
-msgstr "%1 KB"
-
-#: src/core/global.cpp:107
-#, fuzzy, kde-format
-#| msgid "%1 MB"
-msgctxt "size in 2^20 bytes"
-msgid "%1 MiB"
-msgstr "%1 MB"
-
-#: src/core/global.cpp:108
-#, fuzzy, kde-format
-#| msgid "%1 GB"
-msgctxt "size in 2^30 bytes"
-msgid "%1 GiB"
-msgstr "%1 GB"
-
-#: src/core/global.cpp:109
-#, fuzzy, kde-format
-#| msgid "%1 TB"
-msgctxt "size in 2^40 bytes"
-msgid "%1 TiB"
-msgstr "%1 TB"
-
-#: src/core/global.cpp:110
-#, kde-format
-msgctxt "size in 2^50 bytes"
-msgid "%1 PiB"
-msgstr ""
-
-#: src/core/global.cpp:111
-#, kde-format
-msgctxt "size in 2^60 bytes"
-msgid "%1 EiB"
-msgstr ""
-
-#: src/core/global.cpp:112
-#, kde-format
-msgctxt "size in 2^70 bytes"
-msgid "%1 ZiB"
-msgstr ""
-
-#: src/core/global.cpp:113
-#, kde-format
-msgctxt "size in 2^80 bytes"
-msgid "%1 YiB"
-msgstr ""
-
-#: src/core/global.cpp:173
-#, kde-format
-msgid "1 day %2"
-msgid_plural "%1 days %2"
-msgstr[0] "%1 dan %2"
-msgstr[1] "%1 dana %2"
-msgstr[2] "%1 dana %2"
-
-#: src/core/global.cpp:208 src/core/global.cpp:225
-#, kde-format
-msgid "%1 Item"
-msgid_plural "%1 Items"
-msgstr[0] "%1 stavka"
-msgstr[1] "%1 stavke"
-msgstr[2] "%1 stavaka"
-
-#: src/core/global.cpp:212
-#, kde-format
-msgid "1 Folder"
-msgid_plural "%1 Folders"
-msgstr[0] "%1 mapa"
-msgstr[1] "%1 mape"
-msgstr[2] "%1 mapa"
-
-#: src/core/global.cpp:213
-#, kde-format
-msgid "1 File"
-msgid_plural "%1 Files"
-msgstr[0] "%1 datoteka"
-msgstr[1] "%1 datoteke"
-msgstr[2] "%1 datoteka"
-
-#: src/core/global.cpp:216
-#, kde-format
-msgctxt "folders, files (size)"
-msgid "%1, %2 (%3)"
-msgstr "%1, %2 (%3)"
-
-#: src/core/global.cpp:217
-#, kde-format
-msgctxt "folders, files"
-msgid "%1, %2"
-msgstr "%1, %2"
-
-#: src/core/global.cpp:219
-#, kde-format
-msgctxt "files (size)"
-msgid "%1 (%2)"
-msgstr "%1 (%2)"
-
-#: src/core/global.cpp:226
-#, kde-format
-msgctxt "items: folders, files (size)"
-msgid "%1: %2"
-msgstr "%1: %2"
-
-#: src/core/job.cpp:108
-msgctxt "@title job"
-msgid "Moving"
-msgstr "Premještanje"
-
-#: src/core/job.cpp:109 src/core/job.cpp:116 src/core/job.cpp:141
-#: src/widgets/fileundomanager.cpp:130
-msgctxt "The source of a file operation"
-msgid "Source"
-msgstr "Izvor"
-
-#: src/core/job.cpp:110 src/core/job.cpp:117
-#: src/widgets/fileundomanager.cpp:131
-msgctxt "The destination of a file operation"
-msgid "Destination"
-msgstr "Odredište"
-
-#: src/core/job.cpp:115
-msgctxt "@title job"
-msgid "Copying"
-msgstr "Kopiranje"
-
-#: src/core/job.cpp:122
-msgctxt "@title job"
-msgid "Creating directory"
-msgstr "Stvaranje direktorija"
-
-#: src/core/job.cpp:123 src/widgets/fileundomanager.cpp:125
-msgid "Directory"
-msgstr "Direktorij"
-
-#: src/core/job.cpp:128
-msgctxt "@title job"
-msgid "Deleting"
-msgstr "Brisanje"
-
-#: src/core/job.cpp:129 src/core/job.cpp:135
-#: src/widgets/fileundomanager.cpp:136
-msgid "File"
-msgstr "Datoteka"
-
-#: src/core/job.cpp:134
-msgctxt "@title job"
-msgid "Examining"
-msgstr "Ispitivanje"
-
-#: src/core/job.cpp:140
-msgctxt "@title job"
-msgid "Transferring"
-msgstr "Prenošenje"
-
-#: src/core/job.cpp:146
-msgctxt "@title job"
-msgid "Mounting"
-msgstr "Montiranje"
-
-#: src/core/job.cpp:147
-msgid "Device"
-msgstr "Uređaj"
-
-#: src/core/job.cpp:148 src/core/job.cpp:154
-msgid "Mountpoint"
-msgstr "Točka montiranja"
-
-#: src/core/job.cpp:153
-msgctxt "@title job"
-msgid "Unmounting"
-msgstr "Demontiranje"
-
-#: src/core/job_error.cpp:37
-#, kde-format
-msgid "Could not read %1."
-msgstr "Nije moguće čitati %1."
-
-#: src/core/job_error.cpp:40
-#, kde-format
-msgid "Could not write to %1."
-msgstr "Nije moguće pisati u %1."
-
-#: src/core/job_error.cpp:43
-#, kde-format
-msgid "Could not start process %1."
-msgstr "Nije moguće pokrenuti proces %1."
-
-#: src/core/job_error.cpp:46
-#, kde-format
-msgid ""
-"Internal Error\n"
-"Please send a full bug report at http://bugs.kde.org\n"
-"%1"
-msgstr ""
-"Interna pogreška\n"
-"Molim ispunite izvješće o grešci na http://bugs.kde.org\n"
-"%1"
-
-#: src/core/job_error.cpp:49
-#, kde-format
-msgid "Malformed URL %1."
-msgstr "Neispravan URL %1."
-
-#: src/core/job_error.cpp:52
-#, kde-format
-msgid "The protocol %1 is not supported."
-msgstr "Protokol %1 nije podržan."
-
-#: src/core/job_error.cpp:55
-#, kde-format
-msgid "The protocol %1 is only a filter protocol."
-msgstr "Protokol %1 je samo filter protokol."
-
-#: src/core/job_error.cpp:62
-#, kde-format
-msgid "%1 is a folder, but a file was expected."
-msgstr "%1 je direktorij, međutim očekivana je datoteka."
-
-#: src/core/job_error.cpp:65
-#, kde-format
-msgid "%1 is a file, but a folder was expected."
-msgstr "%1 je datoteka, međutim očekivan je direktorij."
-
-#: src/core/job_error.cpp:68
-#, kde-format
-msgid "The file or folder %1 does not exist."
-msgstr "Navedena datoteka ili direktorij %1 ne postoji."
-
-#: src/core/job_error.cpp:71
-#, kde-format
-msgid "A file named %1 already exists."
-msgstr "Datoteka s nazivom %1 već postoji."
-
-#: src/core/job_error.cpp:74
-#, kde-format
-msgid "A folder named %1 already exists."
-msgstr "Direktorij naziva %1 već postoji."
-
-#: src/core/job_error.cpp:77
-msgid "No hostname specified."
-msgstr "Niste naveli poslužitelja."
-
-#: src/core/job_error.cpp:77
-#, kde-format
-msgid "Unknown host %1"
-msgstr "Nepoznato računalo %1"
-
-#: src/core/job_error.cpp:80
-#, kde-format
-msgid "Access denied to %1."
-msgstr "Zabranjen pristup k %1."
-
-#: src/core/job_error.cpp:83
-#, kde-format
-msgid ""
-"Access denied.\n"
-"Could not write to %1."
-msgstr ""
-"Pristup odbijen.\n"
-"Nije moguće pisati u %1."
-
-#: src/core/job_error.cpp:86
-#, kde-format
-msgid "Could not enter folder %1."
-msgstr "Nije moguće ući u direktorij %1."
-
-#: src/core/job_error.cpp:89
-#, kde-format
-msgid "The protocol %1 does not implement a folder service."
-msgstr "Protokol %1 ne immplementira direktorijski servis."
-
-#: src/core/job_error.cpp:92
-#, kde-format
-msgid "Found a cyclic link in %1."
-msgstr "Nađen kružni link u %1."
-
-#: src/core/job_error.cpp:98
-#, kde-format
-msgid "Found a cyclic link while copying %1."
-msgstr "Nađen kružni link prilikom kopiranja %1."
-
-#: src/core/job_error.cpp:101
-#, kde-format
-msgid "Could not create socket for accessing %1."
-msgstr "Nije moguće stvoriti utičnicu za pristup %1."
-
-#: src/core/job_error.cpp:104
-#, kde-format
-msgid "Could not connect to host %1."
-msgstr "Nije se moguće spojiti na host %1."
-
-#: src/core/job_error.cpp:107
-#, kde-format
-msgid "Connection to host %1 is broken."
-msgstr "Veza prema hostu %1 je prekinuta."
-
-#: src/core/job_error.cpp:110
-#, kde-format
-msgid "The protocol %1 is not a filter protocol."
-msgstr "Protokol %1 nije filtar protokol."
-
-#: src/core/job_error.cpp:113
-#, kde-format
-msgid ""
-"Could not mount device.\n"
-"The reported error was:\n"
-"%1"
-msgstr ""
-"Ne mogu montirati uređaj.\n"
-"Prijavljena greška je:\n"
-"%1"
-
-#: src/core/job_error.cpp:116
-#, kde-format
-msgid ""
-"Could not unmount device.\n"
-"The reported error was:\n"
-"%1"
-msgstr ""
-"Ne mogu odmontirati uređaj.\n"
-"Prijavljena greška je:\n"
-"%1"
-
-#: src/core/job_error.cpp:119
-#, kde-format
-msgid "Could not read file %1."
-msgstr "Nije moguće čitati datoteku %1."
-
-#: src/core/job_error.cpp:122
-#, kde-format
-msgid "Could not write to file %1."
-msgstr "Nije moguće pisati u datoteku %1."
-
-#: src/core/job_error.cpp:125
-#, kde-format
-msgid "Could not bind %1."
-msgstr "Nije moguće dodijeliti vrijednost %1."
-
-#: src/core/job_error.cpp:128
-#, kde-format
-msgid "Could not listen %1."
-msgstr "Nije moguće slušati %1."
-
-#: src/core/job_error.cpp:131
-#, kde-format
-msgid "Could not accept %1."
-msgstr "Nije moguće prihvatiti %1."
-
-#: src/core/job_error.cpp:137
-#, kde-format
-msgid "Could not access %1."
-msgstr "Nije moguće pristupiti %1."
-
-#: src/core/job_error.cpp:140
-#, kde-format
-msgid "Could not terminate listing %1."
-msgstr "Nije moguće prekinuti listanje %1."
-
-#: src/core/job_error.cpp:143
-#, kde-format
-msgid "Could not make folder %1."
-msgstr "Nije moguće napraviti mapu %1."
-
-#: src/core/job_error.cpp:146
-#, kde-format
-msgid "Could not remove folder %1."
-msgstr "Nije moguće ukloniti mapu %1."
-
-#: src/core/job_error.cpp:149
-#, kde-format
-msgid "Could not resume file %1."
-msgstr "Nije moguće nastaviti datoteku %1."
-
-#: src/core/job_error.cpp:152
-#, kde-format
-msgid "Could not rename file %1."
-msgstr "Nije moguće preimenovati datoteku %1."
-
-#: src/core/job_error.cpp:155
-#, kde-format
-msgid "Could not change permissions for %1."
-msgstr "Nije moguće promijeniti dozvole za %1."
-
-#: src/core/job_error.cpp:158
-#, kde-format
-msgid "Could not change ownership for %1."
-msgstr "Nije moguće promijeniti vlasništvo od %1."
-
-#: src/core/job_error.cpp:161
-#, kde-format
-msgid "Could not delete file %1."
-msgstr "Nije moguće izbrisati datoteku %1."
-
-#: src/core/job_error.cpp:164
-#, kde-format
-msgid "The process for the %1 protocol died unexpectedly."
-msgstr "Proces za protokol %1 je neočekivano umro."
-
-#: src/core/job_error.cpp:167
-#, kde-format
-msgid ""
-"Error. Out of memory.\n"
-"%1"
-msgstr ""
-"Greška: ponestalo memorije.\n"
-"%1"
-
-#: src/core/job_error.cpp:170
-#, kde-format
-msgid ""
-"Unknown proxy host\n"
-"%1"
-msgstr ""
-"Nepoznato proxy računalo\n"
-"%1"
-
-#: src/core/job_error.cpp:173
-#, kde-format
-msgid "Authorization failed, %1 authentication not supported"
-msgstr "Provjera vjerodostojnosti nije uspjela, %1 provjeravanje nije podržano"
-
-#: src/core/job_error.cpp:176
-#, kde-format
-msgid ""
-"User canceled action\n"
-"%1"
-msgstr ""
-"Akciju zaustavio korisnik\n"
-"%1"
-
-#: src/core/job_error.cpp:179
-#, kde-format
-msgid ""
-"Internal error in server\n"
-"%1"
-msgstr ""
-"Interna greška na poslužitelju\n"
-"%1"
-
-#: src/core/job_error.cpp:182
-#, kde-format
-msgid ""
-"Timeout on server\n"
-"%1"
-msgstr ""
-"Prekoračenje vremena na poslužitelju\n"
-"%1"
-
-#: src/core/job_error.cpp:185
-#, kde-format
-msgid ""
-"Unknown error\n"
-"%1"
-msgstr ""
-"Nepoznata greška\n"
-"%1"
-
-#: src/core/job_error.cpp:188
-#, kde-format
-msgid ""
-"Unknown interrupt\n"
-"%1"
-msgstr ""
-"Nepoznat prekid\n"
-"%1"
-
-#: src/core/job_error.cpp:199
-#, kde-format
-msgid ""
-"Could not delete original file %1.\n"
-"Please check permissions."
-msgstr ""
-"Ne mogu izbrisati izvornu datoteku %1.\n"
-"Molim provjerite ovlasti."
-
-#: src/core/job_error.cpp:202
-#, kde-format
-msgid ""
-"Could not delete partial file %1.\n"
-"Please check permissions."
-msgstr ""
-"Ne mogu izbrisati parcijalnu datoteku %1.\n"
-"Molim provjerite ovlasti."
-
-#: src/core/job_error.cpp:205
-#, kde-format
-msgid ""
-"Could not rename original file %1.\n"
-"Please check permissions."
-msgstr ""
-"Ne mogu promijeniti naziv originalne datoteke %1.\n"
-"Molim provjerite ovlasti."
-
-#: src/core/job_error.cpp:208
-#, kde-format
-msgid ""
-"Could not rename partial file %1.\n"
-"Please check permissions."
-msgstr ""
-"Ne mogu promijeniti naziv djelomične datoteke %1.\n"
-"Molim provjerite ovlasti."
-
-#: src/core/job_error.cpp:211
-#, kde-format
-msgid ""
-"Could not create symlink %1.\n"
-"Please check permissions."
-msgstr ""
-"Ne mogu stvoriti simboličku vezu %1.\n"
-"Molim provjerite ovlasti."
-
-#: src/core/job_error.cpp:217
-#, kde-format
-msgid ""
-"Could not write file %1.\n"
-"Disk full."
-msgstr ""
-"Ne mogu zapisati u datoteku %1.\n"
-"Disk je popunjen."
-
-#: src/core/job_error.cpp:220
-#, kde-format
-msgid ""
-"The source and destination are the same file.\n"
-"%1"
-msgstr ""
-"Izvorna i ciljna datoteka su iste.\n"
-"%1"
-
-#: src/core/job_error.cpp:226
-#, kde-format
-msgid "%1 is required by the server, but is not available."
-msgstr "Poslužitelj potražuje %1, no to nije dostupno."
-
-#: src/core/job_error.cpp:229
-msgid "Access to restricted port in POST denied."
-msgstr "Odbijen pristup ograničenom portu u POST-u."
-
-#: src/core/job_error.cpp:232
-msgid ""
-"The required content size information was not provided for a POST operation."
-msgstr ""
-"Tražene informacije o veličini sadržaja nisu pružene za operaciju POST."
-
-#: src/core/job_error.cpp:235
-#, kde-format
-msgid ""
-"Unknown error code %1\n"
-"%2\n"
-"Please send a full bug report at http://bugs.kde.org."
-msgstr ""
-"Nepoznati kod greške %1\n"
-"%2\n"
-"Molim prijavite grešku na http://bugs.kde.org."
-
-#: src/core/job_error.cpp:260
-msgctxt "@info url"
-msgid "(unknown)"
-msgstr "(nepoznat)"
-
-#: src/core/job_error.cpp:267
-#, kde-format
-msgctxt "@info %1 error name, %2 description"
-msgid "%1
%2
"
-msgstr "%1
%2
"
-
-#: src/core/job_error.cpp:271
-msgid "Technical reason : "
-msgstr "Tehnička pogreška : "
-
-#: src/core/job_error.cpp:273
-msgid "Details of the request :"
-msgstr "Detalji zahtjeva :"
-
-#: src/core/job_error.cpp:274
-#, kde-format
-msgid "URL: %1 "
-msgstr "URL: %1 "
-
-#: src/core/job_error.cpp:276
-#, kde-format
-msgid "Protocol: %1 "
-msgstr "Protokol: %1 "
-
-#: src/core/job_error.cpp:278
-#, kde-format
-msgid "Date and time: %1 "
-msgstr "Nadnevak i vrijeme: %1 "
-
-#: src/core/job_error.cpp:279
-#, kde-format
-msgid "Additional information: %1 "
-msgstr "Dodatne informacije: %1 "
-
-#: src/core/job_error.cpp:282
-msgid "Possible causes :"
-msgstr "Mogući uzroci :"
-
-#: src/core/job_error.cpp:287
-msgid "Possible solutions :"
-msgstr "Moguća rješenja :"
-
-#: src/core/job_error.cpp:321
-msgctxt "@info protocol"
-msgid "(unknown)"
-msgstr "(nepoznat)"
-
-#: src/core/job_error.cpp:330
-msgid ""
-"Contact your appropriate computer support system, whether the system "
-"administrator, or technical support group for further assistance."
-msgstr ""
-"Posavjetujte se sa službom za podršku ili vašim administratorom sustava ili "
-"sa odgovarajućom službom za pomoć."
-
-#: src/core/job_error.cpp:333
-msgid "Contact the administrator of the server for further assistance."
-msgstr "Kontaktirajte administratora poslužitelja za daljnju pomoć."
-
-#: src/core/job_error.cpp:336
-msgid "Check your access permissions on this resource."
-msgstr "Provjerite vaše ovlasti za pristup ovom resursu."
-
-#: src/core/job_error.cpp:337
-msgid ""
-"Your access permissions may be inadequate to perform the requested operation "
-"on this resource."
-msgstr ""
-"Vaše ovlasti nisu dovoljne za izvršavanje traženog postupka na ovom resursu."
-
-#: src/core/job_error.cpp:339
-msgid ""
-"The file may be in use (and thus locked) by another user or application."
-msgstr ""
-"Datoteka je zauzeta (pa stoga i zaključana) od strane druge aplikacije."
-
-#: src/core/job_error.cpp:341
-msgid ""
-"Check to make sure that no other application or user is using the file or "
-"has locked the file."
-msgstr ""
-"Provjerite, možda druga aplikacija koristi datoteku, pa je zbog toga "
-"zaključana."
-
-#: src/core/job_error.cpp:343
-msgid "Although unlikely, a hardware error may have occurred."
-msgstr "Iako malo vjerojatno, možda se dogodio kvar (greška) na uređaju."
-
-#: src/core/job_error.cpp:345
-msgid "You may have encountered a bug in the program."
-msgstr "Možda ste naišli na grešku u programu."
-
-#: src/core/job_error.cpp:346
-msgid ""
-"This is most likely to be caused by a bug in the program. Please consider "
-"submitting a full bug report as detailed below."
-msgstr ""
-"Ovo je najvjerojatnije uzrokovano greškom u programu. Molimo, razmislite o "
-"slanju izvješća o grešci, kako je dolje navedeno."
-
-#: src/core/job_error.cpp:348
-msgid ""
-"Update your software to the latest version. Your distribution should provide "
-"tools to update your software."
-msgstr ""
-"Obnovite vaše programe na posljednje inačice. Distribucija koju koristite bi "
-"trebala imati alate za taj postupak."
-
-#: src/core/job_error.cpp:350
-msgid ""
-"When all else fails, please consider helping the KDE team or the third party "
-"maintainer of this software by submitting a high quality bug report. If the "
-"software is provided by a third party, please contact them directly. "
-"Otherwise, first look to see if the same bug has been submitted by someone "
-"else by searching at the KDE bug reporting "
-"website . If not, take note of the details given above, and include them "
-"in your bug report, along with as many other details as you think might help."
-msgstr ""
-"Ako ništa drugo ne pomaže, razmislite o pomaganju KDE timu ili trećoj osobi "
-"koja radi na održavanju programa, tako što ćete poslati kvalitetno izvješće "
-"o grešci. Ako vam je program dala treća osoba, molimo da se javite istoj. U "
-"suprotnom, prvo pogledajte jeli već takva greška prijavljena, što možete "
-"vidjeti na adresi KDE bug reporting "
-"website . Ako nije, zabilježite gore navedene podatke i dodajte ih u "
-"svoje izvješće, zajedno sa svim ostalim detaljima za koje mislite da bi "
-"mogli pomoći."
-
-#: src/core/job_error.cpp:358
-msgid "There may have been a problem with your network connection."
-msgstr "Možda postoji problem sa vašom mrežnom vezom."
-
-#: src/core/job_error.cpp:361
-msgid ""
-"There may have been a problem with your network configuration. If you have "
-"been accessing the Internet with no problems recently, this is unlikely."
-msgstr ""
-"Možda postoji problem sa vašim mrežnim postavkama. To nije vjerojatno ako "
-"ste nedavno pristupali internetu bez teškoća."
-
-#: src/core/job_error.cpp:364
-msgid ""
-"There may have been a problem at some point along the network path between "
-"the server and this computer."
-msgstr ""
-"Možda postoji problem na nekom dijelu mrežne putanje između poslužitelja i "
-"ovog računala."
-
-#: src/core/job_error.cpp:366
-msgid "Try again, either now or at a later time."
-msgstr "Pokušajte ponovo, bilo sada ili kasnije."
-
-#: src/core/job_error.cpp:367
-msgid "A protocol error or incompatibility may have occurred."
-msgstr "Dogodila se greška ili nepodudarnost protokola."
-
-#: src/core/job_error.cpp:368
-msgid "Ensure that the resource exists, and try again."
-msgstr "Provjerite da resurs postoji i zatim probjate ponovo."
-
-#: src/core/job_error.cpp:369
-msgid "The specified resource may not exist."
-msgstr "Navedeno resurs možda ne postoji."
-
-#: src/core/job_error.cpp:370
-msgid "You may have incorrectly typed the location."
-msgstr "Možda ste neispravno unijeli lokaciju."
-
-#: src/core/job_error.cpp:371
-msgid "Double-check that you have entered the correct location and try again."
-msgstr ""
-"Dvaput provjerite jeste li ispravno unijeli lokaciju i zatim probajte ponovo."
-
-#: src/core/job_error.cpp:373
-msgid "Check your network connection status."
-msgstr "Provjerite stanje vaše veze s mrežom."
-
-#: src/core/job_error.cpp:377
-msgid "Cannot Open Resource For Reading"
-msgstr "Nemopgu otvoriti resurs za čitanje"
-
-#: src/core/job_error.cpp:378
-#, kde-format
-msgid ""
-"This means that the contents of the requested file or folder %1"
-"strong> could not be retrieved, as read access could not be obtained."
-msgstr ""
-"Ovo znači da se sadržaj zatražene datoteke ili mape %1 ne "
-"može dohvatiti, jer nije moguće dobiti pristup za čitanje."
-
-#: src/core/job_error.cpp:381
-msgid "You may not have permissions to read the file or open the folder."
-msgstr "Moguće je da nemate dozvole za čitanje datoteke ili otvaranje mape."
-
-#: src/core/job_error.cpp:387
-msgid "Cannot Open Resource For Writing"
-msgstr "Nemogu otvoriti resurs za pisanje"
-
-#: src/core/job_error.cpp:388
-#, kde-format
-msgid ""
-"This means that the file, %1 , could not be written to as "
-"requested, because access with permission to write could not be obtained."
-msgstr ""
-"To znači da u datoteku, %1 , nije moguće snimati, kako je "
-"zatraženo jer nemožete dobiti ovlasti pristupa istoj."
-
-#: src/core/job_error.cpp:396
-#, kde-format
-msgid "Cannot Initiate the %1 Protocol"
-msgstr "Ne mogu pokrenuti protokol %1"
-
-#: src/core/job_error.cpp:397
-msgid "Unable to Launch Process"
-msgstr "Ne mogu pokrenuti proces"
-
-#: src/core/job_error.cpp:398
-#, kde-format
-msgid ""
-"The program on your computer which provides access to the %1"
-"strong> protocol could not be started. This is usually due to technical "
-"reasons."
-msgstr ""
-"Program na vašem računalu, koji pruža pristup protokolu %1 , "
-"nije bilo moguće pokrenuti. To je obično radi tehničkih razloga."
-
-#: src/core/job_error.cpp:401
-msgid ""
-"The program which provides compatibility with this protocol may not have "
-"been updated with your last update of KDE. This can cause the program to be "
-"incompatible with the current version and thus not start."
-msgstr ""
-"Program koji pruža uslugu usklađivanja sa ovim protokolom možda nije "
-"nadograđen kod zadnje nadogradnje KDE-a. Zbog toga program nije usklađen sa "
-"sa inačicom koju koristite, pa ga nije moguće pokrenuti."
-
-#: src/core/job_error.cpp:409
-msgid "Internal Error"
-msgstr "Interna Greška"
-
-#: src/core/job_error.cpp:410
-#, kde-format
-msgid ""
-"The program on your computer which provides access to the %1"
-"strong> protocol has reported an internal error."
-msgstr ""
-"Program na vašem računalu, koji pruža pristup protokolu %1 , "
-"prijavio je internu grešku."
-
-#: src/core/job_error.cpp:418
-msgid "Improperly Formatted URL"
-msgstr "Nepravilno oblikovan URL"
-
-#: src/core/job_error.cpp:419
-msgid ""
-"The U niform R esource L"
-"strong>ocator (URL) that you entered was not properly formatted. The format "
-"of a URL is generally as follows:protocol://user:"
-"password@www.example.org:port/folder/filename.extension?query=value"
-"strong> "
-msgstr ""
-"U niformni R esursni L"
-"strong>okator (URL) koji ste unijeli nije pravilno oblikovan. Oblik URL-a "
-"obično izgleda: protokol://korisnik:zaporka@www.primjer."
-"org:port/mapa/datoteka.nastavak?upit=vrijednost "
-
-#: src/core/job_error.cpp:428
-#, kde-format
-msgid "Unsupported Protocol %1"
-msgstr "Nepodržani protokol %1"
-
-#: src/core/job_error.cpp:429
-#, kde-format
-msgid ""
-"The protocol %1 is not supported by the KDE programs "
-"currently installed on this computer."
-msgstr ""
-"Protokol %1 , nije podržan od strane KDE programa koji su "
-"trenutno postavljeni na ovom računalu."
-
-#: src/core/job_error.cpp:432
-msgid "The requested protocol may not be supported."
-msgstr "Zahtijevani protokol nije podržan."
-
-#: src/core/job_error.cpp:433
-#, kde-format
-msgid ""
-"The versions of the %1 protocol supported by this computer and the server "
-"may be incompatible."
-msgstr ""
-"Inačice protokola %1 , koju podržava ovo računalo i "
-"poslužitelj nisu međusobno sukladne."
-
-#: src/core/job_error.cpp:435
-msgid ""
-"You may perform a search on the Internet for a KDE program (called a "
-"kioslave or ioslave) which supports this protocol. Places to search include "
-"http://kde-apps.org/ and http://freshmeat.net/ ."
-msgstr ""
-"Možete pretražiti Internet za KDE programe (zvane kioslave ili ioslave) koje "
-"podržavaju ovaj protokol. Mjesta koja ulaze u pretragu su http://kde-apps.org/ i http://freshmeat.net/ ."
-
-#: src/core/job_error.cpp:444
-msgid "URL Does Not Refer to a Resource."
-msgstr "URL se ne odnosi na resurs."
-
-#: src/core/job_error.cpp:445
-msgid "Protocol is a Filter Protocol"
-msgstr "Protokol nije filter protokol"
-
-#: src/core/job_error.cpp:446
-msgid ""
-"The U niform R esource L"
-"strong>ocator (URL) that you entered did not refer to a specific resource."
-msgstr ""
-"U niformni R esursni L"
-"strong>okator (URL) koji ste unijeli ne upućuje na poseban resurs."
-
-#: src/core/job_error.cpp:449
-msgid ""
-"KDE is able to communicate through a protocol within a protocol; the "
-"protocol specified is only for use in such situations, however this is not "
-"one of these situations. This is a rare event, and is likely to indicate a "
-"programming error."
-msgstr ""
-"KDE može komunicirati kroz protkol unutar protokola; nevedni protokol se "
-"koristi samo u određenim situacijama, ali ovo nije jedna od njih. To se "
-"rijetko događa i stoga upućuje na grešku u programiranju."
-
-#: src/core/job_error.cpp:457
-#, kde-format
-msgid "Unsupported Action: %1"
-msgstr "Nepodržani postupak: %1"
-
-#: src/core/job_error.cpp:458
-#, kde-format
-msgid ""
-"The requested action is not supported by the KDE program which is "
-"implementing the %1 protocol."
-msgstr ""
-"Zahtjevani postupak nije podržan od strane KDE programa koji opslužuje "
-"protokol %1 ."
-
-#: src/core/job_error.cpp:461
-msgid ""
-"This error is very much dependent on the KDE program. The additional "
-"information should give you more information than is available to the KDE "
-"input/output architecture."
-msgstr ""
-"Ova greška je vrlo ovisna o KDE programu. Dodatne informacije vam mogu dati "
-"više dostupnih podataka o KDE ulazno/izlaznoj arhitekturi."
-
-#: src/core/job_error.cpp:464
-msgid "Attempt to find another way to accomplish the same outcome."
-msgstr "Pokušaj nalaženja drugog postupka koji bi dao isti rezultat."
-
-#: src/core/job_error.cpp:469
-msgid "File Expected"
-msgstr "Očekivana je datoteka"
-
-#: src/core/job_error.cpp:470
-#, kde-format
-msgid ""
-"The request expected a file, however the folder %1 was "
-"found instead."
-msgstr ""
-"Zahtjev je očekivao datoteku, no direktorij %1 je pronađen."
-
-#: src/core/job_error.cpp:472
-msgid "This may be an error on the server side."
-msgstr "Čini se da je greška na poslužitelju."
-
-#: src/core/job_error.cpp:477
-msgid "Folder Expected"
-msgstr "Očekivan je direktorij"
-
-#: src/core/job_error.cpp:478
-#, kde-format
-msgid ""
-"The request expected a folder, however the file %1 was "
-"found instead."
-msgstr "Zahtjevan je direktorij, a nađena je datoteka %1 ."
-
-#: src/core/job_error.cpp:485
-msgid "File or Folder Does Not Exist"
-msgstr "Navedeni direktorij ili datoteka ne postoji!"
-
-#: src/core/job_error.cpp:486
-#, kde-format
-msgid "The specified file or folder %1 does not exist."
-msgstr "Navedena datoteka ili direktorij %1 ne postoji."
-
-#: src/core/job_error.cpp:494
-msgid ""
-"The requested file could not be created because a file with the same name "
-"already exists."
-msgstr ""
-"Datoteku nije bilo moguće napraviti jer već postoji datoteka istog naziva."
-
-#: src/core/job_error.cpp:496
-msgid "Try moving the current file out of the way first, and then try again."
-msgstr ""
-"Pokušajte prvo premjestiti postojeću datoteku, pa onda pokušajte ponovo."
-
-#: src/core/job_error.cpp:498
-msgid "Delete the current file and try again."
-msgstr "Izbrišite postojeću datoteku i zatim probajte ponovo."
-
-#: src/core/job_error.cpp:499
-msgid "Choose an alternate filename for the new file."
-msgstr "Odaberite drugi naziv za novu datoteku."
-
-#: src/core/job_error.cpp:504
-msgid ""
-"The requested folder could not be created because a folder with the same "
-"name already exists."
-msgstr ""
-"Traženi direktorij nije mogao biti napravljen jer već postoji direktorij "
-"istog naziva."
-
-#: src/core/job_error.cpp:506
-msgid "Try moving the current folder out of the way first, and then try again."
-msgstr ""
-"Pokušajte prvo premjestiti postojeću datoteku, pa onda pokušajte ponovo."
-
-#: src/core/job_error.cpp:508
-msgid "Delete the current folder and try again."
-msgstr "Izbrišite postojeću mapu i isprobajte ponovo."
-
-#: src/core/job_error.cpp:509
-msgid "Choose an alternate name for the new folder."
-msgstr "Odaberite alternativni naziv za novi direktorij."
-
-#: src/core/job_error.cpp:513
-msgid "Unknown Host"
-msgstr "Nepoznato računalo"
-
-#: src/core/job_error.cpp:514
-#, kde-format
-msgid ""
-"An unknown host error indicates that the server with the requested name, "
-"%1 , could not be located on the Internet."
-msgstr ""
-"Greška 'nepoznato računalo' govori da poslužitelja naziva %1"
-"strong> nije moguće naći na Internetu."
-
-#: src/core/job_error.cpp:517
-#, kde-format
-msgid ""
-"The name that you typed, %1, may not exist: it may be incorrectly typed."
-msgstr ""
-"Naziv koje ste upisali, %1, možda ne postoji. Možda ste ga krivo upisali."
-
-#: src/core/job_error.cpp:524
-msgid "Access Denied"
-msgstr "Pristup odbijen"
-
-#: src/core/job_error.cpp:525
-#, kde-format
-msgid "Access was denied to the specified resource, %1 ."
-msgstr "Pristup nevedenom resursu %1 , je odbijen."
-
-#: src/core/job_error.cpp:527 src/core/job_error.cpp:753
-msgid "You may have supplied incorrect authentication details or none at all."
-msgstr ""
-"Moguće je da ste dali neisprave podatke za provjeru identiteta (šifru) ili "
-"ih niste uopće unijeli."
-
-#: src/core/job_error.cpp:529 src/core/job_error.cpp:755
-msgid "Your account may not have permission to access the specified resource."
-msgstr "Nemate ovlasti za pristup nevedenom resursu."
-
-#: src/core/job_error.cpp:531 src/core/job_error.cpp:757
-#: src/core/job_error.cpp:769
-msgid ""
-"Retry the request and ensure your authentication details are entered "
-"correctly."
-msgstr "Ponovite zahtjev i provjerite da ste šifru ispravno unijeli."
-
-#: src/core/job_error.cpp:539
-msgid "Write Access Denied"
-msgstr "Pristup za zapisivanje odbijen"
-
-#: src/core/job_error.cpp:540
-#, kde-format
-msgid ""
-"This means that an attempt to write to the file %1 was "
-"rejected."
-msgstr "To znči da je odbijen pokušaj snimanja datoteke %1 ."
-
-#: src/core/job_error.cpp:547
-msgid "Unable to Enter Folder"
-msgstr "Ne mogu ući u mapu"
-
-#: src/core/job_error.cpp:548
-#, kde-format
-msgid ""
-"This means that an attempt to enter (in other words, to open) the requested "
-"folder %1 was rejected."
-msgstr ""
-"Ovo znači da je odbijen zahtjev za ulazak u navedeni direktorij%1"
-"strong>."
-
-#: src/core/job_error.cpp:556
-msgid "Folder Listing Unavailable"
-msgstr "Popis direktorija nije dostupan"
-
-#: src/core/job_error.cpp:557
-#, kde-format
-msgid "Protocol %1 is not a Filesystem"
-msgstr "Protokol %1 nije datotečni sustav"
-
-#: src/core/job_error.cpp:558
-msgid ""
-"This means that a request was made which requires determining the contents "
-"of the folder, and the KDE program supporting this protocol is unable to do "
-"so."
-msgstr ""
-"Ovo znači da je napravljen zahtjev za ispisom direkotrija, a KDE program "
-"koji podržava ovaj protokol nije u mogućnosti ispisati ga."
-
-#: src/core/job_error.cpp:566
-msgid "Cyclic Link Detected"
-msgstr "Nađena ciklična veza"
-
-#: src/core/job_error.cpp:567
-msgid ""
-"UNIX environments are commonly able to link a file or folder to a separate "
-"name and/or location. KDE detected a link or series of links that results in "
-"an infinite loop - i.e. the file was (perhaps in a roundabout way) linked to "
-"itself."
-msgstr ""
-"Unix okruženja obično pružaju mogućnost stvaranja veza (linkova) datoteka i "
-"direktorija na nekim drugim mjestima. KDE je našao vezu ili niz veza koje "
-"tvore beskonačnu petlju. Npr. datoteka je vezana na samu sebe."
-
-#: src/core/job_error.cpp:571 src/core/job_error.cpp:593
-msgid ""
-"Delete one part of the loop in order that it does not cause an infinite "
-"loop, and try again."
-msgstr ""
-"Izbrišite dio petlje kako nebi došlo do stvaranja beskonačnih petlji i zatim "
-"probajte ponovo."
-
-#: src/core/job_error.cpp:580
-msgid "Request Aborted By User"
-msgstr "Zahtjev prekinut od strane korisnika"
-
-#: src/core/job_error.cpp:581 src/core/job_error.cpp:896
-msgid "The request was not completed because it was aborted."
-msgstr "Zahtjev nije ispunjen jer je prekinut."
-
-#: src/core/job_error.cpp:583 src/core/job_error.cpp:787
-#: src/core/job_error.cpp:898
-msgid "Retry the request."
-msgstr "Ponovi zahtjev."
-
-#: src/core/job_error.cpp:587
-msgid "Cyclic Link Detected During Copy"
-msgstr "Kružna veza otkrivena kod kopiranja"
-
-#: src/core/job_error.cpp:588
-msgid ""
-"UNIX environments are commonly able to link a file or folder to a separate "
-"name and/or location. During the requested copy operation, KDE detected a "
-"link or series of links that results in an infinite loop - i.e. the file was "
-"(perhaps in a roundabout way) linked to itself."
-msgstr ""
-"Unix okruženja obično pružaju mogućnost stvaranja veza (linkova) datoteka i "
-"direktorija na nekim drugim mjestima. Prilikom izvođenje kopiranja, KDE je "
-"našao vezu ili niz veza koje tvore beskonačnu petlju. Npr. datoteka je "
-"vezana na samu sebe."
-
-#: src/core/job_error.cpp:598
-msgid "Could Not Create Network Connection"
-msgstr "Ne mogu napraviti mrežnu vezu."
-
-#: src/core/job_error.cpp:599
-msgid "Could Not Create Socket"
-msgstr "Ne mogu napraviti priključak"
-
-#: src/core/job_error.cpp:600
-msgid ""
-"This is a fairly technical error in which a required device for network "
-"communications (a socket) could not be created."
-msgstr ""
-"Ovo je zapravo tehnička greška kod koje nije moguće napraviti priključak za "
-"otvaranje mrežne komunikacije."
-
-#: src/core/job_error.cpp:602 src/core/job_error.cpp:723
-#: src/core/job_error.cpp:734 src/core/job_error.cpp:743
-msgid ""
-"The network connection may be incorrectly configured, or the network "
-"interface may not be enabled."
-msgstr ""
-"Mrežna komunikacija možda nije ispravno podešena ili nije omogućeno mrežno "
-"sučelje."
-
-#: src/core/job_error.cpp:608
-msgid "Connection to Server Refused"
-msgstr "Odbijeno spajanje na poslužitelj."
-
-#: src/core/job_error.cpp:609
-#, kde-format
-msgid ""
-"The server %1 refused to allow this computer to make a "
-"connection."
-msgstr ""
-"Poslužitelj %1 odbija dozvoliti ovom računalu otvaranje "
-"veze."
-
-#: src/core/job_error.cpp:611
-msgid ""
-"The server, while currently connected to the Internet, may not be configured "
-"to allow requests."
-msgstr ""
-"Posliužitelj, iako ispravno spojen na internet, možda je podešen da ne "
-"dozvoli ovakve zahtjeve."
-
-#: src/core/job_error.cpp:613
-#, kde-format
-msgid ""
-"The server, while currently connected to the Internet, may not be running "
-"the requested service (%1)."
-msgstr ""
-"Posliužitelj, iako ispravno spojen na internet, možda ne podržava zahtjevanu "
-"uslugu (%1)."
-
-#: src/core/job_error.cpp:615
-msgid ""
-"A network firewall (a device which restricts Internet requests), either "
-"protecting your network or the network of the server, may have intervened, "
-"preventing this request."
-msgstr ""
-"Izgleda da je se upleo Mrežni vatrozid (uređaj/program koji ograničava "
-"zahtjeve na internetu) štiteći vašu mrežu ili mrežu poslužitelja."
-
-#: src/core/job_error.cpp:622
-msgid "Connection to Server Closed Unexpectedly"
-msgstr "Neočekivano prekinuta veza sa poslužiteljem."
-
-#: src/core/job_error.cpp:623
-#, kde-format
-msgid ""
-"Although a connection was established to %1 , the connection "
-"was closed at an unexpected point in the communication."
-msgstr ""
-"Iako je veza bila upostavljena s %1 , ona je zatvorena na "
-"neočekivanoj točki u komunikaciji."
-
-#: src/core/job_error.cpp:626
-msgid ""
-"A protocol error may have occurred, causing the server to close the "
-"connection as a response to the error."
-msgstr ""
-"Dogodila se greška u protokolu, zbog čega je poslužitelj, kao odgovor na "
-"grešku zatvorio vezu."
-
-#: src/core/job_error.cpp:632
-msgid "URL Resource Invalid"
-msgstr "Neipsravan URL."
-
-#: src/core/job_error.cpp:633
-#, kde-format
-msgid "Protocol %1 is not a Filter Protocol"
-msgstr "Protokol %1 nije filter protokol"
-
-#: src/core/job_error.cpp:634
-#, kde-format
-msgid ""
-"The U niform R esource L"
-"strong>ocator (URL) that you entered did not refer to a valid mechanism of "
-"accessing the specific resource, %1%2 ."
-msgstr ""
-"U niformni R esursni L"
-"strong>okator (URL) koji ste unijeli ne upućuje na valjan mehanizam "
-"pristupanja posebnom resursu, %1%2 ."
-
-#: src/core/job_error.cpp:639
-msgid ""
-"KDE is able to communicate through a protocol within a protocol. This "
-"request specified a protocol be used as such, however this protocol is not "
-"capable of such an action. This is a rare event, and is likely to indicate a "
-"programming error."
-msgstr ""
-"KDE može komunicirati kroz protkol unutar protokola. Ovaj zahtjev ne "
-"podržava navedeni postupak. To se rijetko događa i stoga upućuje na grešku u "
-"programiranju."
-
-#: src/core/job_error.cpp:647
-msgid "Unable to Initialize Input/Output Device"
-msgstr "Nemogu pokrenuti Ulazno/izlazni uređaj"
-
-#: src/core/job_error.cpp:648
-msgid "Could Not Mount Device"
-msgstr "Ne mogu montirati uređaj"
-
-#: src/core/job_error.cpp:649
-#, kde-format
-msgid ""
-"The requested device could not be initialized (\"mounted\"). The reported "
-"error was: %1 "
-msgstr ""
-"Zahtjevani uređaj nijemoguće pokrenuti (\"montirati\"). Prijavljena greška "
-"je :%1 "
-
-#: src/core/job_error.cpp:652
-msgid ""
-"The device may not be ready, for example there may be no media in a "
-"removable media device (i.e. no CD-ROM in a CD drive), or in the case of a "
-"peripheral/portable device, the device may not be correctly connected."
-msgstr ""
-"Uređaj nije spreman, npr. možda nema medija u izmjenjivom uređaju (npr. cr-"
-"rom, zip) ili u slučaju vanjskog uređaja koji možda nije uključen/spojen."
-
-#: src/core/job_error.cpp:656
-msgid ""
-"You may not have permissions to initialize (\"mount\") the device. On UNIX "
-"systems, often system administrator privileges are required to initialize a "
-"device."
-msgstr ""
-"Nemate dovoljno ovlasti za pokretanje (\"montiranje\") uređaja. Na UNIX "
-"sustavima, često su potrebne privilegija administratora sustava za "
-"pokretanje uređaja."
-
-#: src/core/job_error.cpp:660
-msgid ""
-"Check that the device is ready; removable drives must contain media, and "
-"portable devices must be connected and powered on.; and try again."
-msgstr ""
-"Provjerite jeli uređaj spreman; izmjenjivi uređaji/mediji i prijenosni "
-"uređaji moraju biti spojeni i uključeni; provjerite i zatim probajte ponovo."
-
-#: src/core/job_error.cpp:666
-msgid "Unable to Uninitialize Input/Output Device"
-msgstr "Nemogu pokrenuti ulazno/izlazni uređaj"
-
-#: src/core/job_error.cpp:667
-msgid "Could Not Unmount Device"
-msgstr "Ne mogu demontirati uređaj"
-
-#: src/core/job_error.cpp:668
-#, kde-format
-msgid ""
-"The requested device could not be uninitialized (\"unmounted\"). The "
-"reported error was: %1 "
-msgstr ""
-"Traženi uređaj nije moguće zaustaviti (\"demontirati\"). Prijavljena je "
-"greška : %1 "
-
-#: src/core/job_error.cpp:671
-msgid ""
-"The device may be busy, that is, still in use by another application or "
-"user. Even such things as having an open browser window on a location on "
-"this device may cause the device to remain in use."
-msgstr ""
-"Uređaj je vjerojatno zauzet, odnosno još ga uvijek koristi neki od programa "
-"ili korisnika. Čak i samo jedan prozor preglednika ili sličan pogled na "
-"uređaj može biti razlog zauzetosti uređaja."
-
-#: src/core/job_error.cpp:675
-msgid ""
-"You may not have permissions to uninitialize (\"unmount\") the device. On "
-"UNIX systems, system administrator privileges are often required to "
-"uninitialize a device."
-msgstr ""
-"Nemate ovlasti za zasutavljanje (\"demontiranja\") uređaja. Na UINX "
-"ssutavima, potrebno je imati ovlasti administratora sustava za zaustavljanje "
-"uređaja."
-
-#: src/core/job_error.cpp:679
-msgid "Check that no applications are accessing the device, and try again."
-msgstr "Provjerite, možda neki program koristi uređaj i zatim probajte ponovo."
-
-#: src/core/job_error.cpp:684
-msgid "Cannot Read From Resource"
-msgstr "Nemogu čitati iz resursa."
-
-#: src/core/job_error.cpp:685
-#, kde-format
-msgid ""
-"This means that although the resource, %1 , was able to be "
-"opened, an error occurred while reading the contents of the resource."
-msgstr ""
-"To znači da iako je resurs, %1 , otvoren, greška je nastala "
-"kod čitanja sadržaja resursa."
-
-#: src/core/job_error.cpp:688
-msgid "You may not have permissions to read from the resource."
-msgstr "Nemate ovlasti za čitanje resursa."
-
-#: src/core/job_error.cpp:701
-msgid "Cannot Write to Resource"
-msgstr "Nemogu pisati u resurs"
-
-#: src/core/job_error.cpp:702
-#, kde-format
-msgid ""
-"This means that although the resource, %1 , was able to be "
-"opened, an error occurred while writing to the resource."
-msgstr ""
-"Iako možete otvoriti resurs %1 , prijavljena je greška pri "
-"pokušaju pisanja u isti resurs."
-
-#: src/core/job_error.cpp:705
-msgid "You may not have permissions to write to the resource."
-msgstr "Možda nemate ovlasti za pisanje u resurs."
-
-#: src/core/job_error.cpp:718 src/core/job_error.cpp:729
-msgid "Could Not Listen for Network Connections"
-msgstr "Nemogu osluškivati veze s mrežom."
-
-#: src/core/job_error.cpp:719
-msgid "Could Not Bind"
-msgstr "Ne mogu se vezati"
-
-#: src/core/job_error.cpp:720 src/core/job_error.cpp:731
-msgid ""
-"This is a fairly technical error in which a required device for network "
-"communications (a socket) could not be established to listen for incoming "
-"network connections."
-msgstr ""
-"To je prilično tehnička greška kod koje traženi uređaj za mrežnu "
-"komunikaciju (priljučak) nije moguće uspostaviti za slušanje dolazećih "
-"zahtjeva za mrežno povezivanje."
-
-#: src/core/job_error.cpp:730
-msgid "Could Not Listen"
-msgstr "Ne mogu slušati"
-
-#: src/core/job_error.cpp:740
-msgid "Could Not Accept Network Connection"
-msgstr "Ne mogu primiti vezu sa mreže"
-
-#: src/core/job_error.cpp:741
-msgid ""
-"This is a fairly technical error in which an error occurred while attempting "
-"to accept an incoming network connection."
-msgstr ""
-"To je prilično tehnička greška kod koje dolazi do greške kada se pokuša "
-"primiti dolazeći zahtjev za mrežnim povezivanjem."
-
-#: src/core/job_error.cpp:745
-msgid "You may not have permissions to accept the connection."
-msgstr "Nemate ovlasti za prihvat takvog mrežnog povezivanja."
-
-#: src/core/job_error.cpp:750
-#, kde-format
-msgid "Could Not Login: %1"
-msgstr "Ne mogu se prijaviti na: %1."
-
-#: src/core/job_error.cpp:751
-msgid ""
-"An attempt to login to perform the requested operation was unsuccessful."
-msgstr "Pokušaj prijavljivanja radi zahtjevanog postupka nije bio uspješan."
-
-#: src/core/job_error.cpp:762
-msgid "Could Not Determine Resource Status"
-msgstr "Nisam mogao utrvditi stanje resrusa"
-
-#: src/core/job_error.cpp:763
-msgid "Could Not Stat Resource"
-msgstr "Ne mogu pratiti resurs"
-
-#: src/core/job_error.cpp:764
-#, kde-format
-msgid ""
-"An attempt to determine information about the status of the resource "
-"%1 , such as the resource name, type, size, etc., was unsuccessful."
-msgstr ""
-"Pokušaj da se odredi informacija o statusu resursa %1 , kao "
-"naziv resursa, vrsta, veličina itd., nije uspio."
-
-#: src/core/job_error.cpp:767
-msgid "The specified resource may not have existed or may not be accessible."
-msgstr "Izabrani resurs ne postoji ili nije dostupan."
-
-#: src/core/job_error.cpp:775
-msgid "Could Not Cancel Listing"
-msgstr "Nisam u stanju prekinuti ispis"
-
-#: src/core/job_error.cpp:776
-msgid "FIXME: Document this"
-msgstr "POPRAVIME: Dokumentiraj ovo"
-
-#: src/core/job_error.cpp:780
-msgid "Could Not Create Folder"
-msgstr "Ne mogu napraviti mapu"
-
-#: src/core/job_error.cpp:781
-msgid "An attempt to create the requested folder failed."
-msgstr "Pokušaj pravljenja traženog direktorija nije uspio."
-
-#: src/core/job_error.cpp:782
-msgid "The location where the folder was to be created may not exist."
-msgstr "Lokacija gdje se traži stvaranje direktorija, ne postoji."
-
-#: src/core/job_error.cpp:791
-msgid "Could Not Remove Folder"
-msgstr "Ne mogu ukloniti mapu"
-
-#: src/core/job_error.cpp:792
-#, kde-format
-msgid "An attempt to remove the specified folder, %1 , failed."
-msgstr "Pokušaj uklanjanja direkotorija %1 , nije uspio."
-
-#: src/core/job_error.cpp:794
-msgid "The specified folder may not exist."
-msgstr "Navedeni direktorij vjerojatno ne postoji."
-
-#: src/core/job_error.cpp:795
-msgid "The specified folder may not be empty."
-msgstr "Navedeni direktorij vjerojatno nije prazan."
-
-#: src/core/job_error.cpp:800
-msgid "Ensure that the folder exists and is empty, and try again."
-msgstr ""
-"Provjerite postoji li direktorij i da li prazan, pa zatim pokušajte ponovo."
-
-#: src/core/job_error.cpp:805
-msgid "Could Not Resume File Transfer"
-msgstr "Ne mogu nastaviti prijenos datoteke"
-
-#: src/core/job_error.cpp:806
-#, kde-format
-msgid ""
-"The specified request asked that the transfer of file %1 be "
-"resumed at a certain point of the transfer. This was not possible."
-msgstr ""
-"Navedeni zahtjev pita da li će prijenos datoteke %1 biti "
-"nastavljen u određenoj točki prijenosa. Ovo nije moguće."
-
-#: src/core/job_error.cpp:809
-msgid "The protocol, or the server, may not support file resuming."
-msgstr "Protokol, ili poslužitelj ne podržava nastavljanje prijenosa."
-
-#: src/core/job_error.cpp:811
-msgid "Retry the request without attempting to resume transfer."
-msgstr "Ponovite zahtjev bez traženja nastavljanja prijenosa datoteke."
-
-#: src/core/job_error.cpp:816
-msgid "Could Not Rename Resource"
-msgstr "Ne mogu promijeniti naziv resursa"
-
-#: src/core/job_error.cpp:817
-#, kde-format
-msgid "An attempt to rename the specified resource %1 failed."
-msgstr "Pokušaj preimovanja navedenog resursa %1 , nije uspio."
-
-#: src/core/job_error.cpp:827
-msgid "Could Not Alter Permissions of Resource"
-msgstr "Ne mogu promijeniti ovlasti za resurs."
-
-#: src/core/job_error.cpp:828
-#, kde-format
-msgid ""
-"An attempt to alter the permissions on the specified resource %1"
-"strong> failed."
-msgstr ""
-"Pokušaj mijenjanja dozvola na određenom resursu %1 nije "
-"uspjelo."
-
-#: src/core/job_error.cpp:835
-msgid "Could Not Change Ownership of Resource"
-msgstr "Nije moguće promijeniti vlasništvo resursa."
-
-#: src/core/job_error.cpp:836
-#, kde-format
-msgid ""
-"An attempt to change the ownership of the specified resource %1"
-"strong> failed."
-msgstr ""
-"Pokušaj promjene vlasništva navedenog resursa %1 nije uspio."
-
-#: src/core/job_error.cpp:843
-msgid "Could Not Delete Resource"
-msgstr "Ne mogu izbrisati resurs"
-
-#: src/core/job_error.cpp:844
-#, kde-format
-msgid "An attempt to delete the specified resource %1 failed."
-msgstr "Pokušaj brisanja navedenog resursa %1 , nije uspio."
-
-#: src/core/job_error.cpp:851
-msgid "Unexpected Program Termination"
-msgstr "Neočekivani prekid programa"
-
-#: src/core/job_error.cpp:852
-#, kde-format
-msgid ""
-"The program on your computer which provides access to the %1"
-"strong> protocol has unexpectedly terminated."
-msgstr ""
-"Program na vašem računalu, koji pruža pristup protokolu %1 , "
-"neočekivano se prekinuo."
-
-#: src/core/job_error.cpp:860
-msgid "Out of Memory"
-msgstr "Nema više slobodne memorije"
-
-#: src/core/job_error.cpp:861
-#, kde-format
-msgid ""
-"The program on your computer which provides access to the %1"
-"strong> protocol could not obtain the memory required to continue."
-msgstr ""
-"Program na vašem računalu, koji pruža pristup protokolu %1 , "
-"nije uspio prikupiti potrebnu memoriju za nastavak."
-
-#: src/core/job_error.cpp:869
-msgid "Unknown Proxy Host"
-msgstr "Nepoznato 'proxy' računalo"
-
-#: src/core/job_error.cpp:870
-#, kde-format
-msgid ""
-"While retrieving information about the specified proxy host, %1"
-"strong>, an Unknown Host error was encountered. An unknown host error "
-"indicates that the requested name could not be located on the Internet."
-msgstr ""
-"Prilikom dohvaćanja informacija o određenom proxy poslužitelju %1"
-"strong>, naiđeno je na grešku Nepoznati host. Greška nepoznati host ukazuje "
-"da zatraženo ime ne može biti locirano na Internetu."
-
-#: src/core/job_error.cpp:874
-#, fuzzy
-msgid ""
-"There may have been a problem with your network configuration, specifically "
-"your proxy's hostname. If you have been accessing the Internet with no "
-"problems recently, this is unlikely."
-msgstr ""
-"Čini sa da nešto nije u redu sa vašim mrežnim postavkama, odnosno imenom "
-"vašeg posrednika (proxy-a). Ako ste donedavno pristupali internetu bez "
-"problema, onda je vjerojatno nešto drugo uvrokovalo problem."
-
-#: src/core/job_error.cpp:878
-msgid "Double-check your proxy settings and try again."
-msgstr "Provjerite vaše postavke posrednika (proxy-a) i probajte ponovo."
-
-#: src/core/job_error.cpp:883
-#, kde-format
-msgid "Authentication Failed: Method %1 Not Supported"
-msgstr ""
-"Provjera vjerodostojnosti nije uspjela: Način provjeravanja %1 nije podržan"
-
-#: src/core/job_error.cpp:885
-#, kde-format
-msgid ""
-"Although you may have supplied the correct authentication details, the "
-"authentication failed because the method that the server is using is not "
-"supported by the KDE program implementing the protocol %1."
-msgstr ""
-"Iako ste upisali ispravne podatke za provjeru vjerodostojnosti, ona nije "
-"uspjela jer način koji ovaj poslužitelj zahtjeva nije podržan u KDE programu "
-"koji omogućava protokol %1."
-
-#: src/core/job_error.cpp:889
-msgid ""
-"Please file a bug at http://bugs.kde.org/"
-"a> to inform the KDE team of the unsupported authentication method."
-msgstr ""
-"Molim da prijavite nedostatak na http://"
-"bugs.kde.org/ da bi priopćili KDE-ovom timu o nepodržanoj metodi "
-"autentifikacije."
-
-#: src/core/job_error.cpp:895
-msgid "Request Aborted"
-msgstr "Zahtjev odbijen"
-
-#: src/core/job_error.cpp:902
-msgid "Internal Error in Server"
-msgstr "Interna greška na poslužitelju"
-
-#: src/core/job_error.cpp:903
-#, kde-format
-msgid ""
-"The program on the server which provides access to the %1 "
-"protocol has reported an internal error: %2."
-msgstr ""
-"Program na poslužitelju koji pruža pristup protokolu %1 , "
-"prijavio je internu grešku: %2."
-
-#: src/core/job_error.cpp:906
-msgid ""
-"This is most likely to be caused by a bug in the server program. Please "
-"consider submitting a full bug report as detailed below."
-msgstr ""
-"Ovo je najvjerojatnije greška u poslužitaljevu programu. Molim razmislite o "
-"slanju potpunog izvješća o grešci kao što je navedeno dolje."
-
-#: src/core/job_error.cpp:909
-msgid "Contact the administrator of the server to advise them of the problem."
-msgstr "Javite se administratoru poslužitelja i objasnite mu problem."
-
-#: src/core/job_error.cpp:911
-msgid ""
-"If you know who the authors of the server software are, submit the bug "
-"report directly to them."
-msgstr "Ako znate tko su autori poslužiteljevog programa, prijavite im grešku."
-
-#: src/core/job_error.cpp:916
-msgid "Timeout Error"
-msgstr "Greška – vrijeme isteklo"
-
-#: src/core/job_error.cpp:917
-#, kde-format
-msgid ""
-"Although contact was made with the server, a response was not received "
-"within the amount of time allocated for the request as follows:"
-"Timeout for establishing a connection: %1 seconds Timeout "
-"for receiving a response: %2 seconds Timeout for accessing proxy "
-"servers: %3 seconds Please note that you can alter these timeout "
-"settings in the KDE System Settings, by selecting Network Settings -> "
-"Connection Preferences."
-msgstr ""
-"Iako je ostvaren kontakt s poslužiteljem, odgovor nije primljen unutar "
-"osiguranog vremena za zahtjev: Vremensko ograničenje za "
-"uspostavljanje veze: %1 sekundi Vremensko ograničenje za primanje "
-"odgovora: %2 sekundi Vremensko ograničenje za pristupanje proxy "
-"poslužitelju: %3 sekundi Molim vas da primjetite da je moguće "
-"promijeniti ove postavke vremenskih ograničenja u Postavkama sustava KDE-a, "
-"odabirajući Postavke mreže → Podešavanje veze."
-
-#: src/core/job_error.cpp:928
-msgid "The server was too busy responding to other requests to respond."
-msgstr ""
-"Poslužitelj je previše zauzet sa ostalim korisnicima, pa nemože odgovoriti."
-
-#: src/core/job_error.cpp:934 src/core/slavebase.cpp:1429
-msgid "Unknown Error"
-msgstr "Nepoznata greška"
-
-#: src/core/job_error.cpp:935
-#, kde-format
-msgid ""
-"The program on your computer which provides access to the %1"
-"strong> protocol has reported an unknown error: %2."
-msgstr ""
-"Program na vašem računalu, koji pruža pristup protokolu %1 , "
-"prijavio je nepoznatu grešku: %2."
-
-#: src/core/job_error.cpp:943
-msgid "Unknown Interruption"
-msgstr "Nepoznat prekid"
-
-#: src/core/job_error.cpp:944
-#, kde-format
-msgid ""
-"The program on your computer which provides access to the %1"
-"strong> protocol has reported an interruption of an unknown type: %2."
-msgstr ""
-"Program na vašem računalu, koji pruža pristup protokolu %1 , "
-"prijavio je prekid nepoznate vrste: %2."
-
-#: src/core/job_error.cpp:952
-msgid "Could Not Delete Original File"
-msgstr "Ne mogu izbrisati izvornu datoteku "
-
-#: src/core/job_error.cpp:953
-#, kde-format
-msgid ""
-"The requested operation required the deleting of the original file, most "
-"likely at the end of a file move operation. The original file %1"
-"strong> could not be deleted."
-msgstr ""
-"Zatražena operacija zahtjeva brisanje originalne datoteke, najvjerojatnije "
-"na kraju operacije premještanja datoteke. Originalna datoteka %1"
-"strong> ne može biti izbrisana."
-
-#: src/core/job_error.cpp:962
-msgid "Could Not Delete Temporary File"
-msgstr "Ne mogu izbrisati privremenu datoteku"
-
-#: src/core/job_error.cpp:963
-#, kde-format
-msgid ""
-"The requested operation required the creation of a temporary file in which "
-"to save the new file while being downloaded. This temporary file %1"
-"strong> could not be deleted."
-msgstr ""
-"Zatražena operacija zahtjeva stvaranje privremene datoteke u koju će se "
-"snimiti nova datoteka kad bude skinuta. Ova privremena datoteka %1"
-"strong> ne može biti izbrisana."
-
-#: src/core/job_error.cpp:972
-msgid "Could Not Rename Original File"
-msgstr "Ne mogu promijeniti naziv izvorne datoteke"
-
-#: src/core/job_error.cpp:973
-#, kde-format
-msgid ""
-"The requested operation required the renaming of the original file "
-"%1 , however it could not be renamed."
-msgstr ""
-"Zatražena operacija zahtijeva preimenovanje originalne datoteke %1"
-"strong>, no nije ju moguće preimenovati."
-
-#: src/core/job_error.cpp:981
-msgid "Could Not Rename Temporary File"
-msgstr "Ne mogu promijeniti naziv privremene datoteke"
-
-#: src/core/job_error.cpp:982
-#, kde-format
-msgid ""
-"The requested operation required the creation of a temporary file "
-"%1 , however it could not be created."
-msgstr ""
-"Zatražena operacija zahtjeva stvaranje privremene datoteke %1"
-"strong>, no ne može biti stvorena."
-
-#: src/core/job_error.cpp:990
-msgid "Could Not Create Link"
-msgstr "Ne mogu napraviti vezu"
-
-#: src/core/job_error.cpp:991
-msgid "Could Not Create Symbolic Link"
-msgstr "Nemogu napraviti simboličku vezu"
-
-#: src/core/job_error.cpp:992
-#, kde-format
-msgid "The requested symbolic link %1 could not be created."
-msgstr "Nije moguće napraviti simboličku vezu %1."
-
-#: src/core/job_error.cpp:999
-msgid "No Content"
-msgstr "Bez sadržaja"
-
-#: src/core/job_error.cpp:1004
-msgid "Disk Full"
-msgstr "Disk je pun"
-
-#: src/core/job_error.cpp:1005
-#, kde-format
-msgid ""
-"The requested file %1 could not be written to as there is "
-"inadequate disk space."
-msgstr ""
-"Zahtjevanu datoteka %1 nije moguće zapisati jer nema "
-"dovoljno prostora na disku."
-
-#: src/core/job_error.cpp:1007
-msgid ""
-"Free up enough disk space by 1) deleting unwanted and temporary files; 2) "
-"archiving files to removable media storage such as CD-Recordable discs; or "
-"3) obtain more storage capacity."
-msgstr ""
-"Oslobodite prostor na disku tako što 1) obrišete nepotrebne privremene "
-"datoteke; 2) arhivirajte datoteke na medije kao što su CD-R diskovi i sl. ;"
-"ili 3) nabavite više diskovnog prostora."
-
-#: src/core/job_error.cpp:1014
-msgid "Source and Destination Files Identical"
-msgstr "Izvorna i ciljna datoteka su iste"
-
-#: src/core/job_error.cpp:1015
-msgid ""
-"The operation could not be completed because the source and destination "
-"files are the same file."
-msgstr ""
-"Navedni postupak nije moguća završiti jer su izvorna i ciljna datoteka "
-"identična datoteka."
-
-#: src/core/job_error.cpp:1017
-msgid "Choose a different filename for the destination file."
-msgstr "Odaberite drugačiji naziv za odredišnu datoteku."
-
-#: src/core/job_error.cpp:1028
-msgid "Undocumented Error"
-msgstr "Nedokumentirana greška"
-
-#: src/core/kcoredirlister.cpp:397 src/widgets/krun.cpp:830
-#: src/widgets/paste.cpp:265 src/widgets/renamedialog.cpp:410
-#, kde-format
-msgid ""
-"Malformed URL\n"
-"%1"
-msgstr ""
-"Neispravan URL\n"
-"%1"
-
-#: src/core/kcoredirlister.cpp:402
-#, kde-format
-msgid ""
-"URL cannot be listed\n"
-"%1"
-msgstr ""
-"URL ne može biti izlistan\n"
-"%1"
-
-#: src/core/kfileitem.cpp:1202
-#, kde-format
-msgid "(Symbolic Link to %1)"
-msgstr "(Simbolički link na %1)"
-
-#: src/core/kfileitem.cpp:1204
-#, kde-format
-msgid "(%1, Link to %2)"
-msgstr "(%1, link na %2)"
-
-#: src/core/kfileitem.cpp:1207
-#, kde-format
-msgid " (Points to %1)"
-msgstr " (Pokazuje na %1)"
-
-#: src/core/klocalsocket_unix.cpp:192 src/core/klocalsocket_unix.cpp:260
-#, fuzzy
-#| msgid "The certificate is invalid."
-msgid "Specified socket path is invalid"
-msgstr "Potvrda je ispravna."
-
-#: src/core/klocalsocket_unix.cpp:201 src/core/klocalsocket_unix.cpp:248
-#: src/core/klocalsocket_unix.cpp:269
-#, fuzzy
-#| msgid "The protocol %1 is not supported."
-msgid "The socket operation is not supported"
-msgstr "Protokol %1 nije podržan."
-
-#: src/core/klocalsocket_unix.cpp:214
-#, fuzzy
-#| msgid "Connection to Server Refused"
-msgid "Connection refused"
-msgstr "Odbijeno spajanje na poslužitelj."
-
-#: src/core/klocalsocket_unix.cpp:219 src/core/klocalsocket_unix.cpp:282
-#, fuzzy
-#| msgctxt "@label"
-#| msgid "Permissions"
-msgid "Permission denied"
-msgstr "Dopuštenja"
-
-#: src/core/klocalsocket_unix.cpp:223
-#, fuzzy
-#| msgid "Connection timed out."
-msgid "Connection timed out"
-msgstr "Veza je prekoračila vrijeme."
-
-#: src/core/klocalsocket_unix.cpp:227 src/core/klocalsocket_unix.cpp:307
-#, fuzzy
-#| msgid "Unknown Error"
-msgid "Unknown error"
-msgstr "Nepoznata greška"
-
-#: src/core/klocalsocket_unix.cpp:235 src/core/klocalsocket_unix.cpp:315
-#, fuzzy
-#| msgid "Could not login to %1."
-msgid "Could not set non-blocking mode"
-msgstr "Ne mogu se prijaviti na %1."
-
-#: src/core/klocalsocket_unix.cpp:286
-msgid "Address is already in use"
-msgstr ""
-
-#: src/core/klocalsocket_unix.cpp:291
-#, fuzzy
-#| msgid ""
-#| "URL cannot be listed\n"
-#| "%1"
-msgid "Path cannot be used"
-msgstr ""
-"URL ne može biti izlistan\n"
-"%1"
-
-#: src/core/klocalsocket_unix.cpp:295
-msgid "No such file or directory"
-msgstr ""
-
-#: src/core/klocalsocket_unix.cpp:299
-#, fuzzy
-#| msgctxt "@action:button"
-#| msgid "Create directory"
-msgid "Not a directory"
-msgstr "Stvori direktorij"
-
-#: src/core/klocalsocket_unix.cpp:303
-msgid "Read-only filesystem"
-msgstr ""
-
-#: src/core/klocalsocket_unix.cpp:370 src/core/klocalsocket_unix.cpp:404
-#, fuzzy
-#| msgid "Unknown Error"
-msgid "Unknown socket error"
-msgstr "Nepoznata greška"
-
-#: src/core/klocalsocket_win.cpp:31 src/core/klocalsocket_win.cpp:36
-#, fuzzy
-#| msgid "Writing to %1 is not supported."
-msgid "Operation not supported"
-msgstr "Pisanje u %1 nije podržano."
-
-#: src/core/ktcpsocket.cpp:165
-msgctxt "SSL error"
-msgid "No error"
-msgstr ""
-
-#: src/core/ktcpsocket.cpp:167
-#, fuzzy
-#| msgid "The certificate's CA (Certificate Authority) is invalid."
-msgctxt "SSL error"
-msgid "The certificate authority's certificate is invalid"
-msgstr "Vlasništvo certifikata je nevaljano."
-
-#: src/core/ktcpsocket.cpp:169
-#, fuzzy
-#| msgid "Certificate has expired."
-msgctxt "SSL error"
-msgid "The certificate has expired"
-msgstr "Potvrda je istekla."
-
-#: src/core/ktcpsocket.cpp:171
-#, fuzzy
-#| msgid "The certificate is invalid."
-msgctxt "SSL error"
-msgid "The certificate is invalid"
-msgstr "Potvrda je ispravna."
-
-#: src/core/ktcpsocket.cpp:173
-#, fuzzy
-#| msgid "The certificate has not been issued for this host."
-msgctxt "SSL error"
-msgid "The certificate is not signed by any trusted certificate authority"
-msgstr "Certifikat nije izdan za ovo računalo."
-
-#: src/core/ktcpsocket.cpp:175
-#, fuzzy
-#| msgid "The certificate has been revoked."
-msgctxt "SSL error"
-msgid "The certificate has been revoked"
-msgstr "Potvrda je povučena iz uporabe."
-
-#: src/core/ktcpsocket.cpp:177
-#, fuzzy
-#| msgid "The certificate has not been issued for this host."
-msgctxt "SSL error"
-msgid "The certificate is unsuitable for this purpose"
-msgstr "Certifikat nije izdan za ovo računalo."
-
-#: src/core/ktcpsocket.cpp:179
-#, fuzzy
-#| msgid ""
-#| "The CA's (Certificate Authority) certificate can not be found. Most "
-#| "likely, your trust chain is broken."
-msgctxt "SSL error"
-msgid ""
-"The root certificate authority's certificate is not trusted for this purpose"
-msgstr ""
-"Certifikat vlasništva certifikata ne može biti pronađen. Najvjerojatnije je "
-"vaš lanac povjerenja potrgan."
-
-#: src/core/ktcpsocket.cpp:181
-#, fuzzy
-#| msgid ""
-#| "The certificate's CA (Certificate Authority) is not allowed to sign "
-#| "certificates."
-msgctxt "SSL error"
-msgid ""
-"The certificate authority's certificate is marked to reject this "
-"certificate's purpose"
-msgstr "Vlasništvo certifikata ne dozvoljava potpisivanje certifikata."
-
-#: src/core/ktcpsocket.cpp:183
-#, fuzzy
-#| msgid "Do not send a certificate"
-msgctxt "SSL error"
-msgid "The peer did not present any certificate"
-msgstr "Ne šalji potvrdu"
-
-#: src/core/ktcpsocket.cpp:185
-#, fuzzy
-#| msgid "The certificate has not been issued for this host."
-msgctxt "SSL error"
-msgid "The certificate does not apply to the given host"
-msgstr "Certifikat nije izdan za ovo računalo."
-
-#: src/core/ktcpsocket.cpp:187
-#, fuzzy
-#| msgid "The certificate has not been issued for this host."
-msgctxt "SSL error"
-msgid "The certificate cannot be verified for internal reasons"
-msgstr "Certifikat nije izdan za ovo računalo."
-
-#: src/core/ktcpsocket.cpp:189
-#, fuzzy
-#| msgid "The certificate is valid."
-msgctxt "SSL error"
-msgid "The certificate chain is too long"
-msgstr "Potvrda je ispravna."
-
-#: src/core/ktcpsocket.cpp:192
-#, fuzzy
-#| msgid "Unknown Error"
-msgctxt "SSL error"
-msgid "Unknown error"
-msgstr "Nepoznata greška"
-
-#: src/core/slave.cpp:445
-#, kde-format
-msgid "Unknown protocol '%1'."
-msgstr "Nepoznati protokol '%1'."
-
-#: src/core/slave.cpp:453
-#, kde-format
-msgid "Can not find io-slave for protocol '%1'."
-msgstr "Ne mogu pronaći podređeni-iu za protokol '%1'."
-
-#: src/core/slave.cpp:464
-#, fuzzy
-#| msgid "Can not find io-slave for protocol '%1'."
-msgid "Can not find 'kioslave' executable"
-msgstr "Ne mogu pronaći podređeni-iu za protokol '%1'."
-
-#: src/core/slave.cpp:479
-#, kde-format
-msgid "Cannot talk to klauncher: %1"
-msgstr "Nije moguće komunicirati s klauncherom: %1"
-
-#: src/core/slave.cpp:486
-#, kde-format
-msgid ""
-"Unable to create io-slave:\n"
-"klauncher said: %1"
-msgstr ""
-"Ne mogu stvoriti io-slave:\n"
-"klauncher kaže: %1"
-
-#: src/core/slavebase.cpp:782
-#, kde-format
-msgid "Opening connections is not supported with the protocol %1."
-msgstr "Otvaranje veza nije podržano s protokolom %1."
-
-#: src/core/slavebase.cpp:784
-#, kde-format
-msgid "Closing connections is not supported with the protocol %1."
-msgstr "Zatvaranje veza nije podržano protokolom %1."
-
-#: src/core/slavebase.cpp:786
-#, kde-format
-msgid "Accessing files is not supported with the protocol %1."
-msgstr "Pristupanje datotekama nije podržano protokolom %1."
-
-#: src/core/slavebase.cpp:788
-#, kde-format
-msgid "Writing to %1 is not supported."
-msgstr "Pisanje u %1 nije podržano."
-
-#: src/core/slavebase.cpp:790
-#, kde-format
-msgid "There are no special actions available for protocol %1."
-msgstr "Nema dostupnih posebnih akcija za protokol %1."
-
-#: src/core/slavebase.cpp:792
-#, kde-format
-msgid "Listing folders is not supported for protocol %1."
-msgstr "Listanje mapa nije podržano protokolom %1."
-
-#: src/core/slavebase.cpp:794
-#, kde-format
-msgid "Retrieving data from %1 is not supported."
-msgstr "Dohvaćanje podataka iz %1 nije podržano."
-
-#: src/core/slavebase.cpp:796
-#, kde-format
-msgid "Retrieving mime type information from %1 is not supported."
-msgstr "Dohvaćanje informacija o MIME vrstama iz %1 nije podržano."
-
-#: src/core/slavebase.cpp:798
-#, kde-format
-msgid "Renaming or moving files within %1 is not supported."
-msgstr "Preimenovanje ili premještanje datoteka unutar %1 nije podržano."
-
-#: src/core/slavebase.cpp:800
-#, kde-format
-msgid "Creating symlinks is not supported with protocol %1."
-msgstr "Stvaranje simboličkih linkove nije podržano protokolom %1."
-
-#: src/core/slavebase.cpp:802
-#, kde-format
-msgid "Copying files within %1 is not supported."
-msgstr "Kopiranje datoteka unutar %1 nije podržano."
-
-#: src/core/slavebase.cpp:804
-#, kde-format
-msgid "Deleting files from %1 is not supported."
-msgstr "Brisanje datoteka iz %1 nije podržano."
-
-#: src/core/slavebase.cpp:806
-#, kde-format
-msgid "Creating folders is not supported with protocol %1."
-msgstr "Stvaranje mapa nije podržano protokolom %1."
-
-#: src/core/slavebase.cpp:808
-#, kde-format
-msgid "Changing the attributes of files is not supported with protocol %1."
-msgstr "Mijenjanje atributa datoteka nije podržano protokolom %1."
-
-#: src/core/slavebase.cpp:810
-#, kde-format
-msgid "Changing the ownership of files is not supported with protocol %1."
-msgstr "Mijenjanje vlasništva datoteka nije podržano protokolom %1."
-
-#: src/core/slavebase.cpp:812
-#, kde-format
-msgid "Using sub-URLs with %1 is not supported."
-msgstr "Korištenje pod-URL-a s %1 nije podržano."
-
-#: src/core/slavebase.cpp:814
-#, kde-format
-msgid "Multiple get is not supported with protocol %1."
-msgstr "Višestruko preuzimanje nije podržano protokolom %1."
-
-#: src/core/slavebase.cpp:816
-#, kde-format
-msgid "Opening files is not supported with protocol %1."
-msgstr "Otvaranje datoteka nije podržano protokolom %1."
-
-#: src/core/slavebase.cpp:818
-#, kde-format
-msgid "Protocol %1 does not support action %2."
-msgstr "Protokol %1 ne podržava akciju %2."
-
-#: src/core/slavebase.h:280 src/core/slavebase.h:300
-msgid "&Yes"
-msgstr "&Prihvaćam"
-
-#: src/core/slavebase.h:281 src/core/slavebase.h:301
-msgid "&No"
-msgstr "&Ne prihvaćam"
-
-#: src/core/slaveinterface.cpp:429 src/core/tcpslavebase.cpp:822
-#: src/widgets/sslui.cpp:78
-msgid "&Details"
-msgstr "&Detalji"
-
-#: src/core/slaveinterface.cpp:431 src/core/tcpslavebase.cpp:839
-#: src/widgets/sslui.cpp:114
-msgid "&Forever"
-msgstr "&Zauvijek"
-
-#: src/core/slaveinterface.cpp:435 src/core/tcpslavebase.cpp:822
-#: src/widgets/sslui.cpp:79
-msgid "Co&ntinue"
-msgstr "&Nastavi"
-
-#: src/core/slaveinterface.cpp:437 src/core/tcpslavebase.cpp:840
-#: src/widgets/sslui.cpp:115
-msgid "&Current Session only"
-msgstr "Samo trenutna s&jednica"
-
-#: src/core/socketconnectionbackend.cpp:144
-#, kde-format
-msgid "Unable to create io-slave: %1"
-msgstr "Ne mogu stvoriti io-slave:%1"
-
-#: src/core/tcpslavebase.cpp:319
-msgid ""
-"You are about to leave secure mode. Transmissions will no longer be "
-"encrypted.\n"
-"This means that a third party could observe your data in transit."
-msgstr ""
-"Napuštate sigurni način rada. Dalja komunikacija nije zaštićena "
-"(šifrirana).\n"
-"To znači da treća osoba može čitati podatke koje šaljete i primate."
-
-#: src/core/tcpslavebase.cpp:325 src/core/tcpslavebase.cpp:590
-msgid "Security Information"
-msgstr "Informacije o sigurnosti"
-
-#: src/core/tcpslavebase.cpp:326
-msgid "C&ontinue Loading"
-msgstr "&Nastavi učitavati"
-
-#: src/core/tcpslavebase.cpp:421
-#, kde-format
-msgctxt "%1 is a host name"
-msgid "%1: SSL negotiation failed"
-msgstr "%1: SSL pregovaranje nije uspjelo"
-
-#: src/core/tcpslavebase.cpp:584
-msgid ""
-"You are about to enter secure mode. All transmissions will be encrypted "
-"unless otherwise noted.\n"
-"This means that no third party will be able to easily observe your data in "
-"transit."
-msgstr ""
-"Ulazite u sigurni način rada. Svi podaci koje šaljete i primate bit će "
-"zaštićeni, osim ako nije drugačije navedeno.\n"
-"To znači da treće osobe neće moći lako pročitati podatke koje izmjenjujete "
-"preko mreže."
-
-#: src/core/tcpslavebase.cpp:591
-msgid "Display SSL &Information"
-msgstr "Prikaži SSL &informacije"
-
-#: src/core/tcpslavebase.cpp:592
-msgid "C&onnect"
-msgstr "Sp&oji se"
-
-#: src/core/tcpslavebase.cpp:736
-msgid "Enter the certificate password:"
-msgstr "Unesite zaporku potvrde:"
-
-#: src/core/tcpslavebase.cpp:737
-msgid "SSL Certificate Password"
-msgstr "Zaporka SSL potvrde"
-
-#: src/core/tcpslavebase.cpp:751
-msgid "Unable to open the certificate. Try a new password?"
-msgstr "Nije moguće otvoriti potvrdu. Probajte novu zaporku?"
-
-#: src/core/tcpslavebase.cpp:765
-msgid "The procedure to set the client certificate for the session failed."
-msgstr "Postupak utvrđivanja potvrde klijenta za ovu seansu nije uspio."
-
-#: src/core/tcpslavebase.cpp:767 src/widgets/jobuidelegate.cpp:336
-msgid "SSL"
-msgstr "SSL"
-
-#: src/core/tcpslavebase.cpp:811 src/widgets/sslui.cpp:68
-#, kde-format
-msgid ""
-"The server failed the authenticity check (%1).\n"
-"\n"
-msgstr ""
-"Poslužitelj nije uspio provjeriti vjerodostojnost (%1).\n"
-"\n"
-
-#: src/core/tcpslavebase.cpp:821 src/core/tcpslavebase.cpp:838
-#: src/core/tcpslavebase.cpp:942 src/core/tcpslavebase.cpp:954
-#: src/widgets/sslui.cpp:77 src/widgets/sslui.cpp:113
-msgid "Server Authentication"
-msgstr "Provjera vjerodostojnosti poslužitelja"
-
-#: src/core/tcpslavebase.cpp:835 src/widgets/sslui.cpp:110
-msgid ""
-"Would you like to accept this certificate forever without being prompted?"
-msgstr "Želite li uvijek primati ovaj certifikat bez traženja potvrde?"
-
-#: src/core/tcpslavebase.cpp:941
-msgid ""
-"You have indicated that you wish to accept this certificate, but it is not "
-"issued to the server who is presenting it. Do you wish to continue loading?"
-msgstr ""
-"Naveli ste da želite prihvatiti potvrdu, no ona nije izdana za poslužitelja "
-"koji ga nudi. Želite li nastaviti učitavanje?"
-
-#: src/core/tcpslavebase.cpp:953
-msgid ""
-"SSL certificate is being rejected as requested. You can disable this in the "
-"KDE System Settings."
-msgstr ""
-"SSL certifikat je odbijen kao što je traženo. Ovo možete onemogućiti u KDE-"
-"ovim postavkama sustava."
-
-#: src/filewidgets/kdiroperator.cpp:761
-#, kde-format
-msgid "A file or folder named %1 already exists."
-msgstr "Datoteka ili mapa naziva %1 već postoji."
-
-#: src/filewidgets/kdiroperator.cpp:764
-msgid "You do not have permission to create that folder."
-msgstr "Nemate dozvolu stvoriti taj direktorij."
-
-#: src/filewidgets/kdiroperator.cpp:779
-msgid "You did not select a file to delete."
-msgstr "Niste odabrali datoteku za brisanje."
-
-#: src/filewidgets/kdiroperator.cpp:780
-msgid "Nothing to Delete"
-msgstr "Nema ništa za brisanje"
-
-#: src/filewidgets/kdiroperator.cpp:801
-#, kde-format
-msgid ""
-"Do you really want to delete\n"
-" '%1' ? "
-msgstr ""
-"Želite li doista izbrisati \n"
-"'%1' ? "
-
-#: src/filewidgets/kdiroperator.cpp:803
-msgid "Delete File"
-msgstr "Izbriši datoteku"
-
-#: src/filewidgets/kdiroperator.cpp:808 src/widgets/jobuidelegate.cpp:220
-#, kde-format
-msgid "Do you really want to delete this item?"
-msgid_plural "Do you really want to delete these %1 items?"
-msgstr[0] "Želite li zaista izbrisati ovu %1 stavku?"
-msgstr[1] "Želite li zaista izbrisati ove %1 stavke?"
-msgstr[2] "Želite li zaista izbrisati ovih %1 stavki?"
-
-#: src/filewidgets/kdiroperator.cpp:810 src/widgets/jobuidelegate.cpp:222
-msgid "Delete Files"
-msgstr "Izbriši datoteke"
-
-#: src/filewidgets/kdiroperator.cpp:841
-msgid "You did not select a file to trash."
-msgstr "Niste odabrali datoteku za bacanje u smeće."
-
-#: src/filewidgets/kdiroperator.cpp:842
-msgid "Nothing to Trash"
-msgstr "Nema ništa za bacanje u smeće"
-
-#: src/filewidgets/kdiroperator.cpp:859
-#, kde-format
-msgid ""
-"Do you really want to trash\n"
-" '%1' ? "
-msgstr ""
-"Želite li zaista želite baciti u smeće\n"
-"'%1' ? "
-
-#: src/filewidgets/kdiroperator.cpp:861
-msgid "Trash File"
-msgstr "Baci datoteku u smeće"
-
-#: src/filewidgets/kdiroperator.cpp:862 src/filewidgets/kdiroperator.cpp:869
-msgctxt "to trash"
-msgid "&Trash"
-msgstr "&U smeće"
-
-#: src/filewidgets/kdiroperator.cpp:866
-#, kde-format
-msgid "translators: not called for n == 1"
-msgid_plural "Do you really want to trash these %1 items?"
-msgstr[0] "Želite li zaista baciti u smeće ovu %1 stavku?"
-msgstr[1] "Želite li zaista baciti u smeće ove %1 stavke?"
-msgstr[2] "Želite li zaista baciti u smeće ovih %1 stavki?"
-
-#: src/filewidgets/kdiroperator.cpp:868
-msgid "Trash Files"
-msgstr "Baci datoteku u smeće"
-
-#: src/filewidgets/kdiroperator.cpp:1058 src/filewidgets/kdiroperator.cpp:1196
-msgid "The specified folder does not exist or was not readable."
-msgstr "Naveden direktorij ne postoji ili nije čitljiv."
-
-#: src/filewidgets/kdiroperator.cpp:1858
-msgid "Menu"
-msgstr "Izbornik"
-
-#: src/filewidgets/kdiroperator.cpp:1862
-msgid "Parent Folder"
-msgstr "Mapa roditelj"
-
-#: src/filewidgets/kdiroperator.cpp:1869
-msgid "Home Folder"
-msgstr "Osobna mapa"
-
-#: src/filewidgets/kdiroperator.cpp:1872
-msgid "Reload"
-msgstr "Ponovno učitaj"
-
-#: src/filewidgets/kdiroperator.cpp:1875
-msgid "New Folder..."
-msgstr "Nova mapa…"
-
-#: src/filewidgets/kdiroperator.cpp:1880 src/widgets/jobuidelegate.cpp:243
-msgid "Move to Trash"
-msgstr "Premjesti u smeće"
-
-#: src/filewidgets/kdiroperator.cpp:1886
-msgid "Delete"
-msgstr "Izbriši"
-
-#: src/filewidgets/kdiroperator.cpp:1893
-msgid "Sorting"
-msgstr "Sortiraj"
-
-#: src/filewidgets/kdiroperator.cpp:1896
-msgid "By Name"
-msgstr "Po nazivu"
-
-#: src/filewidgets/kdiroperator.cpp:1900
-msgid "By Size"
-msgstr "Po veličini"
-
-#: src/filewidgets/kdiroperator.cpp:1904
-msgid "By Date"
-msgstr "Po datumu"
-
-#: src/filewidgets/kdiroperator.cpp:1908
-msgid "By Type"
-msgstr "Po tipu:"
-
-#: src/filewidgets/kdiroperator.cpp:1912
-msgid "Descending"
-msgstr "Silazno"
-
-#: src/filewidgets/kdiroperator.cpp:1916
-msgid "Folders First"
-msgstr "Prvo mape"
-
-#: src/filewidgets/kdiroperator.cpp:1926
-msgid "Icon Position"
-msgstr "Položaj ikone"
-
-#: src/filewidgets/kdiroperator.cpp:1929
-msgid "Next to File Name"
-msgstr "Pokraj naziva datoteke"
-
-#: src/filewidgets/kdiroperator.cpp:1933
-msgid "Above File Name"
-msgstr "Iznad naziva datoteke"
-
-#: src/filewidgets/kdiroperator.cpp:1944
-msgid "Short View"
-msgstr "Skraćeni prikaz"
-
-#: src/filewidgets/kdiroperator.cpp:1949
-msgid "Detailed View"
-msgstr "Detaljni prikaz"
-
-#: src/filewidgets/kdiroperator.cpp:1954
-msgid "Tree View"
-msgstr "Prikaz kroz stablo"
-
-#: src/filewidgets/kdiroperator.cpp:1959
-msgid "Detailed Tree View"
-msgstr "Detaljni prikaz kroz stablo"
-
-#: src/filewidgets/kdiroperator.cpp:1970
-msgid "Show Hidden Files"
-msgstr "Prikaži skrivene datoteke"
-
-#: src/filewidgets/kdiroperator.cpp:1974
-msgid "Show Aside Preview"
-msgstr "Prikaži odvojen pregled"
-
-#: src/filewidgets/kdiroperator.cpp:1980
-msgid "Show Preview"
-msgstr "Prikaži pregled"
-
-#: src/filewidgets/kdiroperator.cpp:1984
-msgid "Open File Manager"
-msgstr "Otvori upravitelja datoteka"
-
-#: src/filewidgets/kdiroperator.cpp:1989
-msgid "Properties"
-msgstr "Svojstva"
-
-#: src/filewidgets/kdiroperator.cpp:1996
-msgid "&View"
-msgstr "&Prikaz"
-
-#: src/filewidgets/kencodingfiledialog.cpp:86
-msgid "Encoding:"
-msgstr "Kodiranje:"
-
-#: src/filewidgets/kencodingfiledialog.cpp:142
-#: src/filewidgets/kencodingfiledialog.cpp:161
-#: src/filewidgets/kencodingfiledialog.cpp:179
-#: src/filewidgets/kencodingfiledialog.cpp:198
-#: src/widgets/kurlrequesterdialog.cpp:131
-msgid "Open"
-msgstr "Otvori"
-
-#: src/filewidgets/kencodingfiledialog.cpp:217
-#: src/filewidgets/kencodingfiledialog.cpp:240
-msgid "Save As"
-msgstr "Spremi kao"
-
-#: src/filewidgets/kfilefiltercombo.cpp:36
-#: src/filewidgets/kfilewidget.cpp:1842
-msgid "*|All Files"
-msgstr "*|Sve datoteke"
-
-#: src/filewidgets/kfilefiltercombo.cpp:180
-msgid "All Supported Files"
-msgstr "Sve podržane datoteke"
-
-#: src/filewidgets/kfilefiltercombo.cpp:189
-msgid "All Files"
-msgstr "Sve datoteke"
-
-#: src/filewidgets/kfileplaceeditdialog.cpp:85
-msgid "Add Places Entry"
-msgstr "Dodaj unos za Mjesta"
-
-#: src/filewidgets/kfileplaceeditdialog.cpp:87
-msgid "Edit Places Entry"
-msgstr "Uredi unose Mjesta"
-
-#: src/filewidgets/kfileplaceeditdialog.cpp:96
-msgid ""
-"This is the text that will appear in the Places panel. The "
-"label should consist of one or two words that will help you remember what "
-"this entry refers to. If you do not enter a label, it will be derived from "
-"the location's URL. "
-msgstr ""
-"Ovo je tekst koji će se pojaviti u panelu Mjesta. Natpis bi "
-"se trebao sastojati od riječi koje će vam pomoći da se prisjetite na što se "
-"ovaj unos odnosi. Ukoliko ne unesete natips, on će se izvesti iz URL "
-"lokacije. "
-
-#: src/filewidgets/kfileplaceeditdialog.cpp:102
-msgid "L&abel:"
-msgstr "N&atpis:"
-
-#: src/filewidgets/kfileplaceeditdialog.cpp:104
-msgid "Enter descriptive label here"
-msgstr "Unesite opisni natips ovdje"
-
-#: src/filewidgets/kfileplaceeditdialog.cpp:108
-#, kde-format
-msgid ""
-"This is the location associated with the entry. Any valid URL may be "
-"used. For example: %1 http://www.kde.org ftp://ftp.kde."
-"org/pub/kde/stable By clicking on the button next to the text "
-"edit box you can browse to an appropriate URL. "
-msgstr ""
-"Ova lokacija je povezana s unosom. Svaka valjana URL adresa može biti "
-"korištena. Na primjer: %1 http://www.kde.org ftp://ftp."
-"kde.org/pub/kde/stable Klikom na gumb pokraj polja za uređivanje "
-"teksta, možete otići na odgovarajuću URL adresu. "
-
-#: src/filewidgets/kfileplaceeditdialog.cpp:114
-msgid "&Location:"
-msgstr "&Lokacija:"
-
-#: src/filewidgets/kfileplaceeditdialog.cpp:120
-msgid ""
-"This is the icon that will appear in the Places panel. Click "
-"on the button to select a different icon. "
-msgstr ""
-"Ovo je ikona koja će se pojaviti u panelu Mjesta. Kliknite na "
-"gumb da biste odabrali drugačiju ikonu. "
-
-#: src/filewidgets/kfileplaceeditdialog.cpp:123
-msgid "Choose an &icon:"
-msgstr "Izaberite &ikonu:"
-
-#: src/filewidgets/kfileplaceeditdialog.cpp:141
-#, kde-format
-msgid "&Only show when using this application (%1)"
-msgstr "&Prikaži samo kad se koristi ova aplikacija (%1)"
-
-#: src/filewidgets/kfileplaceeditdialog.cpp:143
-#, kde-format
-msgid ""
-"Select this setting if you want this entry to show only when using the "
-"current application (%1). If this setting is not selected, the "
-"entry will be available in all applications. "
-msgstr ""
-"Odaberite ovu postavku ako želite da se ovaj unos prikazuje samo kad "
-"koristite trenutnu aplikaciju (%1). Ako ova postavka nije "
-"odabrana, unos će biti dostupan u svim aplikacijama. "
-
-#: src/filewidgets/kfileplacesmodel.cpp:118
-msgctxt "KFile System Bookmarks"
-msgid "Home"
-msgstr "Osobna mapa"
-
-#: src/filewidgets/kfileplacesmodel.cpp:121
-msgctxt "KFile System Bookmarks"
-msgid "Network"
-msgstr "Mreža"
-
-#: src/filewidgets/kfileplacesmodel.cpp:133
-msgctxt "KFile System Bookmarks"
-msgid "Root"
-msgstr "Ishodište"
-
-#: src/filewidgets/kfileplacesmodel.cpp:137
-msgctxt "KFile System Bookmarks"
-msgid "Trash"
-msgstr "Smeće"
-
-#: src/filewidgets/kfileplacesmodel.cpp:798
-#, kde-format
-msgid "&Release '%1'"
-msgstr "&Izdanje '%1'"
-
-#: src/filewidgets/kfileplacesmodel.cpp:800
-#, kde-format
-msgid "&Safely Remove '%1'"
-msgstr "&Sigurno ukloni '%1'"
-
-#: src/filewidgets/kfileplacesmodel.cpp:803
-#, kde-format
-msgid "&Unmount '%1'"
-msgstr "&Demontiraj '%1'"
-
-#: src/filewidgets/kfileplacesmodel.cpp:824
-#, kde-format
-msgid "&Eject '%1'"
-msgstr "&Izbaci '%1'"
-
-#: src/filewidgets/kfileplacesmodel.cpp:858
-#, kde-format
-msgid "The device '%1' is not a disk and cannot be ejected."
-msgstr "Uređaj '%1' nije disk i ne može biti izbačen."
-
-#: src/filewidgets/kfileplacesmodel.cpp:894
-#, kde-format
-msgid "An error occurred while accessing '%1', the system responded: %2"
-msgstr "Dogodila se greška prilikom pristupanja '%1', sustav je odgovorio: %2"
-
-#: src/filewidgets/kfileplacesmodel.cpp:898
-#, kde-format
-msgid "An error occurred while accessing '%1'"
-msgstr "Dogodila se greška prilikom pristupanja '%1'"
-
-#: src/filewidgets/kfileplacesview.cpp:584
-msgctxt "@action:inmenu"
-msgid "Empty Trash"
-msgstr "Isprazni smeće"
-
-#: src/filewidgets/kfileplacesview.cpp:589
-#: src/filewidgets/kfileplacesview.cpp:610
-#: src/filewidgets/kfileplacesview.cpp:617 src/widgets/kacleditwidget.cpp:96
-msgid "Add Entry..."
-msgstr "Dodaj unos…"
-
-#: src/filewidgets/kfileplacesview.cpp:591
-#, kde-format
-msgid "&Edit Entry '%1'..."
-msgstr "&Uredi unos '%1'…"
-
-#: src/filewidgets/kfileplacesview.cpp:613
-#, kde-format
-msgid "&Hide Entry '%1'"
-msgstr "Sa&krij unos '%1'"
-
-#: src/filewidgets/kfileplacesview.cpp:622
-msgid "&Show All Entries"
-msgstr "Prikaži &sve unose"
-
-#: src/filewidgets/kfileplacesview.cpp:633
-#, kde-format
-msgid "&Remove Entry '%1'"
-msgstr "&Ukloni unos '%1'"
-
-#: src/filewidgets/kfileplacesview.cpp:645
-msgctxt "@info"
-msgid "Do you really want to empty the Trash? All items will be deleted."
-msgstr "Želite li zaista isprazniti smeće? Sve stavke bit će izbrisane."
-
-#: src/filewidgets/kfileplacesview.cpp:649 src/widgets/jobuidelegate.cpp:232
-msgctxt "@action:button"
-msgid "Empty Trash"
-msgstr "Isprazni smeće"
-
-#: src/filewidgets/kfilewidget.cpp:297
-msgid ""
-"While typing in the text area, you may be presented with possible "
-"matches. This feature can be controlled by clicking with the right mouse "
-"button and selecting a preferred mode from the Text Completion menu."
-"qt>"
-msgstr ""
-"Dok se tipka u tekst području, mogu vam se pokazati moguća poklapanja. "
-"Ovom mogućnosti može se upravljati pritiskom na desnu tipku miša i "
-"odabiranjem željenog načina iz izbornika Dovršavanje teksta . "
-
-#: src/filewidgets/kfilewidget.cpp:381
-#, kde-format
-msgid "Drive: %1"
-msgstr "Pogon: %1"
-
-#: src/filewidgets/kfilewidget.cpp:437
-#, kde-format
-msgid ""
-"Click this button to enter the parent folder. For instance, "
-"if the current location is file:/home/%1 clicking this button will take you "
-"to file:/home. "
-msgstr ""
-"Kliknite na ovaj gumb da bi ste ušli u roditeljski direktorij. Na primjer, ako je trenutna lokacija file:/home/%1, klik na ovaj gumb "
-"odvest će vas na file:/home. "
-
-#: src/filewidgets/kfilewidget.cpp:441
-msgid "Click this button to move backwards one step in the browsing history."
-msgstr ""
-"Klik na ovaj gumb vraća na lokaciju koja je jedan korak unatrag u povijesti "
-"pregledavanja."
-
-#: src/filewidgets/kfilewidget.cpp:442
-msgid "Click this button to move forward one step in the browsing history."
-msgstr ""
-"Klik na ovaj gumb pomiče jedan korak unaprijed u povijesti pregledavanja."
-
-#: src/filewidgets/kfilewidget.cpp:444
-msgid "Click this button to reload the contents of the current location."
-msgstr "Klik na ovaj gumb ponovno učitava sadržaja trenute lokacije."
-
-#: src/filewidgets/kfilewidget.cpp:446
-msgid "Click this button to create a new folder."
-msgstr "Klik na ovaj gumb stvara novi direktorij."
-
-#: src/filewidgets/kfilewidget.cpp:452
-msgid "Show Places Navigation Panel"
-msgstr "Prikaži navigacijski panel s Mjestima"
-
-#: src/filewidgets/kfilewidget.cpp:459
-msgid "Show Bookmarks"
-msgstr "Prikaži oznake"
-
-#: src/filewidgets/kfilewidget.cpp:464
-msgid "Options"
-msgstr "Opcije"
-
-#: src/filewidgets/kfilewidget.cpp:466
-msgid ""
-"This is the preferences menu for the file dialog. Various options can be "
-"accessed from this menu including: how files are sorted in the list"
-"li> types of view, including icon and list showing of hidden "
-"files the Places navigation panel file previews"
-"li> separating folders from files "
-msgstr ""
-"Ovo je izbornik postavki za datotečni dijalog. Iz njega možete "
-"pristupiti raznim opcijama uključujući: način na koji su datoteke "
-"sortirane u listi tipovi prikaza, uključujući ikone i listu"
-"li> prikaz skrivenih datoteka navigacijski panel s Mjestima"
-"li> pregled datoteka odvajanje direktorija od datoteka "
-"qt>"
-
-#: src/filewidgets/kfilewidget.cpp:509
-msgid "Zoom out"
-msgstr "Umanji"
-
-#: src/filewidgets/kfilewidget.cpp:511
-msgid "Zoom in"
-msgstr "Uvećaj"
-
-#. i18n: ectx: property (text), widget (QLabel, nameLabel)
-#: src/filewidgets/kfilewidget.cpp:552
-#: src/widgets/kpropertiesdesktopbase.ui:17
-msgid "&Name:"
-msgstr "&Naziv:"
-
-#: src/filewidgets/kfilewidget.cpp:575
-msgid ""
-"This is the filter to apply to the file list. File names that do not "
-"match the filter will not be shown.You may select from one of the preset "
-"filters in the drop down menu, or you may enter a custom filter directly "
-"into the text area.
Wildcards such as * and ? are allowed.
"
-msgstr ""
-"Ovo je filtar koji se primjenjuje na listu datoteka. Imena datoteka koja "
-"se ne podudaraju s filtrom neće biti prikazane.Možete odabrati jedan od "
-"zadanih filtera iz padajućeg izbornika ili možete unijeti vlastiti filtar "
-"izravno u polje za unos teksta
Dozvoljeni su višeznačnici poput * i ?."
-"
"
-
-#: src/filewidgets/kfilewidget.cpp:581
-msgid "&Filter:"
-msgstr "&Filtar:"
-
-#: src/filewidgets/kfilewidget.cpp:813
-msgid "You can only select one file"
-msgstr "Možete odabrati samo jednu datoteku"
-
-#: src/filewidgets/kfilewidget.cpp:814
-msgid "More than one file provided"
-msgstr "Pruženo je više od jedne datoteke"
-
-#: src/filewidgets/kfilewidget.cpp:983
-msgid "You can only select local files"
-msgstr "Možete odabrati samo lokalne datoteke"
-
-#: src/filewidgets/kfilewidget.cpp:984
-msgid "Remote files not accepted"
-msgstr "Udaljene datoteke nisu prihvatljive"
-
-#: src/filewidgets/kfilewidget.cpp:1003
-msgid ""
-"More than one folder has been selected and this dialog does not accept "
-"folders, so it is not possible to decide which one to enter. Please select "
-"only one folder to list it."
-msgstr ""
-"Odabrano je više od jednog direktorija, a ovaj dijalog ne prihvaća "
-"direktorije, pa zato nije moguće odlučiti u kojega treba ući. Molim "
-"odaberite jedan direktorij da ga prikažem."
-
-#: src/filewidgets/kfilewidget.cpp:1003
-msgid "More than one folder provided"
-msgstr "Pruženo je više od jednog direktorija"
-
-#: src/filewidgets/kfilewidget.cpp:1011
-msgid ""
-"At least one folder and one file has been selected. Selected files will be "
-"ignored and the selected folder will be listed"
-msgstr ""
-"Barem je jedan direktorij i jedna datoteka odabrana. Odabrane datoteke bit "
-"će zanemarene, a odabrani direktorij bit će izlistan"
-
-#: src/filewidgets/kfilewidget.cpp:1011
-msgid "Files and folders selected"
-msgstr "Odabrane su datoteke i direktoriji"
-
-#: src/filewidgets/kfilewidget.cpp:1026
-#, kde-format
-msgid "The file \"%1\" could not be found"
-msgstr "Nije moguće naći datoteku \"%1\""
-
-#: src/filewidgets/kfilewidget.cpp:1026
-msgid "Cannot open file"
-msgstr "Nije moguće otvoriti datoteku"
-
-#: src/filewidgets/kfilewidget.cpp:1300
-msgid "This is the name to save the file as."
-msgstr "Ovo je ime pod kojim će datoteka biti spremljena."
-
-#: src/filewidgets/kfilewidget.cpp:1303
-msgid ""
-"This is the list of files to open. More than one file can be specified by "
-"listing several files, separated by spaces."
-msgstr ""
-"Ovo je lista datoteka koje treba otvoriti. Više od jedne datoteke može se "
-"odrediti izlistavanjem nekoliko datoteka, odvojenih razmacima. "
-
-#: src/filewidgets/kfilewidget.cpp:1308
-msgid "This is the name of the file to open."
-msgstr "Ovo je ime datoteke koja će biti otvorena."
-
-#: src/filewidgets/kfilewidget.cpp:1322
-msgctxt "@title:window"
-msgid "Places"
-msgstr "Mjesta"
-
-#: src/filewidgets/kfilewidget.cpp:1512
-#, kde-format
-msgid "The file \"%1\" already exists. Do you wish to overwrite it?"
-msgstr "Datoteka \"%1\" već postoji. Želite li ju prepisati?"
-
-#: src/filewidgets/kfilewidget.cpp:1513
-msgid "Overwrite File?"
-msgstr "Prepisati datoteku?"
-
-#: src/filewidgets/kfilewidget.cpp:1647
-msgid ""
-"The chosen filenames do not\n"
-"appear to be valid."
-msgstr ""
-"Izgleda da odabrani nazivi\n"
-"datoteka nisu valjani."
-
-#: src/filewidgets/kfilewidget.cpp:1649
-msgid "Invalid Filenames"
-msgstr "Nevažeći nazivi datoteka"
-
-#: src/filewidgets/kfilewidget.cpp:1734
-msgid "You can only select local files."
-msgstr "Možete odabrati samo lokalne datoteke."
-
-#: src/filewidgets/kfilewidget.cpp:1735
-msgid "Remote Files Not Accepted"
-msgstr "Udaljene datoteke nisu prihvatljive"
-
-#: src/filewidgets/kfilewidget.cpp:1840
-msgid "*|All Folders"
-msgstr "*|Svi direktoriji"
-
-#: src/filewidgets/kfilewidget.cpp:2009 src/widgets/kfileitemactions.cpp:536
-msgid "&Open"
-msgstr "&Otvori"
-
-#: src/filewidgets/kfilewidget.cpp:2095
-#, kde-format
-msgid "Icon size: %1 pixels (standard size)"
-msgstr "Veličina ikone: %1 piksela (standardna veličina)"
-
-#: src/filewidgets/kfilewidget.cpp:2098
-#, kde-format
-msgid "Icon size: %1 pixels"
-msgstr "Veličina ikone: %1 piksela"
-
-#: src/filewidgets/kfilewidget.cpp:2232
-#, kde-format
-msgid "Automatically select filename e&xtension (%1)"
-msgstr "Automatski odaberi datotečni &nastavak (%1)"
-
-#: src/filewidgets/kfilewidget.cpp:2233
-#, kde-format
-msgid "the extension %1 "
-msgstr "dodatak %1 "
-
-#: src/filewidgets/kfilewidget.cpp:2239
-msgid "Automatically select filename e&xtension"
-msgstr "Automatski odaberi datotečni &nastavak"
-
-#: src/filewidgets/kfilewidget.cpp:2240
-msgid "a suitable extension"
-msgstr "prikladan nastavak"
-
-#: src/filewidgets/kfilewidget.cpp:2250
-#, kde-format
-msgid ""
-"This option enables some convenient features for saving files with "
-"extensions:Any extension specified in the %1 text area "
-"will be updated if you change the file type to save in. "
-"li> If no extension is specified in the %2 text area when you "
-"click Save , %3 will be added to the end of the filename (if the "
-"filename does not already exist). This extension is based on the file type "
-"that you have chosen to save in. If you do not want KDE to supply "
-"an extension for the filename, you can either turn this option off or you "
-"can suppress it by adding a period (.) to the end of the filename (the "
-"period will be automatically removed). If unsure, keep this option "
-"enabled as it makes your files more manageable."
-msgstr ""
-"Ova opcija omogućuje zgodne mogućnosti za spremanje datoteka s ekstenzijama:"
-"Bilo koja ekstenzija definirana u polju za uređivanje teksta "
-"%1 će biti ažurirana ako promijenite tip datoteke za spremanje. Ako ne definirate ekstenziju u polju %2 , tada, nakon što "
-"klinete Spremi , %3 će biti dodano na kraj imena datoteke (ako "
-"datoteka još ne postoji). Ekstenzija je bazirana na tipu datoteke koju ste "
-"odabrali za spremanje. Ako ne želite da KDE doda ekstenziju u ime "
-"datoteke, možete ili ugasiti tu opciju ili ju zaobići tako da dodate točku "
-"(.) na kraj imena datoteke (točka će automatski biti maknuta). Ako "
-"niste sigurni, ostavite ovu opciju uključenom kako bi ste imali veću "
-"preglednost nad Vašim datotekama."
-
-#: src/filewidgets/kfilewidget.cpp:2560
-msgid "Bookmarks"
-msgstr "Oznake"
-
-#: src/filewidgets/kfilewidget.cpp:2564
-msgid ""
-"This button allows you to bookmark specific locations. Click on this "
-"button to open the bookmark menu where you may add, edit or select a "
-"bookmark. These bookmarks are specific to the file dialog, but "
-"otherwise operate like bookmarks elsewhere in KDE. "
-msgstr ""
-"Ovaj gumb vam omogućuje označivanje posebnih lokacija. Klikom na taj "
-"gumb otvarate izbornik s oznakama gdje možete dodavati, uređivati ili "
-"odabirati oznake. Iako su ove oznake specifične za datotečni "
-"dijalog, s njima možete raditi kao i s oznakama drugdje unutar KDE-a. "
-
-#: src/filewidgets/knewfilemenu.cpp:380 src/filewidgets/knewfilemenu.cpp:923
-msgid "Sorry"
-msgstr "Žalim"
-
-#: src/filewidgets/knewfilemenu.cpp:389
-#, kde-format
-msgid "The template file %1 does not exist. "
-msgstr "Datoteka predloška%1 ne postoji. "
-
-#: src/filewidgets/knewfilemenu.cpp:408
-msgctxt "@action:button"
-msgid "Create directory"
-msgstr "Stvori direktorij"
-
-#: src/filewidgets/knewfilemenu.cpp:410
-msgctxt "@action:button"
-msgid "Enter a different name"
-msgstr "Unesite drugačiji naziv"
-
-#: src/filewidgets/knewfilemenu.cpp:413
-msgid "Create hidden directory?"
-msgstr "Stvoriti skriveni direktorij?"
-
-#: src/filewidgets/knewfilemenu.cpp:423
-#, kde-format
-msgid ""
-"The name \"%1\" starts with a dot, so the directory will be hidden by "
-"default."
-msgstr ""
-"Naziv \"%1\" počinje točkom, stoga će taj direktorij biti skriven ukoliko se "
-"ne odabere drugačije."
-
-#: src/filewidgets/knewfilemenu.cpp:425
-msgid "Do not ask again"
-msgstr "Ne pitaj ponovno"
-
-#: src/filewidgets/knewfilemenu.cpp:518 src/filewidgets/knewfilemenu.cpp:591
-msgid "File name:"
-msgstr "Naziv datoteke:"
-
-#: src/filewidgets/knewfilemenu.cpp:521
-msgid "Create Symlink"
-msgstr "Stvori simboličku poveznicu"
-
-#: src/filewidgets/knewfilemenu.cpp:595
-msgid "Create link to URL"
-msgstr "Stvori poveznicu na URL"
-
-#: src/filewidgets/knewfilemenu.cpp:640 src/filewidgets/knewfilemenu.cpp:685
-#, fuzzy, kde-format
-#| msgctxt "@item:inmenu Open With, %1 is application name"
-#| msgid "%1"
-msgctxt "@item:inmenu Create New"
-msgid "%1"
-msgstr "%1|/|$[gen %1]"
-
-#: src/filewidgets/knewfilemenu.cpp:934
-msgid ""
-"Basic links can only point to local files or directories.\n"
-"Please use \"Link to Location\" for remote URLs."
-msgstr ""
-"Osnovni linkovi mogu samo pokazivati prema lokalnim datotekama i "
-"direktorijima.\n"
-"Molim koristite \"Link na lokaciju\" za udaljene URL-ove."
-
-#: src/filewidgets/knewfilemenu.cpp:1011
-msgid "Create New"
-msgstr "Stvori novi"
-
-#: src/filewidgets/knewfilemenu.cpp:1024
-msgid "Link to Device"
-msgstr "Veza prema uređaju"
-
-#: src/filewidgets/knewfilemenu.cpp:1071
-msgctxt "Default name for a new folder"
-msgid "New Folder"
-msgstr "Nova mapa"
-
-#: src/filewidgets/knewfilemenu.cpp:1081
-msgctxt "@title:window"
-msgid "New Folder"
-msgstr "Nova mapa"
-
-#: src/filewidgets/knewfilemenu.cpp:1084
-#, kde-format
-msgid ""
-"Create new folder in:\n"
-"%1"
-msgstr ""
-"Stvori novu mapu u:\n"
-"%1"
-
-#: src/filewidgets/kstatusbarofflineindicator.cpp:52
-msgid "The desktop is offline"
-msgstr "Radna površina je izvan mreže."
-
-#: src/filewidgets/kurlnavigator.cpp:421
-msgid "Copy"
-msgstr "Kopiraj"
-
-#: src/filewidgets/kurlnavigator.cpp:425
-msgid "Paste"
-msgstr "Zalijepi"
-
-#: src/filewidgets/kurlnavigator.cpp:432
-msgid "Edit"
-msgstr "Uređuj"
-
-#: src/filewidgets/kurlnavigator.cpp:435
-msgid "Navigate"
-msgstr "Navigiraj"
-
-#: src/filewidgets/kurlnavigator.cpp:450
-msgid "Show Full Path"
-msgstr "Prikaži cijelu putanju"
-
-#: src/filewidgets/kurlnavigator.cpp:685
-msgid "Custom Path"
-msgstr "Prilagođena putanja"
-
-#: src/filewidgets/kurlnavigatorbutton.cpp:688
-msgctxt "@action:inmenu"
-msgid "More"
-msgstr "Više"
-
-#: src/filewidgets/kurlnavigatorprotocolcombo.cpp:174
-msgctxt "@item:inmenu"
-msgid "Devices"
-msgstr "Uređaji"
-
-#: src/filewidgets/kurlnavigatorprotocolcombo.cpp:178
-msgctxt "@item:inmenu"
-msgid "Subversion"
-msgstr "Subversion"
-
-#: src/filewidgets/kurlnavigatorprotocolcombo.cpp:182
-msgctxt "@item:inmenu"
-msgid "Other"
-msgstr "Ostalo"
-
-#: src/filewidgets/kurlnavigatortogglebutton.cpp:42
-#, fuzzy
-#| msgid "Edit"
-msgid "Edit mode"
-msgstr "Uređuj"
-
-#: src/filewidgets/kurlnavigatortogglebutton.cpp:97
-msgid "Click for Location Navigation"
-msgstr "Kliknite za navigaciju prema lokaciji"
-
-#: src/filewidgets/kurlnavigatortogglebutton.cpp:99
-msgid "Click to Edit Location"
-msgstr "Kliknite za uređivanje lokacije"
-
-#: src/ioslaves/file/file.cpp:224
-#, kde-format
-msgid "Setting ACL for %1"
-msgstr "Postavljanje ACL-a za %1"
-
-#: src/ioslaves/file/file.cpp:680 src/ioslaves/file/file_unix.cpp:260
-#, kde-format
-msgid ""
-"Could not change permissions for\n"
-"%1"
-msgstr ""
-"Ne mogu promijeniti ovlasti za\n"
-"%1"
-
-#: src/ioslaves/file/file.cpp:879
-msgid "No Media inserted or Media not recognized."
-msgstr "Nema umetnutog ili prepoznatog medija."
-
-#: src/ioslaves/file/file.cpp:888 src/ioslaves/file/file.cpp:1084
-msgid "\"vold\" is not running."
-msgstr "\"vold\" nije pokrenut."
-
-#: src/ioslaves/file/file.cpp:921
-msgid "Could not find program \"mount\""
-msgstr "Nije moguće pronaći program \"mount\""
-
-#: src/ioslaves/file/file.cpp:990
-msgid "mounting is not supported by wince."
-msgstr "Sustav wince ne podržava montiranje."
-
-#: src/ioslaves/file/file.cpp:1095
-msgid "Could not find program \"umount\""
-msgstr "Nije moguće pronaći program \"umount\""
-
-#: src/ioslaves/file/file.cpp:1110
-msgid "unmounting is not supported by wince."
-msgstr "Sustav wince ne podržava demontiranje."
-
-#: src/ioslaves/file/file_unix.cpp:193
-#, kde-format
-msgid "Cannot copy file from %1 to %2. (Errno: %3)"
-msgstr "Nije moguće kopirati datoteku sa %1 u %2. (Broj greške: %3)"
-
-#: src/ioslaves/file/file_unix.cpp:325
-#, kde-format
-msgid "No media in device for %1"
-msgstr "Nema medija u uređaju za %1"
-
-#: src/ioslaves/file/file_unix.cpp:558
-#, kde-format
-msgid "Could not get user id for given user name %1"
-msgstr "Nije moguće dobiti ID korisnika za korisničko ime %1"
-
-#: src/ioslaves/file/file_unix.cpp:571
-#, kde-format
-msgid "Could not get group id for given group name %1"
-msgstr "Nije moguće dobiti ID grupe za dan naziv grupe %1"
-
-#: src/ioslaves/ftp/ftp.cpp:347
-#, kde-format
-msgid "Opening connection to host %1"
-msgstr "Otvaram vezu na računalo %1"
-
-#: src/ioslaves/ftp/ftp.cpp:362
-#, kde-format
-msgid "Connected to host %1"
-msgstr "Spojeno na računalo %1"
-
-#: src/ioslaves/ftp/ftp.cpp:472
-#, kde-format
-msgid ""
-"%1.\n"
-"\n"
-"Reason: %2"
-msgstr ""
-"%1.\n"
-"\n"
-"Razlog: %2"
-
-#: src/ioslaves/ftp/ftp.cpp:502
-msgid "Sending login information"
-msgstr "Šaljem prijavne podatke"
-
-#: src/ioslaves/ftp/ftp.cpp:560
-#, kde-format
-msgid ""
-"Message sent:\n"
-"Login using username=%1 and password=[hidden]\n"
-"\n"
-"Server replied:\n"
-"%2\n"
-"\n"
-msgstr ""
-"Poslao sam:\n"
-"Prijava s korisničkim imenom=%1 i zaporkom=[sakriveno]\n"
-"\n"
-"Poslužitelj je odgovorio:\n"
-"%2\n"
-"\n"
-
-#: src/ioslaves/ftp/ftp.cpp:569 src/ioslaves/http/http.cpp:5294
-msgid "You need to supply a username and a password to access this site."
-msgstr "Trebate upisati korisničko ime i zaporku za pristup ovim stranicama."
-
-#: src/ioslaves/ftp/ftp.cpp:571 src/ioslaves/http/http.cpp:5296
-msgid "Site:"
-msgstr "Stranica:"
-
-#: src/ioslaves/ftp/ftp.cpp:572
-#, kde-format
-msgid "%1 "
-msgstr "%1 "
-
-#: src/ioslaves/ftp/ftp.cpp:655
-msgid "Login OK"
-msgstr "Prijava u redu"
-
-#: src/ioslaves/ftp/ftp.cpp:684
-#, kde-format
-msgid "Could not login to %1."
-msgstr "Ne mogu se prijaviti na %1."
-
-#: src/ioslaves/ftp/ftp.cpp:2580 src/ioslaves/http/http.cpp:5180
-#: src/ioslaves/http/http.cpp:5306
-msgid ""
-"You need to supply a username and a password for the proxy server listed "
-"below before you are allowed to access any sites."
-msgstr ""
-"Trebate upisati korisničko ime i zaporku za proxy poslužitelj izlistan niže "
-"dolje prije nego što vam on dozvoli pristup bilo kojim stranicama."
-
-#: src/ioslaves/ftp/ftp.cpp:2584 src/ioslaves/http/http.cpp:5184
-#: src/ioslaves/http/http.cpp:5309
-msgid "Proxy:"
-msgstr "Proxy:"
-
-#: src/ioslaves/ftp/ftp.cpp:2585 src/ioslaves/http/http.cpp:5185
-#: src/ioslaves/http/http.cpp:5390
-#, kde-format
-msgid "%1 at %2 "
-msgstr "%1 na %2 "
-
-#: src/ioslaves/ftp/ftp.cpp:2586 src/ioslaves/http/http.cpp:5187
-#: src/ioslaves/http/http.cpp:5326
-msgid "Proxy Authentication Failed."
-msgstr "Neuspjela autentikacija posrednika (proxy)"
-
-#: src/ioslaves/help/kio_help.cpp:122
-#, fuzzy, kde-format
-#| msgid "There are no special actions available for protocol %1."
-msgid "There is no documentation available for %1."
-msgstr "Nema dostupnih posebnih akcija za protokol %1."
-
-#: src/ioslaves/help/kio_help.cpp:176
-msgid "Looking up correct file"
-msgstr ""
-
-#: src/ioslaves/help/kio_help.cpp:227
-msgid "Preparing document"
-msgstr ""
-
-#: src/ioslaves/help/kio_help.cpp:236 src/ioslaves/help/kio_help.cpp:281
-#, fuzzy, kde-format
-#| msgid "The requested lock could not be granted. %1"
-msgid "The requested help file could not be parsed: %1"
-msgstr "Zahtjevano zaključavanje nije moguće odobriti. %1"
-
-#: src/ioslaves/help/kio_help.cpp:258
-msgid "Saving to cache"
-msgstr ""
-
-#: src/ioslaves/help/kio_help.cpp:275
-msgid "Using cached version"
-msgstr ""
-
-#: src/ioslaves/help/kio_help.cpp:337
-msgid "Looking up section"
-msgstr ""
-
-#: src/ioslaves/help/kio_help.cpp:348
-#, fuzzy, kde-format
-#| msgid "Could not read file %1."
-msgid "Could not find filename %1 in %2."
-msgstr "Nije moguće čitati datoteku %1."
-
-#: src/ioslaves/http/http.cpp:590
-msgid "No host specified."
-msgstr "Niste definirali domaćina (host)."
-
-#: src/ioslaves/http/http.cpp:1553
-msgid "Otherwise, the request would have succeeded."
-msgstr "Osim toga, zahtjev bi bio uspješan."
-
-#: src/ioslaves/http/http.cpp:1557
-msgctxt "request type"
-msgid "retrieve property values"
-msgstr "dohvaćanje svojstvenih vrijednosti"
-
-#: src/ioslaves/http/http.cpp:1560
-msgctxt "request type"
-msgid "set property values"
-msgstr "postavljanje svojstvenih vrijednosti"
-
-#: src/ioslaves/http/http.cpp:1563
-msgctxt "request type"
-msgid "create the requested folder"
-msgstr "stvori traženu mapu"
-
-#: src/ioslaves/http/http.cpp:1566
-msgctxt "request type"
-msgid "copy the specified file or folder"
-msgstr "kopiranje navedene datoteke ili mape"
-
-#: src/ioslaves/http/http.cpp:1569
-msgctxt "request type"
-msgid "move the specified file or folder"
-msgstr "premještanje navedene datoteke ili mape"
-
-#: src/ioslaves/http/http.cpp:1572
-msgctxt "request type"
-msgid "search in the specified folder"
-msgstr "pretraga u navedenoj mapi"
-
-#: src/ioslaves/http/http.cpp:1575
-msgctxt "request type"
-msgid "lock the specified file or folder"
-msgstr "zaključavanje navedene datoteke ili mape"
-
-#: src/ioslaves/http/http.cpp:1578
-msgctxt "request type"
-msgid "unlock the specified file or folder"
-msgstr "otključavanje navedene datoteke ili mape"
-
-#: src/ioslaves/http/http.cpp:1581
-msgctxt "request type"
-msgid "delete the specified file or folder"
-msgstr "brisanje navedene datoteke ili mape"
-
-#: src/ioslaves/http/http.cpp:1584
-msgctxt "request type"
-msgid "query the server's capabilities"
-msgstr "upit za mogućnosti poslužitelja"
-
-#: src/ioslaves/http/http.cpp:1587
-msgctxt "request type"
-msgid "retrieve the contents of the specified file or folder"
-msgstr "dohvaćanje sadržaja navedene datoteke ili mape"
-
-#: src/ioslaves/http/http.cpp:1590
-msgctxt "request type"
-msgid "run a report in the specified folder"
-msgstr "pokrenite izvještaj u navedenoj mapi"
-
-#: src/ioslaves/http/http.cpp:1601
-#, kde-format
-msgctxt "%1: code, %2: request type"
-msgid "An unexpected error (%1) occurred while attempting to %2."
-msgstr "Dogodila se neočekivana greška (%1) prilikom pokušaja %2."
-
-#: src/ioslaves/http/http.cpp:1608
-msgid "The server does not support the WebDAV protocol."
-msgstr "Poslužitelj ne podržava WebDAV protokol."
-
-#: src/ioslaves/http/http.cpp:1650
-#, kde-format
-msgctxt "%1: request type, %2: url"
-msgid ""
-"An error occurred while attempting to %1, %2. A summary of the reasons is "
-"below."
-msgstr ""
-"Dogodila se greška prilikom pokušavanja %1, %2. Sažetak razloga nalazi se "
-"ispod."
-
-#: src/ioslaves/http/http.cpp:1665 src/ioslaves/http/http.cpp:1798
-#, kde-format
-msgctxt "%1: request type"
-msgid "Access was denied while attempting to %1."
-msgstr "Pristup je odbijen prilikom %1."
-
-#: src/ioslaves/http/http.cpp:1678 src/ioslaves/http/http.cpp:1804
-msgid ""
-"A resource cannot be created at the destination until one or more "
-"intermediate collections (folders) have been created."
-msgstr ""
-"Resurs nije moguće stvoriti na odredištu sve dok jedna ili više privremenih "
-"kolekcija (direktorija) nije stvorena."
-
-#: src/ioslaves/http/http.cpp:1686
-#, kde-format
-msgid ""
-"The server was unable to maintain the liveness of the properties listed in "
-"the propertybehavior XML element or you attempted to overwrite a file while "
-"requesting that files are not overwritten. %1"
-msgstr ""
-"Poslužitelj nije u mogućnosti održati navedena svojstva u propertybehavior "
-"XML elementu ili ste pokušali prepisati detoteku dok zahtjevate da se te "
-"datoteke na prepisuju. %1"
-
-#: src/ioslaves/http/http.cpp:1694
-#, kde-format
-msgid "The requested lock could not be granted. %1"
-msgstr "Zahtjevano zaključavanje nije moguće odobriti. %1"
-
-#: src/ioslaves/http/http.cpp:1700
-msgid "The server does not support the request type of the body."
-msgstr "Poslužutelj ne podržava ovakvu vrstu zahtjeva tijela (dokumenta)."
-
-#: src/ioslaves/http/http.cpp:1705 src/ioslaves/http/http.cpp:1812
-#, kde-format
-msgctxt "%1: request type"
-msgid "Unable to %1 because the resource is locked."
-msgstr "Nije moguće %1, jer je resurs zaključan."
-
-#: src/ioslaves/http/http.cpp:1709
-msgid "This action was prevented by another error."
-msgstr "Postupak je spreiječen od strane druge greške."
-
-#: src/ioslaves/http/http.cpp:1715 src/ioslaves/http/http.cpp:1818
-#, kde-format
-msgctxt "%1: request type"
-msgid ""
-"Unable to %1 because the destination server refuses to accept the file or "
-"folder."
-msgstr ""
-"Nije moguće %1, jer odredišni poslužitelj odbija prihvatiti datoteku ili "
-"mapu."
-
-#: src/ioslaves/http/http.cpp:1722 src/ioslaves/http/http.cpp:1825
-msgid ""
-"The destination resource does not have sufficient space to record the state "
-"of the resource after the execution of this method."
-msgstr ""
-"Odredišni resurs nema dovoljno prostora za zapis stanja resursa nakon "
-"izvršenja ove metode."
-
-#: src/ioslaves/http/http.cpp:1776
-msgid "The resource cannot be deleted."
-msgstr "Resurs ne može biti izbrisan."
-
-#: src/ioslaves/http/http.cpp:1789
-#, kde-format
-msgctxt "request type"
-msgid "upload %1"
-msgstr "slanje %1"
-
-#: src/ioslaves/http/http.cpp:1839
-#, kde-format
-msgctxt "%1: response code, %2: request type"
-msgid "An unexpected error (%1) occurred while attempting to %2."
-msgstr "Dogodila se neočekivana greška (%1) prilikom pokušavanja %2."
-
-#: src/ioslaves/http/http.cpp:2665
-#, kde-format
-msgid "%1 contacted. Waiting for reply..."
-msgstr "%1 je kontaktiran. Očekujem odgovor…"
-
-#: src/ioslaves/http/http.cpp:3004
-#, kde-format
-msgctxt "@info Security check on url being accessed"
-msgid ""
-"You are about to log in to the site \"%1\" with the username \"%2\", but "
-"the website does not require authentication. This may be an attempt to trick "
-"you.
Is \"%1\" the site you want to visit?
"
-msgstr ""
-
-#: src/ioslaves/http/http.cpp:3010
-msgctxt "@title:window"
-msgid "Confirm Website Access"
-msgstr "Potvrda pristupanja web-stranici"
-
-#: src/ioslaves/http/http.cpp:3086
-msgid "Server processing request, please wait..."
-msgstr "Poslužitelj obrađuje zahtjev, molim pričekajte…"
-
-#: src/ioslaves/http/http.cpp:3791 src/ioslaves/http/http.cpp:3845
-#, kde-format
-msgid "Sending data to %1"
-msgstr "Šaljem podatke na %1"
-
-#: src/ioslaves/http/http.cpp:4302
-#, kde-format
-msgid "Retrieving %1 from %2..."
-msgstr "Preuzimam podatke %1 od %2…"
-
-#: src/ioslaves/http/http.cpp:5325
-msgid "Authentication Failed."
-msgstr "Neuspjela autentikacija"
-
-#: src/ioslaves/http/http.cpp:5423
-msgid "Authorization failed."
-msgstr "Autorizacija nije uspjela."
-
-#: src/ioslaves/http/http.cpp:5439
-msgid "Unknown Authorization method."
-msgstr "Nepoznata autorizacijska metoda."
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:66
-msgid "Cookie Alert"
-msgstr "Upozorenje: Kolačić"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:96
-#, kde-format
-msgctxt "%2 hostname, %3 optional cross domain suffix (translated below)"
-msgid ""
-"You received a cookie from%2%3 Do you want to accept or "
-"reject this cookie?
"
-msgid_plural ""
-"You received %1 cookies from%2%3 Do you want to accept or "
-"reject these cookies?
"
-msgstr[0] ""
-msgstr[1] ""
-msgstr[2] ""
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:104
-#, fuzzy
-#| msgid " [Cross Domain] "
-msgctxt "@item:intext cross domain cookie"
-msgid " [Cross Domain]"
-msgstr " [Križna domena] "
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:114
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:369
-msgid "See or modify the cookie information"
-msgstr "Prikaži ili izmijeni podatke o kolačiću"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:118
-msgid "Accept for this &session"
-msgstr ""
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:120
-msgid "Accept cookie(s) until the end of the current session"
-msgstr ""
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:127
-msgid "&Accept"
-msgstr "&Prihvati"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:128
-msgid "&Reject"
-msgstr "&Odbij"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:162
-msgid "Apply Choice To"
-msgstr "Primijeni izbor na"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:165
-msgid "&Only this cookie"
-msgstr "&Samo ovaj kolačić"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:165
-msgid "&Only these cookies"
-msgstr "&Samo ovi kolačići"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:169
-#, fuzzy
-#| msgid ""
-#| "Select this option to accept/reject only this cookie. You will be "
-#| "prompted if another cookie is received. (see WebBrowsing/Cookies in "
-#| "the System Settings) ."
-msgid ""
-"Select this option to only accept or reject this cookie. You will be "
-"prompted again if you receive another cookie."
-msgstr ""
-"Odaberite ovu opciju za prihvaćanje/odbijanje samo ovog kolačića. Sustav će "
-"tražiti potvrdu ako dobijete nove kolačiće. (pogledajte pod "
-"Pretraživanje/Kolačići u Postavkama sustava) ."
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:172
-msgid "All cookies from this do&main"
-msgstr "Sve kolačiće iz ove do&mene"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:175
-#, fuzzy
-#| msgid ""
-#| "Select this option to accept/reject all cookies from this site. Choosing "
-#| "this option will add a new policy for the site this cookie originated "
-#| "from. This policy will be permanent until you manually change it from the "
-#| "Control Center (see WebBrowsing/Cookies in the Control Center) ."
-msgid ""
-"Select this option to accept or reject all cookies from this site. Choosing "
-"this option will add a new policy for the site this cookie originated from. "
-"This policy will be permanent until you manually change it from the System "
-"Settings."
-msgstr ""
-"Odaberite mogućnost primanja/odbijanja svih kolačića s ovog poslužitelja. "
-"Odabiranje će postaviti novo pravilo za poslužitelj koji je poslao kolačić. "
-"Ovo pravilo će biti stalno važeće, dok ga ručno ne promijenite u Kontrolnom "
-"centru (pogledajte pod Pretraživanje/Kontrolni centar) ."
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:180
-msgid "All &cookies"
-msgstr "Sve &kolačiće"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:183
-#, fuzzy
-#| msgid ""
-#| "Select this option to accept/reject all cookies from anywhere. Choosing "
-#| "this option will change the global cookie policy set in the Control "
-#| "Center for all cookies (see WebBrowsing/Cookies in the Control Center)"
-#| " ."
-msgid ""
-"Select this option to accept/reject all cookies from anywhere. Choosing this "
-"option will change the global cookie policy for all cookies until you "
-"manually change it from the System Settings."
-msgstr ""
-"Odaberite mogućnost primanja/odbijanja svih kolačića sa svih poslužitelja. "
-"Odabiranje će postaviti novo pravilo za sve poslužitelje. Ovo pravilo će "
-"biti stalno važeće, dok ga ručno ne promijenite u Kontrolnom centru "
-"(pogledajte pod Pretraživanje/Kontrolni centar) ."
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:251
-msgid "Cookie Details"
-msgstr "Detalji o kolačiću"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:256
-msgid "Name:"
-msgstr "Naziv:"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:264
-msgid "Value:"
-msgstr "Vrijednost:"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:271
-msgid "Expires:"
-msgstr "Istječe:"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:278
-msgid "Path:"
-msgstr "Putanja:"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:285
-msgid "Domain:"
-msgstr "Domena:"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:292
-msgid "Exposure:"
-msgstr "Vidljivost:"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:300
-msgctxt "Next cookie"
-msgid "&Next >>"
-msgstr "Slje&deće >>"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:305
-msgid "Show details of the next cookie"
-msgstr "Prikaži detalje za sljedeći kolačić"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:333
-msgid "Not specified"
-msgstr "Nije navedeno"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:343
-msgid "End of Session"
-msgstr "Kraj korištenja"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:348
-msgid "Secure servers only"
-msgstr "Samo sigurni poslužitelji"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:350
-msgid "Secure servers, page scripts"
-msgstr "Sigurni poslužitelj, stranice skripti"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:354
-msgid "Servers"
-msgstr "Poslužitelji"
-
-#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:356
-msgid "Servers, page scripts"
-msgstr "Poslužitelj, stranice skripti"
-
-#: src/ioslaves/telnet/ktelnetservice.cpp:68
-#, kde-format
-msgid "You do not have permission to access the %1 protocol."
-msgstr "Nemate ovlasti za pristup protokolu %1."
-
-#: src/kpac/discovery.cpp:112
-msgid "Could not find a usable proxy configuration script"
-msgstr "Ne mogu pronaći upotrebljivu datoteku sa postavkama proxy poslužitelja"
-
-#: src/kpac/downloader.cpp:92
-#, kde-format
-msgid ""
-"Could not download the proxy configuration script:\n"
-"%1"
-msgstr ""
-"Ne mogu preuzeti datoteku s skriptom proxy postavki:\n"
-"%1"
-
-#: src/kpac/downloader.cpp:95
-msgid "Could not download the proxy configuration script"
-msgstr "Ne mogu preuzeti datoteku sa postavkama proxy poslužitelja"
-
-#: src/kpac/proxyscout.cpp:237
-#, kde-format
-msgid ""
-"The proxy configuration script is invalid:\n"
-"%1"
-msgstr ""
-"Skripta za podešenje proxyja je neispravna:\n"
-"%1"
-
-#: src/kpac/proxyscout.cpp:346
-#, kde-format
-msgid ""
-"The proxy configuration script returned an error:\n"
-"%1"
-msgstr ""
-"Skripta za konfiguriranje proxya je vratila grešku:\n"
-"%1"
-
-#: src/kpac/script.cpp:752
-msgid "Could not find 'FindProxyForURL' or 'FindProxyForURLEx'"
-msgstr "Nije moguće pronaći 'FindProxyForURL' ili 'FindProxyForURLEx'"
-
-#: src/kpac/script.cpp:763
-#, kde-format
-msgid "Got an invalid reply when calling %1"
-msgstr "Dobiven je neispravan odgovor pri pozivu %1"
-
-#: src/widgets/accessmanager.cpp:221
-msgid "Blocked request."
-msgstr "Blokiran zahtjev."
-
-#: src/widgets/accessmanager.cpp:285
-msgid "Unknown HTTP verb."
-msgstr "Nepoznata HTTP-metoda."
-
-#. i18n: ectx: property (text), widget (QLabel, commonNameTag)
-#: src/widgets/certificateparty.ui:28
-msgid "Common name:"
-msgstr "Uobičajen naziv:"
-
-#. i18n: ectx: property (text), widget (QLabel, commonName)
-#: src/widgets/certificateparty.ui:38
-msgid "Acme Co."
-msgstr "ACME d.o.o."
-
-#. i18n: ectx: property (text), widget (QLabel, organizationTag)
-#: src/widgets/certificateparty.ui:48
-msgid "Organization:"
-msgstr "Organizacija:"
-
-#. i18n: ectx: property (text), widget (QLabel, organization)
-#: src/widgets/certificateparty.ui:58
-msgid "Acme Sundry Products Company"
-msgstr "ACME – tvrka s proizvodima za zaštitu od Sunca"
-
-#. i18n: ectx: property (text), widget (QLabel, organizationalUnitTag)
-#: src/widgets/certificateparty.ui:68
-msgid "Organizational unit:"
-msgstr "Odjel:"
-
-#. i18n: ectx: property (text), widget (QLabel, organizationalUnit)
-#: src/widgets/certificateparty.ui:78
-msgid "Fraud Department"
-msgstr "Odjel za prijevare:"
-
-#. i18n: ectx: property (text), widget (QLabel, countryTag)
-#: src/widgets/certificateparty.ui:88
-msgid "Country:"
-msgstr "Država:"
-
-#. i18n: ectx: property (text), widget (QLabel, country)
-#: src/widgets/certificateparty.ui:98
-msgid "Canada"
-msgstr "Kanada"
-
-#. i18n: ectx: property (text), widget (QLabel, stateTag)
-#: src/widgets/certificateparty.ui:108
-msgid "State:"
-msgstr "Savezna država:"
-
-#. i18n: ectx: property (text), widget (QLabel, state)
-#: src/widgets/certificateparty.ui:118
-msgid "Quebec"
-msgstr "Quebec"
-
-#. i18n: ectx: property (text), widget (QLabel, cityTag)
-#: src/widgets/certificateparty.ui:128
-msgid "City:"
-msgstr "Grad:"
-
-#. i18n: ectx: property (text), widget (QLabel, city)
-#: src/widgets/certificateparty.ui:138
-msgid "Lakeridge Meadows"
-msgstr "Travnjaci Lakeridge"
-
-#: src/widgets/fileundomanager.cpp:124
-msgid "Creating directory"
-msgstr "Stvaranje direktorija"
-
-#: src/widgets/fileundomanager.cpp:129
-msgid "Moving"
-msgstr "Premještanje"
-
-#: src/widgets/fileundomanager.cpp:135
-msgid "Deleting"
-msgstr "Brisanje"
-
-#: src/widgets/fileundomanager.cpp:300
-msgid "Und&o"
-msgstr "P&oništi"
-
-#: src/widgets/fileundomanager.cpp:306
-msgid "Und&o: Copy"
-msgstr "P&oništi: kopiranje"
-
-#: src/widgets/fileundomanager.cpp:308
-msgid "Und&o: Link"
-msgstr "P&oništi: povezivanje"
-
-#: src/widgets/fileundomanager.cpp:310
-msgid "Und&o: Move"
-msgstr "P&oništi: premještanje"
-
-#: src/widgets/fileundomanager.cpp:312
-msgid "Und&o: Rename"
-msgstr "P&oništiti: preimenovanje"
-
-#: src/widgets/fileundomanager.cpp:314
-msgid "Und&o: Trash"
-msgstr "P&oništiti: Bacanje u smeće"
-
-#: src/widgets/fileundomanager.cpp:316
-msgid "Und&o: Create Folder"
-msgstr "Poništi: stvori mapu"
-
-#: src/widgets/fileundomanager.cpp:318
-msgid "Und&o: Create File"
-msgstr "P&oništi: stvori datoteku"
-
-#: src/widgets/fileundomanager.cpp:771
-#, kde-format
-msgid ""
-"The file %1 was copied from %2, but since then it has apparently been "
-"modified at %3.\n"
-"Undoing the copy will delete the file, and all modifications will be lost.\n"
-"Are you sure you want to delete %4?"
-msgstr ""
-"Datoteka %1 je kopirana iz %2, ali od onda je izgleda bila izmijenjna na "
-"%3.\n"
-"Odbijanje kopiranja će izbrisati datoteku i sve izmjene bit će izgubljene.\n"
-"Jeste li sigurni da želite izbrisati %4?"
-
-#: src/widgets/fileundomanager.cpp:774
-msgid "Undo File Copy Confirmation"
-msgstr "Poništi potvrdu o kopiranju datoteka."
-
-#: src/widgets/jobuidelegate.cpp:230
-msgctxt "@info"
-msgid ""
-"Do you want to permanently delete all items from Trash? This action cannot "
-"be undone."
-msgstr ""
-"Želite li trajno obrisati sve stavke iz vašeg otpada? Ova radnja ne može "
-"biti poništena."
-
-#: src/widgets/jobuidelegate.cpp:241
-#, kde-format
-msgid "Do you really want to move this item to the trash?"
-msgid_plural "Do you really want to move these %1 items to the trash?"
-msgstr[0] "Želite li zaista premjestiti ovu %1 stavku u smeće?"
-msgstr[1] "Želite li zaista premjestiti ove %1 stavke u smeće?"
-msgstr[2] "Želite li zaista premjestiti ovih %1 stavaka u smeće?"
-
-#: src/widgets/jobuidelegate.cpp:244
-msgctxt "Verb"
-msgid "&Trash"
-msgstr "Baci&ti u smeće"
-
-#: src/widgets/jobuidelegate.cpp:335
-msgid "The peer SSL certificate chain appears to be corrupt."
-msgstr "Čini se da je SSL potvrda treće osobe pokvarena."
-
-#: src/widgets/kacleditwidget.cpp:59 src/widgets/kacleditwidget.cpp:448
-msgid "Owner"
-msgstr "Vlasnik"
-
-#: src/widgets/kacleditwidget.cpp:60 src/widgets/kacleditwidget.cpp:453
-msgid "Owning Group"
-msgstr "Vlasnička grupa"
-
-#: src/widgets/kacleditwidget.cpp:61 src/widgets/kacleditwidget.cpp:458
-#: src/widgets/kpropertiesdialog.cpp:2022
-msgid "Others"
-msgstr "Ostali"
-
-#: src/widgets/kacleditwidget.cpp:62 src/widgets/kacleditwidget.cpp:463
-msgid "Mask"
-msgstr "Maska"
-
-#: src/widgets/kacleditwidget.cpp:63
-msgid "Named User"
-msgstr "Imenovan korisnik"
-
-#: src/widgets/kacleditwidget.cpp:64
-msgid "Named Group"
-msgstr "Imenovana grupa"
-
-#: src/widgets/kacleditwidget.cpp:100
-msgid "Edit Entry..."
-msgstr "Uredi unos…"
-
-#: src/widgets/kacleditwidget.cpp:104
-msgid "Delete Entry"
-msgstr "Izbriši unos"
-
-#: src/widgets/kacleditwidget.cpp:308
-msgid " (Default)"
-msgstr " (Zadano)"
-
-#: src/widgets/kacleditwidget.cpp:429
-msgid "Edit ACL Entry"
-msgstr "Uredi ACL unos"
-
-#: src/widgets/kacleditwidget.cpp:433
-msgid "Entry Type"
-msgstr "Tip unosa"
-
-#: src/widgets/kacleditwidget.cpp:439
-msgid "Default for new files in this folder"
-msgstr "Uobičajeno za nove datoteke u ovom direktoriju"
-
-#: src/widgets/kacleditwidget.cpp:468
-msgid "Named user"
-msgstr "Imenovan korisnik"
-
-#: src/widgets/kacleditwidget.cpp:473
-msgid "Named group"
-msgstr "Imenovana grupa"
-
-#: src/widgets/kacleditwidget.cpp:493
-msgid "User: "
-msgstr "Korisnik:"
-
-#: src/widgets/kacleditwidget.cpp:508
-msgid "Group: "
-msgstr "Grupa:"
-
-#: src/widgets/kacleditwidget.cpp:645
-msgid "Type"
-msgstr "Vrsta"
-
-#: src/widgets/kacleditwidget.cpp:646
-msgid "Name"
-msgstr "Ime"
-
-#: src/widgets/kacleditwidget.cpp:647
-msgctxt "read permission"
-msgid "r"
-msgstr "č"
-
-#: src/widgets/kacleditwidget.cpp:648
-msgctxt "write permission"
-msgid "w"
-msgstr "p"
-
-#: src/widgets/kacleditwidget.cpp:649
-msgctxt "execute permission"
-msgid "x"
-msgstr "i"
-
-#: src/widgets/kacleditwidget.cpp:650
-msgid "Effective"
-msgstr "Efektivno"
-
-#: src/widgets/kbuildsycocaprogressdialog.cpp:45
-msgid "Updating System Configuration"
-msgstr "Obnova postavki sustava."
-
-#: src/widgets/kbuildsycocaprogressdialog.cpp:46
-msgid "Updating system configuration."
-msgstr "Obnova postavki sustava."
-
-#: src/widgets/kdesktopfileactions.cpp:67
-#, kde-format
-msgid "The desktop entry file %1 has no Type=... entry."
-msgstr "Stavka datoteke na radnoj površini %1 nema Type… unos."
-
-#: src/widgets/kdesktopfileactions.cpp:84
-#, kde-format
-msgid ""
-"The desktop entry of type\n"
-"%1\n"
-"is unknown."
-msgstr ""
-"Stavka na radnoj površini, tipa\n"
-"%1\n"
-"nije poznata."
-
-#: src/widgets/kdesktopfileactions.cpp:97
-#: src/widgets/kdesktopfileactions.cpp:177
-#: src/widgets/kdesktopfileactions.cpp:310
-#, kde-format
-msgid ""
-"The desktop entry file\n"
-"%1\n"
-"is of type FSDevice but has no Dev=... entry."
-msgstr ""
-"Stavka datoteke na radnoj površini\n"
-"%1\n"
-"je tipa FSDevice ali nema Dev… unos."
-
-#: src/widgets/kdesktopfileactions.cpp:143
-#, kde-format
-msgid ""
-"The desktop entry file\n"
-"%1\n"
-"is of type Link but has no URL=... entry."
-msgstr ""
-"Stavka datoteke na radnoj površini\n"
-"%1\n"
-"je tipa veze ali nema URL… unos."
-
-#: src/widgets/kdesktopfileactions.cpp:213
-msgid "Mount"
-msgstr "Monitraj"
-
-#: src/widgets/kdesktopfileactions.cpp:224
-msgid "Eject"
-msgstr "Izbaci"
-
-#: src/widgets/kdesktopfileactions.cpp:226
-msgid "Unmount"
-msgstr "Demonitraj"
-
-#: src/widgets/kdirmodel.cpp:1066
-msgctxt "@title:column"
-msgid "Name"
-msgstr "Naziv"
-
-#: src/widgets/kdirmodel.cpp:1068
-msgctxt "@title:column"
-msgid "Size"
-msgstr "Size"
-
-#: src/widgets/kdirmodel.cpp:1070
-msgctxt "@title:column"
-msgid "Date"
-msgstr "Datum"
-
-#: src/widgets/kdirmodel.cpp:1072
-msgctxt "@title:column"
-msgid "Permissions"
-msgstr "Dozvole"
-
-#: src/widgets/kdirmodel.cpp:1074
-msgctxt "@title:column"
-msgid "Owner"
-msgstr "Owner"
-
-#: src/widgets/kdirmodel.cpp:1076
-msgctxt "@title:column"
-msgid "Group"
-msgstr "Grupa"
-
-#: src/widgets/kdirmodel.cpp:1078
-msgctxt "@title:column"
-msgid "Type"
-msgstr "Vrsta"
-
-#: src/widgets/kfileitemactions.cpp:399
-msgctxt "@title:menu"
-msgid "&Actions"
-msgstr "&Akcije"
-
-#: src/widgets/kfileitemactions.cpp:525
-#, kde-format
-msgid "&Open with %1"
-msgstr "&Otvori s %1|/|&Otvori s $[ins %1]"
-
-#: src/widgets/kfileitemactions.cpp:551
-msgctxt "@title:menu"
-msgid "&Open With"
-msgstr "&Otvori pomoću"
-
-#: src/widgets/kfileitemactions.cpp:568
-msgctxt "@action:inmenu Open With"
-msgid "&Other..."
-msgstr "&Ostalo…"
-
-#: src/widgets/kfileitemactions.cpp:570 src/widgets/kfileitemactions.cpp:579
-msgctxt "@title:menu"
-msgid "&Open With..."
-msgstr "&Otvori pomoću…"
-
-#: src/widgets/kfileitemactions.cpp:683
-#, kde-format
-msgid "Open &with %1"
-msgstr "Ot&vori pomoću %1"
-
-#: src/widgets/kfileitemactions.cpp:685
-#, kde-format
-msgctxt "@item:inmenu Open With, %1 is application name"
-msgid "%1"
-msgstr "%1|/|$[gen %1]"
-
-#: src/widgets/kfileitemdelegate.cpp:221
-#, kde-format
-msgctxt "Items in a folder"
-msgid "1 item"
-msgid_plural "%1 items"
-msgstr[0] "%1 stavka"
-msgstr[1] "%1 stavke"
-msgstr[2] "%1 stavaka"
-
-#: src/widgets/kfileitemdelegate.cpp:277 src/widgets/kfileitemdelegate.cpp:281
-msgctxt "@info mimetype"
-msgid "Unknown"
-msgstr "Nepoznat"
-
-#: src/widgets/kopenwithdialog.cpp:271
-msgid "Known Applications"
-msgstr "Poznate aplikacije"
-
-#: src/widgets/kopenwithdialog.cpp:493
-msgid "Open With"
-msgstr "Otvori pomoću"
-
-#: src/widgets/kopenwithdialog.cpp:497
-#, kde-format
-msgid ""
-"Select the program that should be used to open %1 . If the program "
-"is not listed, enter the name or click the browse button. "
-msgstr ""
-"Odaberite program koji će biti korišten za otvaranje %1 . Ako "
-"program nije na popisu, unesite naziv ili kliknite na gumb za pregledavanje."
-" "
-
-#: src/widgets/kopenwithdialog.cpp:503
-msgid "Choose the name of the program with which to open the selected files."
-msgstr "Izaberite naziv programa u kojemu želite otvoriti izabrane datoteke."
-
-#: src/widgets/kopenwithdialog.cpp:533
-#, kde-format
-msgid "Choose Application for %1"
-msgstr "Izaberite aplikaciju za %1"
-
-#: src/widgets/kopenwithdialog.cpp:534
-#, kde-format
-msgid ""
-"Select the program for the file type: %1 . If the program is not "
-"listed, enter the name or click the browse button. "
-msgstr ""
-"Odaberite program koji ćete povezati sa datotekama tipa: %1 . Ako "
-"nije naveden program, upišite naziv ili kliknite gumb Potraži. "
-
-#: src/widgets/kopenwithdialog.cpp:549
-msgid "Choose Application"
-msgstr "Odaberite aplikaciju"
-
-#: src/widgets/kopenwithdialog.cpp:550
-msgid ""
-"Select a program. If the program is not listed, enter the name or click "
-"the browse button. "
-msgstr ""
-"Odaberite željenu aplikaciju. Ako željena aplikacija nije u popisu, "
-"upišite njen naziv ili kliknite gumb Potraži. "
-
-#: src/widgets/kopenwithdialog.cpp:609
-msgid ""
-"Following the command, you can have several place holders which will be "
-"replaced with the actual values when the actual program is run:\n"
-"%f - a single file name\n"
-"%F - a list of files; use for applications that can open several local files "
-"at once\n"
-"%u - a single URL\n"
-"%U - a list of URLs\n"
-"%d - the directory of the file to open\n"
-"%D - a list of directories\n"
-"%i - the icon\n"
-"%m - the mini-icon\n"
-"%c - the comment"
-msgstr ""
-"Slijedeći naredbu, možete imati nekoliko stavki koje će se zamjeniti sa "
-"pravim vrijednostima kad se pravi program pokrene:\n"
-" %f – jedno ime datoteke\n"
-"%F – lista datoteka; upotrijebiti za aplikacije that koje mogu otvoriti "
-"nekoliko lokalnih datotekaodjednom\n"
-"%u – jedan URL\n"
-"%U – lista URLova\n"
-"%d – direktorij datoteke koju treba otvoriti\n"
-"%D – lista direktorija\n"
-"%i – ikona\n"
-"%m – mini-ikona\n"
-"%c – komentar"
-
-#: src/widgets/kopenwithdialog.cpp:644
-msgid "Run in &terminal"
-msgstr "Pokreni u &terminalu"
-
-#: src/widgets/kopenwithdialog.cpp:662
-msgid "&Do not close when command exits"
-msgstr "Ne zatvaraj kad naredba izađe"
-
-#: src/widgets/kopenwithdialog.cpp:679
-msgid "&Remember application association for this type of file"
-msgstr "Zapamti koji p&rogram otvara ovu vrstu datoteke"
-
-#: src/widgets/kopenwithdialog.cpp:827
-#, kde-format
-msgid ""
-"Could not extract executable name from '%1', please type a valid program "
-"name."
-msgstr ""
-"Ne mogu izvući naziv izvršne datoteke iz '%1'. Molim upišite valjani naziv "
-"programa."
-
-#: src/widgets/kopenwithdialog.cpp:877
-#, kde-format
-msgid "'%1' not found, please type a valid program name."
-msgstr "'%1' nije pronađen, molim upišite valjan naziv programa."
-
-#. i18n: ectx: property (title), widget (QGroupBox, buttonGroup2)
-#: src/widgets/kpropertiesdesktopadvbase.ui:11
-msgctxt ""
-"@title:group Title of a group that lets the user choose options about the "
-"terminal when launching a program"
-msgid "Terminal"
-msgstr "Konzola"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, terminalCheck)
-#: src/widgets/kpropertiesdesktopadvbase.ui:33
-msgid ""
-"Check this option if the application you want to run is a text mode "
-"application or if you want the information that is provided by the terminal "
-"emulator window."
-msgstr ""
-"Odaberite ovu opciju ako je aplikacija koju želite pokrenuti tekst mod "
-"aplikacija ili ako želite vidjeti informaciju koju pruža prozor terminal "
-"emulatora."
-
-#. i18n: ectx: property (text), widget (QCheckBox, terminalCheck)
-#: src/widgets/kpropertiesdesktopadvbase.ui:36
-msgid "&Run in terminal"
-msgstr "Pok&reni u terminalu"
-
-#. i18n: ectx: property (text), widget (QLabel, terminalEditLabel)
-#: src/widgets/kpropertiesdesktopadvbase.ui:43
-msgid "&Terminal options:"
-msgstr "Odrednice &terminala:"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, terminalCloseCheck)
-#: src/widgets/kpropertiesdesktopadvbase.ui:53
-msgid ""
-"Check this option if the text mode application offers relevant information "
-"on exit. Keeping the terminal emulator open allows you to retrieve this "
-"information."
-msgstr ""
-"Odaberite ovu opciju ako tekst mod aplikacija nudi relevantne informacije "
-"pri izlasku. Držanje terminal emulatora otvorenim dozvoljava vam da uzmete "
-"ovu informaciju. "
-
-#. i18n: ectx: property (text), widget (QCheckBox, terminalCloseCheck)
-#: src/widgets/kpropertiesdesktopadvbase.ui:56
-msgid "Do not &close when command exits"
-msgstr "Ne &zatvoriti kada naredba završi"
-
-#. i18n: ectx: property (title), widget (QGroupBox, buttonGroup2_2)
-#: src/widgets/kpropertiesdesktopadvbase.ui:69
-msgctxt ""
-"@title:group Title of a group that lets the user choose which user to use "
-"when launching a program"
-msgid "User"
-msgstr "Korisnik"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, suidCheck)
-#: src/widgets/kpropertiesdesktopadvbase.ui:75
-msgid ""
-"Check this option if you want to run this application with a different user "
-"id. Every process has a different user id associated with it. This id code "
-"determines file access and other permissions. The password of the user is "
-"required to use this option."
-msgstr ""
-"Označite ovu opciju ako želite pokrenuti ovu aplikaciju a drugačijim "
-"korisničkim identitetom. Svaki proces ima drugačiji korisnički identifikator "
-"s kojim je povezan. Ovaj identifikator određuje dozvole pristupa datotekama "
-"i druge dozvole. Zaporka korisnika je potrebna za korištenje ove opcije. "
-
-#. i18n: ectx: property (text), widget (QCheckBox, suidCheck)
-#: src/widgets/kpropertiesdesktopadvbase.ui:78
-msgid "Ru&n as a different user"
-msgstr "Pokre&ni kao neki drugi korisnik"
-
-#. i18n: ectx: property (whatsThis), widget (QLabel, suidEditLabel)
-#: src/widgets/kpropertiesdesktopadvbase.ui:101
-msgid "Enter the user name you want to run the application as."
-msgstr "Unesite korisničko ime pod kojim želite pokretati ovaj program."
-
-#. i18n: ectx: property (text), widget (QLabel, suidEditLabel)
-#: src/widgets/kpropertiesdesktopadvbase.ui:104
-msgid "&Username:"
-msgstr "&Korisničko ime:"
-
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, suidEdit)
-#: src/widgets/kpropertiesdesktopadvbase.ui:114
-msgid "Enter the user name you want to run the application as here."
-msgstr "Unesite korisničko ime pod kojim želite pokretati ovaj program."
-
-#. i18n: ectx: property (title), widget (QGroupBox, buttonGroup4)
-#: src/widgets/kpropertiesdesktopadvbase.ui:124
-msgctxt ""
-"@title:group Title of a group that lets the user choose options regargin "
-"program startup"
-msgid "Startup"
-msgstr "Pokretanje"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, startupInfoCheck)
-#: src/widgets/kpropertiesdesktopadvbase.ui:130
-msgid ""
-"Check this option if you want to make clear that your application has "
-"started. This visual feedback may appear as a busy cursor or in the taskbar."
-msgstr ""
-"Odaberite ovu opciju ako želite pojasniti da je vaša aplikacija pokrenuta. "
-"Ova vizualna povratna informacija se može prikazati kao pokazivač zauzetosti "
-"ili u programskoj traci. "
-
-#. i18n: ectx: property (text), widget (QCheckBox, startupInfoCheck)
-#: src/widgets/kpropertiesdesktopadvbase.ui:133
-msgid "Enable &launch feedback"
-msgstr "&Omogućite povratnu informaciju o pokretanju"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, systrayCheck)
-#: src/widgets/kpropertiesdesktopadvbase.ui:140
-msgid ""
-"Check this option if you want to have a system tray handle for your "
-"application."
-msgstr ""
-"Obaberite ovu opciju ako želite imati ručku sustavske trake za svoju "
-"aplikaciju. "
-
-#. i18n: ectx: property (text), widget (QCheckBox, systrayCheck)
-#: src/widgets/kpropertiesdesktopadvbase.ui:143
-msgid "&Place in system tray"
-msgstr "&Postavi u sistemski blok"
-
-#. i18n: ectx: property (text), widget (QLabel, textLabel12)
-#: src/widgets/kpropertiesdesktopadvbase.ui:150
-msgid "&D-Bus registration:"
-msgstr "&D-Bus registracija:"
-
-#. i18n: ectx: property (text), item, widget (KComboBox, dbusCombo)
-#: src/widgets/kpropertiesdesktopadvbase.ui:161
-msgid "None"
-msgstr "Nijedna"
-
-#. i18n: ectx: property (text), item, widget (KComboBox, dbusCombo)
-#: src/widgets/kpropertiesdesktopadvbase.ui:166
-msgid "Multiple Instances"
-msgstr "Višestruki slučajevi"
-
-#. i18n: ectx: property (text), item, widget (KComboBox, dbusCombo)
-#: src/widgets/kpropertiesdesktopadvbase.ui:171
-msgid "Single Instance"
-msgstr "Jedina pojava"
-
-#. i18n: ectx: property (text), item, widget (KComboBox, dbusCombo)
-#: src/widgets/kpropertiesdesktopadvbase.ui:176
-msgid "Run Until Finished"
-msgstr "Radi do završetka "
-
-#. i18n: ectx: property (whatsThis), widget (QLabel, nameLabel)
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, nameEdit)
-#: src/widgets/kpropertiesdesktopbase.ui:14
-#: src/widgets/kpropertiesdesktopbase.ui:27
-msgid ""
-"Type the name you want to give to this application here. This application "
-"will appear under this name in the applications menu and in the panel."
-msgstr ""
-"Ovdje unosite ime koje želite dati programu. Ovaj program će se pojavljivati "
-"pod ovim imenom u izborniku programa i u ploči."
-
-#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel2)
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, genNameEdit)
-#: src/widgets/kpropertiesdesktopbase.ui:34
-#: src/widgets/kpropertiesdesktopbase.ui:47
-msgid ""
-"Type the description of this application, based on its use, here. Examples: "
-"a dial up application (KPPP) would be \"Dial up tool\"."
-msgstr ""
-"Ovdje unosite opis ovog programa, na osnovu njegove svrhe. Na primjer: "
-"Program za povezivanje na Internet (KPPP) bi bio „Alat za povezivanje na "
-"Internet“."
-
-#. i18n: ectx: property (text), widget (QLabel, textLabel2)
-#: src/widgets/kpropertiesdesktopbase.ui:37
-msgid "&Description:"
-msgstr "&Opis:"
-
-#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel3)
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, commentEdit)
-#: src/widgets/kpropertiesdesktopbase.ui:54
-#: src/widgets/kpropertiesdesktopbase.ui:67
-msgid "Type any comment you think is useful here."
-msgstr "Ovdje unosite bilo koji komentar koji će možda biti koristan."
-
-#. i18n: ectx: property (text), widget (QLabel, textLabel3)
-#: src/widgets/kpropertiesdesktopbase.ui:57
-msgid "Comm&ent:"
-msgstr "&Komentar:"
-
-#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel4)
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, commandEdit)
-#: src/widgets/kpropertiesdesktopbase.ui:85
-#: src/widgets/kpropertiesdesktopbase.ui:111
-#, no-c-format
-msgid ""
-"Type the command to start this application here.\n"
-"\n"
-"Following the command, you can have several place holders which will be "
-"replaced with the actual values when the actual program is run:\n"
-"%f - a single file name\n"
-"%F - a list of files; use for applications that can open several local files "
-"at once\n"
-"%u - a single URL\n"
-"%U - a list of URLs\n"
-"%d - the directory of the file to open\n"
-"%D - a list of directories\n"
-"%i - the icon\n"
-"%m - the mini-icon\n"
-"%c - the caption"
-msgstr ""
-"Ovdje unesite naredbu za pokretanje ovog programa.\n"
-"\n"
-"Prateći naredbu, možete imati više simbola koji će prilikom pokretanja "
-"programa biti zamjenjeni stvarnim vrijednostima:\n"
-"%f – ime datoteke\n"
-"%F – popis datoteka koristi se za programe koji mogu otvoriti više lokalnih "
-"datoteka odjednom\n"
-"%u – jedan URL\n"
-"%U – popis URL-ova\n"
-"%d – direktorij datoteke za otvaranje\n"
-"%D – popis direktorija\n"
-"%i – sličica\n"
-"%m – mini sličica\n"
-"%c – komentar"
-
-#. i18n: ectx: property (text), widget (QLabel, textLabel4)
-#: src/widgets/kpropertiesdesktopbase.ui:88
-msgid "Co&mmand:"
-msgstr "&Naredba:"
-
-#. i18n: ectx: property (whatsThis), widget (QPushButton, browseButton)
-#: src/widgets/kpropertiesdesktopbase.ui:118
-msgid ""
-"Click here to browse your file system in order to find the desired "
-"executable."
-msgstr ""
-"Pritisnite ovdje da pretražite svoj datotečni sustav kako bi našli željenu "
-"izvršnu datoteku."
-
-#. i18n: ectx: property (text), widget (QPushButton, browseButton)
-#: src/widgets/kpropertiesdesktopbase.ui:121
-msgid "&Browse..."
-msgstr "Po&traži…"
-
-#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel5)
-#. i18n: ectx: property (whatsThis), widget (KUrlRequester, pathEdit)
-#: src/widgets/kpropertiesdesktopbase.ui:130
-#: src/widgets/kpropertiesdesktopbase.ui:143
-msgid "Sets the working directory for your application."
-msgstr "Postavlja radni direktorij za vašu aplikaciju."
-
-#. i18n: ectx: property (text), widget (QLabel, textLabel5)
-#: src/widgets/kpropertiesdesktopbase.ui:133
-msgid "&Work path:"
-msgstr "&Radna putanja:"
-
-#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel7)
-#. i18n: ectx: property (whatsThis), widget (QTreeWidget, filetypeList)
-#: src/widgets/kpropertiesdesktopbase.ui:157
-#: src/widgets/kpropertiesdesktopbase.ui:178
-msgid ""
-"This list should show the types of file that your application can "
-"handle. This list is organized by mimetypes .
\n"
-"MIME, Multipurpose Internet (e)Mail Extension, is a standard protocol for "
-"identifying the type of data based on filename extensions and correspondent "
-"mimetypes . Example: the \"bmp\" part that comes after the dot in "
-"flower.bmp indicates that it is a specific kind of image, image/x-bmp"
-"u>. To know which application should open each type of file, the system "
-"should be informed about the abilities of each application to handle these "
-"extensions and mimetypes.
\n"
-"If you want to associate this application with one or more mimetypes that "
-"are not in this list, click on the button Add below. If there are one "
-"or more filetypes that this application cannot handle, you may want to "
-"remove them from the list clicking on the button Remove below.
"
-"qt>"
-msgstr ""
-"Ova lista bi trebala pokazivati tipove datoteka koje Vaša aplikacija "
-"može koristiti. Popis je organiziran po mimetipovima .
\n"
-"MIME, Multipurpose Internet (e)Mail Extension (Višesvrhni dodatak "
-"internet pošti) je standardni protokol za određivanje tipova podataka prema "
-"ekstenzijama imena datoteka i odgovarajućim mimetipovima . Na primjer: "
-"\"bmp\" dio koji dolazi iza točke u imenu datoteke \"cvijet.bmp\" označava "
-"da je to posebna vrsta slike, image/x-bmp . Kako bi znali koja "
-"aplikacija smije otvarati koju vrstu datoteke, sustav za svaku aplikaciju "
-"mora znati koju vrstu ekstenzija i mimetipova ona može otvarati.
\n"
-"Ako želite pridružiti ovoj aplikaciji jedan ili više mimetipova koji nisu "
-"na ovome popisu, kliknite na gumb Dodaj . Ako je naveden jedan ili "
-"više mimetipova koje ova aplikacija ne može koristiti, možda ćete htjeti "
-"maknuti ih s popisa tako da kliknete na gumb Makni .
"
-
-#. i18n: ectx: property (text), widget (QLabel, textLabel7)
-#: src/widgets/kpropertiesdesktopbase.ui:160
-msgid "&Supported file types:"
-msgstr "&Podržani tipovi datoteka:"
-
-#. i18n: ectx: property (text), widget (QTreeWidget, filetypeList)
-#: src/widgets/kpropertiesdesktopbase.ui:191
-msgid "Mimetype"
-msgstr "Mimetip"
-
-#. i18n: ectx: property (text), widget (QTreeWidget, filetypeList)
-#: src/widgets/kpropertiesdesktopbase.ui:196
-msgid "Description"
-msgstr "Opis"
-
-#. i18n: ectx: property (whatsThis), widget (QPushButton, addFiletypeButton)
-#: src/widgets/kpropertiesdesktopbase.ui:206
-msgid ""
-"Click on this button if you want to add a type of file (mimetype) that your "
-"application can handle."
-msgstr ""
-"Pritisnite na ovaj gumb ako želite dodati tip datoteke (mimetip) kojim vaša "
-"aplikacija može rukovati."
-
-#. i18n: ectx: property (text), widget (QPushButton, addFiletypeButton)
-#: src/widgets/kpropertiesdesktopbase.ui:209
-msgid "Add..."
-msgstr "Dodaj…"
-
-#. i18n: ectx: property (whatsThis), widget (QPushButton, delFiletypeButton)
-#: src/widgets/kpropertiesdesktopbase.ui:216
-msgid ""
-"If you want to remove a type of file (mimetype) that your application cannot "
-"handle, select the mimetype in the list above and click on this button."
-msgstr ""
-"Ako želite da uklonite tip datoteke (mime tip) sa kojim vaš program ne može "
-"raditi, odaberite mime tip iz gornje liste i pritisnite ovaj gumb."
-
-#. i18n: ectx: property (text), widget (QPushButton, delFiletypeButton)
-#: src/widgets/kpropertiesdesktopbase.ui:219
-msgid "Remove"
-msgstr "Ukloni"
-
-#. i18n: ectx: property (whatsThis), widget (QPushButton, advancedButton)
-#: src/widgets/kpropertiesdesktopbase.ui:242
-msgid ""
-"Click here to modify the way this application will run, launch feedback, D-"
-"Bus options or to run it as a different user."
-msgstr ""
-"Pritisnite ovdje da izmijenite način na koji će se ova aplikacija "
-"izvršavati, davati povratnu informaciju, D-Bus opcije ili pokretati pod "
-"drugim korisnikom."
-
-#. i18n: ectx: property (text), widget (QPushButton, advancedButton)
-#: src/widgets/kpropertiesdesktopbase.ui:245
-msgid "Ad&vanced Options"
-msgstr "Napredne op&cije"
-
-#: src/widgets/kpropertiesdialog.cpp:202 src/widgets/kpropertiesdialog.cpp:217
-#: src/widgets/kpropertiesdialog.cpp:229 src/widgets/kpropertiesdialog.cpp:245
-#: src/widgets/kpropertiesdialog.cpp:263
-#, kde-format
-msgid "Properties for %1"
-msgstr "Svojstva za %1"
-
-#: src/widgets/kpropertiesdialog.cpp:227
-#, kde-format
-msgid "Properties for 1 item"
-msgid_plural "Properties for %1 Selected Items"
-msgstr[0] "Svojstva za %1 odabrani objekt"
-msgstr[1] "Svojstva za %1 odabrana objekta"
-msgstr[2] "Svojstva za %1 odabranih objekata"
-
-#: src/widgets/kpropertiesdialog.cpp:783
-msgctxt "@title:tab File properties"
-msgid "&General"
-msgstr "&Općenito"
-
-#: src/widgets/kpropertiesdialog.cpp:964
-msgid "Type:"
-msgstr "Vrsta:"
-
-#: src/widgets/kpropertiesdialog.cpp:983
-#, fuzzy
-#| msgid "Create new file type"
-msgid "Create New File Type"
-msgstr "Stvori novu vrstu datoteke"
-
-#: src/widgets/kpropertiesdialog.cpp:985
-#, fuzzy
-#| msgid "File types:"
-msgid "File Type Options"
-msgstr "Tipovi datoteka:"
-
-#: src/widgets/kpropertiesdialog.cpp:996
-msgid "Contents:"
-msgstr "Sadržaj:"
-
-#: src/widgets/kpropertiesdialog.cpp:1004
-#: src/widgets/kurlrequesterdialog.cpp:57
-msgid "Location:"
-msgstr "Lokacija:"
-
-#: src/widgets/kpropertiesdialog.cpp:1019
-msgid "Size:"
-msgstr "Veličina:"
-
-#: src/widgets/kpropertiesdialog.cpp:1035
-msgid "Calculate"
-msgstr "Izračunaj"
-
-#: src/widgets/kpropertiesdialog.cpp:1036
-msgid "Stop"
-msgstr "Zaustaviti"
-
-#: src/widgets/kpropertiesdialog.cpp:1045
-#: src/widgets/kpropertiesdialog.cpp:1246
-msgid "Refresh"
-msgstr "Osvježi"
-
-#: src/widgets/kpropertiesdialog.cpp:1053
-msgid "Points to:"
-msgstr "Pokazuje na:"
-
-#: src/widgets/kpropertiesdialog.cpp:1064
-msgid "Created:"
-msgstr "Stvoreno:"
-
-#: src/widgets/kpropertiesdialog.cpp:1073
-msgid "Modified:"
-msgstr "Mijenjano:"
-
-#: src/widgets/kpropertiesdialog.cpp:1082
-msgid "Accessed:"
-msgstr "Pristupljeno:"
-
-#: src/widgets/kpropertiesdialog.cpp:1100
-msgid "Mounted on:"
-msgstr "Montiran na:"
-
-#: src/widgets/kpropertiesdialog.cpp:1108
-#: src/widgets/kpropertiesdialog.cpp:2859
-msgid "Device usage:"
-msgstr "Korištenje uređaja:"
-
-#: src/widgets/kpropertiesdialog.cpp:1209
-#: src/widgets/kpropertiesdialog.cpp:2991
-#, kde-format
-msgctxt "Available space out of total partition size (percent used)"
-msgid "%1 free of %2 (%3% used)"
-msgstr "%1 slobodan od %2 (%3% iskorišten)"
-
-#: src/widgets/kpropertiesdialog.cpp:1223
-#, kde-format
-msgid ""
-"Calculating... %1 (%2)\n"
-"%3, %4"
-msgstr ""
-"Izračunavanje… %1 (%2)\n"
-"%3, %4"
-
-#: src/widgets/kpropertiesdialog.cpp:1226
-#: src/widgets/kpropertiesdialog.cpp:1241
-#, kde-format
-msgid "1 file"
-msgid_plural "%1 files"
-msgstr[0] "%1 datoteka"
-msgstr[1] "%1 datoteke"
-msgstr[2] "%1 datoteka"
-
-#: src/widgets/kpropertiesdialog.cpp:1227
-#: src/widgets/kpropertiesdialog.cpp:1242
-#, kde-format
-msgid "1 sub-folder"
-msgid_plural "%1 sub-folders"
-msgstr[0] "%1 podmapa"
-msgstr[1] "%1 podmape"
-msgstr[2] "%1 podmapa"
-
-#: src/widgets/kpropertiesdialog.cpp:1255
-msgid "Calculating..."
-msgstr "Računam…"
-
-#: src/widgets/kpropertiesdialog.cpp:1287
-#, kde-format
-msgid "At least %1"
-msgstr "Najmanje %1 "
-
-#: src/widgets/kpropertiesdialog.cpp:1325
-msgid "The new file name is empty."
-msgstr "Novi naziv datoteke je prazan."
-
-#: src/widgets/kpropertiesdialog.cpp:1508
-#: src/widgets/kpropertiesdialog.cpp:2736
-#: src/widgets/kpropertiesdialog.cpp:3036
-#: src/widgets/kpropertiesdialog.cpp:3290
-#, kde-format
-msgid ""
-"Could not save properties. You do not have sufficient access to write to "
-"%1 . "
-msgstr ""
-"Ne mogu spremiti svojstva. Nemate dozvolu pisanja u %1 . "
-
-#: src/widgets/kpropertiesdialog.cpp:1584
-#: src/widgets/kpropertiesdialog.cpp:1590
-#: src/widgets/kpropertiesdialog.cpp:1597
-msgid "Forbidden"
-msgstr "Zabranjeno"
-
-#: src/widgets/kpropertiesdialog.cpp:1585
-msgid "Can Read"
-msgstr "Može čitati"
-
-#: src/widgets/kpropertiesdialog.cpp:1586
-msgid "Can Read & Write"
-msgstr "Može čitati i pisati"
-
-#: src/widgets/kpropertiesdialog.cpp:1591
-msgid "Can View Content"
-msgstr "Može pregledavati sadržaj"
-
-#: src/widgets/kpropertiesdialog.cpp:1592
-msgid "Can View & Modify Content"
-msgstr "Može pregledavati i mijenjati sadržaj"
-
-#: src/widgets/kpropertiesdialog.cpp:1598
-msgid "Can View Content & Read"
-msgstr "Može pregledavati sadržaj i čitati"
-
-#: src/widgets/kpropertiesdialog.cpp:1599
-msgid "Can View/Read & Modify/Write"
-msgstr "Može pregledavati/čitati i mijenjati/pisati"
-
-#: src/widgets/kpropertiesdialog.cpp:1696
-msgid "&Permissions"
-msgstr "&Ovlasti"
-
-#: src/widgets/kpropertiesdialog.cpp:1708
-#: src/widgets/kpropertiesdialog.cpp:1944
-msgid "Access Permissions"
-msgstr "Ovlasti pristupa"
-
-#: src/widgets/kpropertiesdialog.cpp:1716
-msgid "This file is a link and does not have permissions."
-msgid_plural "All files are links and do not have permissions."
-msgstr[0] "Ova datoteka je poveznica i nema dozvole."
-msgstr[1] "Sve ove datoteke su poveznice i nemaju dozvole."
-msgstr[2] "Sve ove datoteke su poveznice i nemaju dozvole."
-
-#: src/widgets/kpropertiesdialog.cpp:1720
-msgid "Only the owner can change permissions."
-msgstr "Samo vlasnik može promjeniti ovlasti "
-
-#: src/widgets/kpropertiesdialog.cpp:1724
-msgid "O&wner:"
-msgstr "&Vlasnik:"
-
-#: src/widgets/kpropertiesdialog.cpp:1730
-msgid "Specifies the actions that the owner is allowed to do."
-msgstr "Opisuje posupke koji su dozvoljeni vlasniku."
-
-#: src/widgets/kpropertiesdialog.cpp:1732
-msgid "Gro&up:"
-msgstr "Gr&upa:"
-
-#: src/widgets/kpropertiesdialog.cpp:1738
-msgid "Specifies the actions that the members of the group are allowed to do."
-msgstr "Opisuje postupke koji su dozvoljeni članovima grupe."
-
-#: src/widgets/kpropertiesdialog.cpp:1740
-msgid "O&thers:"
-msgstr "Os&talo:"
-
-#: src/widgets/kpropertiesdialog.cpp:1746
-msgid ""
-"Specifies the actions that all users, who are neither owner nor in the "
-"group, are allowed to do."
-msgstr ""
-"Opisuje postupke koji su dozvoljeni svim korisnicima, koji nisu niti "
-"vlasnici niti članovi grupe. "
-
-#: src/widgets/kpropertiesdialog.cpp:1751
-msgid "Only own&er can rename and delete folder content"
-msgstr "Samo vlasnik mož&e promijeniti naziv i izbrisati sadržaj mape"
-
-#: src/widgets/kpropertiesdialog.cpp:1752
-msgid "Is &executable"
-msgstr "I&zvršno"
-
-#: src/widgets/kpropertiesdialog.cpp:1756
-msgid ""
-"Enable this option to allow only the folder's owner to delete or rename the "
-"contained files and folders. Other users can only add new files, which "
-"requires the 'Modify Content' permission."
-msgstr ""
-"Uključite ovu opciju da dozvolite samo vlasniku da briše ili mijenja naziv "
-"sadržanim datotekama i mapama. Ostali korisnici mogu samo dodati nove "
-"datoteke, što zahtijeva dozvolu 'mijenjanje sadržaja'."
-
-#: src/widgets/kpropertiesdialog.cpp:1760
-msgid ""
-"Enable this option to mark the file as executable. This only makes sense for "
-"programs and scripts. It is required when you want to execute them."
-msgstr ""
-"Omogućite ovu opciju da bi označili datoteku kao izvršni program. To ima "
-"smisla samo za programe i skripte, te je potrebno kada ih želite izvršavati."
-
-#: src/widgets/kpropertiesdialog.cpp:1767
-msgid "A&dvanced Permissions"
-msgstr "Napre&dne dozvole"
-
-#: src/widgets/kpropertiesdialog.cpp:1775
-msgid "Ownership"
-msgstr "Vlasništvo"
-
-#: src/widgets/kpropertiesdialog.cpp:1782
-msgid "User:"
-msgstr "Korisnik:"
-
-#: src/widgets/kpropertiesdialog.cpp:1859
-msgid "Group:"
-msgstr "Grupa:"
-
-#: src/widgets/kpropertiesdialog.cpp:1896
-msgid "Apply changes to all subfolders and their contents"
-msgstr "Primijeni promjene na sve poddirektorije i njihov sadržaj"
-
-#: src/widgets/kpropertiesdialog.cpp:1935
-msgid "Advanced Permissions"
-msgstr "Napredne dozvole"
-
-#: src/widgets/kpropertiesdialog.cpp:1952
-msgid "Class"
-msgstr "Razred"
-
-#: src/widgets/kpropertiesdialog.cpp:1957
-msgid ""
-"Show\n"
-"Entries"
-msgstr ""
-"Prikaz\n"
-"zapisa"
-
-#: src/widgets/kpropertiesdialog.cpp:1959
-msgid "Read"
-msgstr "Čitaj"
-
-#: src/widgets/kpropertiesdialog.cpp:1965
-msgid "This flag allows viewing the content of the folder."
-msgstr "Ova zastavica omogućava pregledavanje sadržaja direktorija."
-
-#: src/widgets/kpropertiesdialog.cpp:1967
-msgid "The Read flag allows viewing the content of the file."
-msgstr "Zastavica \"čitaj\" omogućuje pregled sadržaja datoteke."
-
-#: src/widgets/kpropertiesdialog.cpp:1972
-msgid ""
-"Write\n"
-"Entries"
-msgstr ""
-"Pisanje\n"
-"zapisa"
-
-#: src/widgets/kpropertiesdialog.cpp:1974
-msgid "Write"
-msgstr "Zapiši"
-
-#: src/widgets/kpropertiesdialog.cpp:1980
-msgid ""
-"This flag allows adding, renaming and deleting of files. Note that deleting "
-"and renaming can be limited using the Sticky flag."
-msgstr ""
-"Ova zastavica dopušta dodavanje, mijanjanje imena i brisanje datoteka."
-"Zapamtite da se brisanje i promjena imena može ograničiti korištenjem "
-"Ljepljivih zastavica."
-
-#: src/widgets/kpropertiesdialog.cpp:1983
-msgid "The Write flag allows modifying the content of the file."
-msgstr "Piši zastavica dozvoljava mijenjanje sadržaja datoteke. "
-
-#: src/widgets/kpropertiesdialog.cpp:1989
-msgctxt "Enter folder"
-msgid "Enter"
-msgstr "Ulazak"
-
-#: src/widgets/kpropertiesdialog.cpp:1990
-msgid "Enable this flag to allow entering the folder."
-msgstr "Podigni zastavicu za pristup mapi."
-
-#: src/widgets/kpropertiesdialog.cpp:1992
-msgid "Exec"
-msgstr "Izvrši"
-
-#: src/widgets/kpropertiesdialog.cpp:1993
-msgid "Enable this flag to allow executing the file as a program."
-msgstr "Omogući ovo da se dozvoli izvršavanje datoteke kao programa."
-
-#: src/widgets/kpropertiesdialog.cpp:2003
-msgid "Special"
-msgstr "Posebno"
-
-#: src/widgets/kpropertiesdialog.cpp:2007
-msgid ""
-"Special flag. Valid for the whole folder, the exact meaning of the flag can "
-"be seen in the right hand column."
-msgstr ""
-"Specijalna privilegija. Važi za cijeli direktorij, točno značenje "
-"privilegije možete vidjeti u desnom stupcu."
-
-#: src/widgets/kpropertiesdialog.cpp:2010
-msgid ""
-"Special flag. The exact meaning of the flag can be seen in the right hand "
-"column."
-msgstr ""
-"Specijalna opcija. Stvarno značenje opcije može se vidjeti u desnoj kolumni."
-
-#: src/widgets/kpropertiesdialog.cpp:2014
-msgid "User"
-msgstr "Korisnik"
-
-#: src/widgets/kpropertiesdialog.cpp:2018
-msgid "Group"
-msgstr "Grupa"
-
-#: src/widgets/kpropertiesdialog.cpp:2026
-msgid "Set UID"
-msgstr "Postavljanje UID-a"
-
-#: src/widgets/kpropertiesdialog.cpp:2030
-msgid ""
-"If this flag is set, the owner of this folder will be the owner of all new "
-"files."
-msgstr ""
-"Ako je ova zastavica postavljena, vlasnik ove mape biti će vlasnik svih "
-"novih datoteka."
-
-#: src/widgets/kpropertiesdialog.cpp:2033
-msgid ""
-"If this file is an executable and the flag is set, it will be executed with "
-"the permissions of the owner."
-msgstr ""
-"Ako je ova datoteka izvršna i postavljena je zastavica, bit će pokrenutasa "
-"privilegijama vlasnika."
-
-#: src/widgets/kpropertiesdialog.cpp:2037
-msgid "Set GID"
-msgstr "Postavljanje GID-a"
-
-#: src/widgets/kpropertiesdialog.cpp:2041
-msgid ""
-"If this flag is set, the group of this folder will be set for all new files."
-msgstr ""
-"Ako je ova zastavica postavljena, grupa ove mape biti će korištena za sve "
-"nove datoteke."
-
-#: src/widgets/kpropertiesdialog.cpp:2044
-msgid ""
-"If this file is an executable and the flag is set, it will be executed with "
-"the permissions of the group."
-msgstr ""
-"Ako je ova datoteka izvršna i zastavica je postavljena, bit ćepokrenuta sa "
-"dozvolama grupe."
-
-#: src/widgets/kpropertiesdialog.cpp:2048
-msgctxt "File permission"
-msgid "Sticky"
-msgstr "Ljepljivo"
-
-#: src/widgets/kpropertiesdialog.cpp:2052
-msgid ""
-"If the Sticky flag is set on a folder, only the owner and root can delete or "
-"rename files. Otherwise everybody with write permissions can do this."
-msgstr ""
-"Ako je ljepljiva zastavica dodijeljena mapi, samo vlasnik i root mogu "
-"brisati ili mijenjati nazive datoteka. U suprotnom to mogu svi sa ovlašću "
-"pisanja."
-
-#: src/widgets/kpropertiesdialog.cpp:2056
-msgid ""
-"The Sticky flag on a file is ignored on Linux, but may be used on some "
-"systems"
-msgstr ""
-"Sticky zastavica na datoteci je ignorirana na Linuxu, ali se moždakoristi na "
-"drugim sustavima "
-
-#: src/widgets/kpropertiesdialog.cpp:2244
-msgid "Link"
-msgstr "Link"
-
-#: src/widgets/kpropertiesdialog.cpp:2263
-msgid "Varying (No Change)"
-msgstr "Promijenjljiv (Bez promjene)"
-
-#: src/widgets/kpropertiesdialog.cpp:2376
-msgid "This file uses advanced permissions"
-msgid_plural "These files use advanced permissions."
-msgstr[0] "Ova datoteka koristi napredne dozvole."
-msgstr[1] "Ove datoteke koriste napredne dozvole."
-msgstr[2] "Ove datoteke koriste napredne dozvole."
-
-#: src/widgets/kpropertiesdialog.cpp:2397
-msgid "This folder uses advanced permissions."
-msgid_plural "These folders use advanced permissions."
-msgstr[0] "Ova mapa koristi napredne dozvole."
-msgstr[1] "Ove mape koriste napredne dozvole."
-msgstr[2] "Ove mape koriste napredne dozvole."
-
-#: src/widgets/kpropertiesdialog.cpp:2412
-msgid "These files use advanced permissions."
-msgstr "Ove datoteke koriste napredne privilegije."
-
-#: src/widgets/kpropertiesdialog.cpp:2647
-msgid "U&RL"
-msgstr "U&RL"
-
-#: src/widgets/kpropertiesdialog.cpp:2654
-msgid "URL:"
-msgstr "URL:"
-
-#: src/widgets/kpropertiesdialog.cpp:2794
-msgid "De&vice"
-msgstr "&Uređaj"
-
-#: src/widgets/kpropertiesdialog.cpp:2823
-msgid "Device (/dev/fd0):"
-msgstr "Uređaj (/dev/fd0):"
-
-#: src/widgets/kpropertiesdialog.cpp:2824
-msgid "Device:"
-msgstr "Uređaj:"
-
-#: src/widgets/kpropertiesdialog.cpp:2837
-msgid "Read only"
-msgstr "Samo za čitanje"
-
-#: src/widgets/kpropertiesdialog.cpp:2841
-msgid "File system:"
-msgstr "Datotečni sustav"
-
-#: src/widgets/kpropertiesdialog.cpp:2849
-msgid "Mount point (/mnt/floppy):"
-msgstr "Mjesto montiranja (/mnt/floppy):"
-
-#: src/widgets/kpropertiesdialog.cpp:2850
-msgid "Mount point:"
-msgstr "Točka montiranja:"
-
-#: src/widgets/kpropertiesdialog.cpp:3094
-msgid "&Application"
-msgstr "&Aplikacija"
-
-#: src/widgets/kpropertiesdialog.cpp:3220
-#, kde-format
-msgid "Add File Type for %1"
-msgstr "Dodaj tip datoteke za %1"
-
-#: src/widgets/kpropertiesdialog.cpp:3221
-msgid "Select one or more file types to add:"
-msgstr "Odaberite jedan ili više tipova datoteke koje želite dodati:"
-
-#: src/widgets/kpropertiesdialog.cpp:3282
-#, fuzzy
-#| msgid "Only executables on local file systems are supported."
-msgid ""
-"Could not save properties. Only entries on local file systems are supported."
-msgstr "Podržano je pokretanje samo lokalnih izvršnih datoteka."
-
-#: src/widgets/kpropertiesdialog.cpp:3361
-msgid "Only executables on local file systems are supported."
-msgstr "Podržano je pokretanje samo lokalnih izvršnih datoteka."
-
-#: src/widgets/kpropertiesdialog.cpp:3375
-#, kde-format
-msgid "Advanced Options for %1"
-msgstr "Napredne postavke za %1"
-
-#: src/widgets/krun.cpp:169
-#, kde-format
-msgid ""
-"Unable to enter %1 .\n"
-"You do not have access rights to this location. "
-msgstr ""
-"Ne mogu ući u %1 .\n"
-"Nemate dovoljne ovlasti za pristup ovoj lokaciji. "
-
-#: src/widgets/krun.cpp:198
-#, kde-format
-msgid ""
-"The file %1 is an executable program. For safety it will not be "
-"started. "
-msgstr ""
-"Datoteka %1 je izvršni program. Zbog sigurnosti neće biti "
-"pokrenut. "
-
-#: src/widgets/krun.cpp:204
-#, kde-format
-msgid "You do not have permission to run %1 . "
-msgstr "Nemate ovlasti za pokretnaje %1 . "
-
-#: src/widgets/krun.cpp:234
-msgid "You are not authorized to select an application to open this file."
-msgstr "Niste ovlašteni za odabir aplikacije koja će otvoriti ovu datoteku."
-
-#: src/widgets/krun.cpp:245
-msgid "Open with:"
-msgstr "Otvori pomoću:"
-
-#: src/widgets/krun.cpp:294
-msgid "You are not authorized to execute this file."
-msgstr "Niste ovlašteni za izvršavanje ove datoteke."
-
-#: src/widgets/krun.cpp:315
-#, kde-format
-msgid "Launching %1"
-msgstr "Pokretanje %1"
-
-#: src/widgets/krun.cpp:419
-#, kde-format
-msgid "Error processing Exec field in %1"
-msgstr "Greška prilikom obrađivanja izvršnog polja (Exec field ) u %1"
-
-#: src/widgets/krun.cpp:591
-msgid "You are not authorized to execute this service."
-msgstr "Niste ovlašteni za izvršavanje ove usluge."
-
-#: src/widgets/krun.cpp:596
-msgctxt "Warning about executing unknown .desktop file"
-msgid "Warning"
-msgstr "Upozorenje"
-
-#: src/widgets/krun.cpp:613
-msgctxt "program name follows in a line edit below"
-msgid "This will start the program:"
-msgstr "Ovo će pokrenuti program:"
-
-#: src/widgets/krun.cpp:630
-msgid "If you do not trust this program, click Cancel"
-msgstr "Ako ne vjerujete ovom programu, kliknite Prekinuti"
-
-#: src/widgets/krun.cpp:673
-#, kde-format
-msgid "Unable to make the service %1 executable, aborting execution"
-msgstr "Nije moguće učiniti uslugu %1 izvršnom, prekidanje izvođenja"
-
-#: src/widgets/krun.cpp:854
-#, kde-format
-msgid ""
-"Unable to run the command specified. The file or folder %1 does "
-"not exist. "
-msgstr ""
-"Ne mogu pokrenuti naredbu koju ste naveli. Datoteka/direktorij %1 "
-"ne postoji. "
-
-#: src/widgets/krun.cpp:1454
-#, kde-format
-msgid "Could not find the program '%1'"
-msgstr "Nije moguće naći program '%1'"
-
-#: src/widgets/ksslinfodialog.cpp:57
-msgid "KDE SSL Information"
-msgstr "KDE SSL Informacije"
-
-#: src/widgets/ksslinfodialog.cpp:69
-msgctxt "The receiver of the SSL certificate"
-msgid "Subject"
-msgstr "Predmet"
-
-#: src/widgets/ksslinfodialog.cpp:70
-msgctxt "The authority that issued the SSL certificate"
-msgid "Issuer"
-msgstr "Izdavatelj:"
-
-#: src/widgets/ksslinfodialog.cpp:86 src/widgets/ksslinfodialog.cpp:126
-msgid "Current connection is secured with SSL."
-msgstr "Trenutna veza osigurana je uz pomoć SSLa."
-
-#: src/widgets/ksslinfodialog.cpp:89 src/widgets/ksslinfodialog.cpp:139
-msgid "Current connection is not secured with SSL."
-msgstr "Trenutna veza nije osigurana SSLom."
-
-#: src/widgets/ksslinfodialog.cpp:93
-msgid "SSL support is not available in this build of KDE."
-msgstr "SSL podrška nije dostupna u ovom KDE-u."
-
-#: src/widgets/ksslinfodialog.cpp:129
-msgid ""
-"The main part of this document is secured with SSL, but some parts are not."
-msgstr "Glavni dio ovog dokumenta je osiguran SSL-om, no neki dijelovi nisu."
-
-#: src/widgets/ksslinfodialog.cpp:135
-msgid "Some of this document is secured with SSL, but the main part is not."
-msgstr "Neki dijelovi ovog dokumenta osigurani su SSL-om, no glavnina nije."
-
-#: src/widgets/ksslinfodialog.cpp:186
-#, kde-format
-msgctxt "%1, using %2 bits of a %3 bit key"
-msgid "%1, %2 %3"
-msgstr "%1, %2 %3"
-
-#: src/widgets/ksslinfodialog.cpp:188
-#, kde-format
-msgctxt "Part of: %1, using %2 bits of a %3 bit key"
-msgid "using %1 bit"
-msgid_plural "using %1 bits"
-msgstr[0] "koristi %1 bit"
-msgstr[1] "koristi %1 bita"
-msgstr[2] "koristi %1 bitova"
-
-#: src/widgets/ksslinfodialog.cpp:190
-#, kde-format
-msgctxt "Part of: %1, using %2 bits of a %3 bit key"
-msgid "of a %1 bit key"
-msgid_plural "of a %1 bit key"
-msgstr[0] "ključa koji je %1-bitan"
-msgstr[1] "ključa koji je %1-bitan"
-msgstr[2] "ključa koji je %1-bitan"
-
-#: src/widgets/ksslinfodialog.cpp:206
-msgctxt "The certificate is not trusted"
-msgid "NO, there were errors:"
-msgstr "NE, dogodile su se greške:"
-
-#: src/widgets/ksslinfodialog.cpp:213
-msgctxt "The certificate is trusted"
-msgid "Yes"
-msgstr "Da"
-
-#: src/widgets/ksslinfodialog.cpp:217
-#, kde-format
-msgctxt "%1 is the effective date of the certificate, %2 is the expiry date"
-msgid "%1 to %2"
-msgstr "%1 do %2"
-
-#: src/widgets/kurlrequester.cpp:284
-msgid "Open file dialog"
-msgstr "Dijalog za otvoranje datoteke"
-
-#: src/widgets/paste.cpp:87 src/widgets/paste.cpp:156
-msgid "Filename for clipboard content:"
-msgstr "Naziv datoteke za sadržaj odlagališta:"
-
-#: src/widgets/paste.cpp:148
-#, kde-format
-msgid "%1 (%2)"
-msgstr "%1 (%2)"
-
-#: src/widgets/paste.cpp:167
-msgid ""
-"The clipboard has changed since you used 'paste': the chosen data format is "
-"no longer applicable. Please copy again what you wanted to paste."
-msgstr ""
-"Odlagalište se promijenilo od kad ste koristili 'zalijepi': odabrani oblik "
-"podataka više nije prihvatljiv. Molim da kopirate ponovno ono što želite "
-"zalijepiti."
-
-#: src/widgets/paste.cpp:295
-#, kde-format
-msgid "&Paste File"
-msgid_plural "&Paste %1 Files"
-msgstr[0] "Zalije&pi %1 datoteku"
-msgstr[1] "Zalije&pi %1 datoteke"
-msgstr[2] "Zalije&pi %1 datoteka"
-
-#: src/widgets/paste.cpp:297
-#, kde-format
-msgid "&Paste URL"
-msgid_plural "&Paste %1 URLs"
-msgstr[0] "&Zalijepi %1 URL"
-msgstr[1] "&Zalijepi %1 URL-a"
-msgstr[2] "&Zalijepi %1 URL-ova"
-
-#: src/widgets/paste.cpp:300
-msgid "&Paste Clipboard Contents"
-msgstr "&Zalijepi sadržaje odlagališta"
-
-#: src/widgets/pastedialog.cpp:57
-msgid "Data format:"
-msgstr "Format datuma:"
-
-#: src/widgets/renamedialog.cpp:134
-msgid "Appl&y to All"
-msgstr "Primijeni na &sve"
-
-#: src/widgets/renamedialog.cpp:135
-#, fuzzy
-#| msgid ""
-#| "Files and folders will be copied into the existing directory, alongside "
-#| "its existing contents.\n"
-#| "You will be prompted again in case of a conflict with an existing file in "
-#| "the directory."
-msgid ""
-"When this is checked the button pressed will be applied to all subsequent "
-"folder conflicts for the remainder of the current job.\n"
-"Unless you press Skip you will still be prompted in case of a conflict with "
-"an existing file in the directory."
-msgstr ""
-"Datoteke i mape bit će kopirane u bilo koji postojeći direktorij zajedno s "
-"postojećim sadržajem.\n"
-"Sustav će vas opet tražiti potvrdu ukoliko dođe do sukoba s postojećom "
-"datotekom u direktoriju."
-
-#: src/widgets/renamedialog.cpp:136
-msgid ""
-"When this is checked the button pressed will be applied to all subsequent "
-"conflicts for the remainder of the current job."
-msgstr ""
-
-#: src/widgets/renamedialog.cpp:141
-msgid "&Rename"
-msgstr "P&romijeni ime"
-
-#: src/widgets/renamedialog.cpp:143
-msgid "Suggest New &Name"
-msgstr "Predloži novi &naziv"
-
-#: src/widgets/renamedialog.cpp:149
-msgid "&Skip"
-msgstr "Pre&skoči"
-
-#: src/widgets/renamedialog.cpp:150
-msgid "Do not copy or move this folder, skip to the next item instead"
-msgstr ""
-"Ne kopiraj niti ne premještaj ovu mapu, umjesto toga preskoći na sljedeću "
-"stavku."
-
-#: src/widgets/renamedialog.cpp:151
-msgid "Do not copy or move this file, skip to the next item instead"
-msgstr ""
-"Ne kopiraj niti ne premještaj ovu datoteku, umjesto toga preskoći na "
-"sljedeću stavku."
-
-#: src/widgets/renamedialog.cpp:156
-msgctxt "Write files into an existing folder"
-msgid "&Write Into"
-msgstr "&Upiši u"
-
-#: src/widgets/renamedialog.cpp:156
-msgid "&Overwrite"
-msgstr "Pr&epiši"
-
-#: src/widgets/renamedialog.cpp:158
-msgid ""
-"Files and folders will be copied into the existing directory, alongside its "
-"existing contents.\n"
-"You will be prompted again in case of a conflict with an existing file in "
-"the directory."
-msgstr ""
-"Datoteke i mape bit će kopirane u bilo koji postojeći direktorij zajedno s "
-"postojećim sadržajem.\n"
-"Sustav će vas opet tražiti potvrdu ukoliko dođe do sukoba s postojećom "
-"datotekom u direktoriju."
-
-#: src/widgets/renamedialog.cpp:163
-msgid "&Resume"
-msgstr "&Nastavi"
-
-#: src/widgets/renamedialog.cpp:172
-#, kde-format
-msgid ""
-"This action would overwrite '%1' with itself.\n"
-"Please enter a new file name:"
-msgstr ""
-"Ovaj postupak će prepisati '%1' samim sobom.\n"
-"Molim Vas, unesite novi naziv datoteke:"
-
-#: src/widgets/renamedialog.cpp:176
-msgid "C&ontinue"
-msgstr "&Nastavi"
-
-#: src/widgets/renamedialog.cpp:230
-msgid "This action will overwrite the destination."
-msgstr "Ova radnja će pisati preko odredišta."
-
-#: src/widgets/renamedialog.cpp:232
-msgid "Source"
-msgstr "Izvor"
-
-#: src/widgets/renamedialog.cpp:233
-msgid "Destination"
-msgstr "Odredište"
-
-#: src/widgets/renamedialog.cpp:239
-msgid "Warning, the destination is more recent."
-msgstr "Oprez, odredište je novije."
-
-#: src/widgets/renamedialog.cpp:270
-#, kde-format
-msgid "An older item named '%1' already exists."
-msgstr "Već postoji starija stavka nazvana '%1'."
-
-#: src/widgets/renamedialog.cpp:272
-#, kde-format
-msgid "A similar file named '%1' already exists."
-msgstr "Slična datoteka naziva %1 već postoji."
-
-#: src/widgets/renamedialog.cpp:274
-#, kde-format
-msgid "A more recent item named '%1' already exists."
-msgstr "Već postoji novija stavka naziva '%1'."
-
-#: src/widgets/renamedialog.cpp:286
-msgid "Rename:"
-msgstr "Preimenuj:"
-
-#: src/widgets/skipdialog.cpp:38
-msgid "Information"
-msgstr "Informacije"
-
-#: src/widgets/skipdialog.cpp:48
-msgid "Retry"
-msgstr "Pokušaj ponovno"
-
-#: src/widgets/skipdialog.cpp:53
-msgid "Skip"
-msgstr "Preskoči"
-
-#: src/widgets/skipdialog.cpp:57
-msgid "AutoSkip"
-msgstr "Preskoči sam"
-
-#. i18n: ectx: property (text), widget (QLabel, encryptionIndicator)
-#: src/widgets/sslinfo.ui:17
-msgid "[padlock]"
-msgstr "[padlock]"
-
-#. i18n: ectx: property (text), widget (QLabel, addressTag)
-#: src/widgets/sslinfo.ui:34
-msgctxt "Web page address"
-msgid "Address:"
-msgstr "Adresa:"
-
-#. i18n: ectx: property (text), widget (QLabel, ipTag)
-#: src/widgets/sslinfo.ui:54
-msgid "IP address:"
-msgstr "IP adresa:"
-
-#. i18n: ectx: property (text), widget (QLabel, encryptionTag)
-#: src/widgets/sslinfo.ui:74
-msgid "Encryption:"
-msgstr "Šifriranje:"
-
-#. i18n: ectx: property (text), widget (QLabel, detailsTag)
-#: src/widgets/sslinfo.ui:94
-msgid "Details:"
-msgstr "Detalji:"
-
-#. i18n: ectx: property (text), widget (QLabel, sslVersionTag)
-#: src/widgets/sslinfo.ui:114
-msgid "SSL version:"
-msgstr "SSL inačica:"
-
-#. i18n: ectx: property (text), widget (QLabel, certSelectorTag)
-#: src/widgets/sslinfo.ui:134
-msgid "Certificate chain:"
-msgstr "Lanac certifikata:"
-
-#. i18n: ectx: property (text), widget (QLabel, trustedTag)
-#: src/widgets/sslinfo.ui:163
-msgid "Trusted:"
-msgstr "Pouzdano:"
-
-#. i18n: ectx: property (text), widget (QLabel, validityPeriodTag)
-#: src/widgets/sslinfo.ui:183
-msgid "Validity period:"
-msgstr "Period :"
-
-#. i18n: ectx: property (text), widget (QLabel, serialTag)
-#: src/widgets/sslinfo.ui:203
-msgid "Serial number:"
-msgstr "Serijski broj:"
-
-#. i18n: ectx: property (text), widget (QLabel, digestTag)
-#: src/widgets/sslinfo.ui:223
-msgid "MD5 digest:"
-msgstr "MD5 sažetak:"
-
-#. i18n: ectx: property (text), widget (QLabel, sha1DigestTag)
-#: src/widgets/sslinfo.ui:243
-msgid "SHA1 digest:"
-msgstr "SHA1 sažetak:"
-
-#: src/widgets/sslui.cpp:49
-msgid ""
-"The remote host did not send any SSL certificates.\n"
-"Aborting because the identity of the host cannot be established."
-msgstr ""
-"Udaljeni poslužitelj nije poslao ni jedan SSL certifikat.\n"
-"Odustajem jer identitet poslužitelja ne može biti utvrđen."
-
-#~ msgid "--- separator ---"
-#~ msgstr "--- razmak ---"
-
-#~ msgctxt "@action:button"
-#~ msgid "Update"
-#~ msgstr "Ažuriraj"
-
-#~ msgctxt "@title:window"
-#~ msgid "Bookmark Properties"
-#~ msgstr "Svojstva oznaka"
-
-#~ msgctxt "@action:button"
-#~ msgid "Add"
-#~ msgstr "Dodaj"
-
-#~ msgctxt "@title:window"
-#~ msgid "Add Bookmark"
-#~ msgstr "Dodaj oznaku"
-
-#~ msgctxt "@action:button"
-#~ msgid "&New Folder..."
-#~ msgstr "&Nova mapa…"
-
-#~ msgctxt "@title:window"
-#~ msgid "Add Bookmarks"
-#~ msgstr "Dodaj oznake"
-
-#~ msgctxt "@title:window"
-#~ msgid "Select Folder"
-#~ msgstr "Odaberi mapu"
-
-#~ msgctxt "@label:textbox"
-#~ msgid "Name:"
-#~ msgstr "Naziv:"
-
-#~ msgctxt "@label:textbox"
-#~ msgid "Location:"
-#~ msgstr "Lokacija:"
-
-#~ msgctxt "@label:textbox"
-#~ msgid "Comment:"
-#~ msgstr "Komentar:"
-
-#~ msgctxt "@title:window"
-#~ msgid "Create New Bookmark Folder"
-#~ msgstr "Stvori novu mapu oznaka"
-
-#~ msgctxt "@title:window"
-#~ msgid "Create New Bookmark Folder in %1"
-#~ msgstr "Napravi novu mapu za oznake u %1"
-
-#~ msgctxt "@label:textbox"
-#~ msgid "New folder:"
-#~ msgstr "Nova mapa:"
-
-#~ msgctxt "name of the container of all browser bookmarks"
-#~ msgid "Bookmarks"
-#~ msgstr "Oznake"
-
-#~ msgid "*.html|HTML Files (*.html)"
-#~ msgstr "*.html|HTML datoteke (*.html)"
-
-#~ msgid ""
-#~ msgstr ""
-
-#~ msgid "*.adr|Opera Bookmark Files (*.adr)"
-#~ msgstr "*.adr|Opera bilješka (*.adr)"
-
-#~ msgid "Add Bookmark Here"
-#~ msgstr "Dodaj oznaku ovdje"
-
-#~ msgid "Open Folder in Bookmark Editor"
-#~ msgstr "Otvori mapu u uređivaču knjiških oznaka"
-
-#~ msgid "Delete Folder"
-#~ msgstr "Izbriši direktorij"
-
-#~ msgid "Copy Link Address"
-#~ msgstr "Kopiraj adresu poveznice"
-
-#~ msgid "Delete Bookmark"
-#~ msgstr "Izbriši knjišku oznaku"
-
-#~ msgid "Open Folder in Tabs"
-#~ msgstr "Otvori mape u karticama"
-
-#~ msgid "Cannot add bookmark with empty URL."
-#~ msgstr "Nije moguće dodati oznaku s praznom URL adresom."
-
-#~ msgid ""
-#~ "Are you sure you wish to remove the bookmark folder\n"
-#~ "\"%1\"?"
-#~ msgstr ""
-#~ "Jeste li sigurni da želite ukloniti mapu oznaka\n"
-#~ "\"%1\"?"
-
-#~ msgid ""
-#~ "Are you sure you wish to remove the bookmark\n"
-#~ "\"%1\"?"
-#~ msgstr ""
-#~ "Jeste li sigurni da želite ukloniti oznaku\n"
-#~ "\"%1\"?"
-
-#~ msgid "Bookmark Folder Deletion"
-#~ msgstr "Brisanje direktorija s oznakama"
-
-#~ msgid "Bookmark Deletion"
-#~ msgstr "Brisanje oznaka"
-
-#~ msgid "Open all bookmarks in this folder as a new tab."
-#~ msgstr "Otvori sve oznake u ovom direktoriju kao novu karticu."
-
-#~ msgid "Bookmark Tabs as Folder..."
-#~ msgstr "Tabovi bilješki kao mape"
-
-#~ msgid "Add a folder of bookmarks for all open tabs."
-#~ msgstr "Dodaj mapu oznaka za sve otvorene kartice"
-
-#~ msgid "Edit your bookmark collection in a separate window"
-#~ msgstr "Uređivanje zbirke oznaka u zasebnom prozoru"
-
-#~ msgid "New Bookmark Folder..."
-#~ msgstr "Nova mapa s oznakama…"
-
-#~ msgid "Create a new bookmark folder in this menu"
-#~ msgstr "Napravi novi direktorij za ovog izbornika"
-
-#~ msgid "Hide in toolbar"
-#~ msgstr "Sakrij alatnu traku"
-
-#~ msgid "Show in toolbar"
-#~ msgstr "Prikaži u alatnoj traci"
-
-#~ msgid "Open in New Window"
-#~ msgstr "Otvori u novom prozoru"
-
-#~ msgid "Open in New Tab"
-#~ msgstr "Otvori u novoj kartici"
-
-#~ msgid ""
-#~ "Unable to save bookmarks in %1. Reported error was: %2. This error "
-#~ "message will only be shown once. The cause of the error needs to be fixed "
-#~ "as quickly as possible, which is most likely a full hard drive."
-#~ msgstr ""
-#~ "Nije bilo moguće snimiti markere u %1. Prijavljena pogreška je: %2. Ova "
-#~ "poruka o grešci biće prikazana samo jednom. Molim, otklonite mogući uzrok "
-#~ "pogreške, što je prije moguće. Najverojatniji uzrok je pun disk."
-
-#~ msgid "Receiving corrupt data."
-#~ msgstr "Primam pokvarene podatke."
-
-#~ msgid "Device name"
-#~ msgstr "Naziv uređaja"
-
-#~ msgid "&Share"
-#~ msgstr "&Dijeljeno"
-
-#~ msgid "Only folders in your home folder can be shared."
-#~ msgstr "Možete dijeliti samo mape u vašoj osobnoj mapi."
-
-#~ msgid "Not shared"
-#~ msgstr "Nije dijeljeno"
-
-#~ msgid "Shared"
-#~ msgstr "Dijeljeno"
-
-#~ msgid ""
-#~ "Sharing this folder makes it available under Linux/UNIX (NFS) and Windows "
-#~ "(Samba)."
-#~ msgstr ""
-#~ "Dijeljenjem je ova mapa dostupna na sustavima pod Linuxom/UNIX-om (NFS) i "
-#~ "Windowsima (Samba)."
-
-#~ msgid "You can also reconfigure file sharing authorization."
-#~ msgstr "Možete podesiti autorizaciju dijeljenja."
-
-#~ msgid "Configure File Sharing..."
-#~ msgstr "Podešavanje dijeljenja datoteka…"
-
-#~ msgid ""
-#~ "Error running 'filesharelist'. Check if installed and in $PATH or /usr/"
-#~ "sbin."
-#~ msgstr ""
-#~ "Greška kod pokretanja 'filesharelist'. Provjerite je postavljen u $PATH "
-#~ "ili /usr/bin."
-
-#~ msgid "You need to be authorized to share folders."
-#~ msgstr "Morate biti autorizirani da bi dijelili mape."
-
-#~ msgid "File sharing is disabled."
-#~ msgstr "Dijeljenje direktorija je onemogućeno."
-
-#~ msgid "Sharing folder '%1' failed."
-#~ msgstr "Dijeljenje direktorija '%1' nije uspjelo."
-
-#~ msgid ""
-#~ "An error occurred while trying to share folder '%1'. Make sure that the "
-#~ "Perl script 'fileshareset' is set suid root."
-#~ msgstr ""
-#~ "Došlo je do greške prilikom postavljanja dijeljenja direktorija '%1'. "
-#~ "Osigurajte da Perl skripta 'fileshareset' ima postavljeni 'suid' na "
-#~ "'root'."
-
-#~ msgid "Unsharing folder '%1' failed."
-#~ msgstr "Micanje dijeljenja direktorija '%1' nije uspjelo."
-
-#~ msgid ""
-#~ "An error occurred while trying to unshare folder '%1'. Make sure that the "
-#~ "Perl script 'fileshareset' is set suid root."
-#~ msgstr ""
-#~ "Došlo je do greške prilikom pokušaja micanja dijeljenja direktorija '%1'. "
-#~ "Osigurajte da Perl skripta 'fileshareset' ima postavljeni 'suid' na "
-#~ "'root'."
-
-#~ msgid ""
-#~ msgstr ""
-
-#~ msgctxt "@title:window"
-#~ msgid "Configure Shown Data"
-#~ msgstr "Podešavanje prikazanih podataka"
-
-#~ msgctxt "@label::textbox"
-#~ msgid "Select which data should be shown:"
-#~ msgstr "Odaberite podatke koji trebaju biti prikazani:"
-
-#~ msgctxt "@action:button"
-#~ msgid "Configure..."
-#~ msgstr "Podešavanje…"
-
-#~ msgctxt "@title:tab"
-#~ msgid "Information"
-#~ msgstr "Informacije"
-
-#~ msgctxt "@label"
-#~ msgid "Comment"
-#~ msgstr "Komentar"
-
-#~ msgctxt "@label creation date"
-#~ msgid "Created"
-#~ msgstr "Izrađeno"
-
-#~ msgctxt "@label file content size"
-#~ msgid "Size"
-#~ msgstr "Veličina"
-
-#~ msgctxt "@label file depends from"
-#~ msgid "Depends"
-#~ msgstr "Ovisi o"
-
-#~ msgctxt "@label Software used to generate content"
-#~ msgid "Generator"
-#~ msgstr "Generator"
-
-#~ msgctxt ""
-#~ "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/"
-#~ "nie#hasLogicalPart"
-#~ msgid "Has Logical Part"
-#~ msgstr "Ima logički dio"
-
-#~ msgctxt "@label parent directory"
-#~ msgid "Part of"
-#~ msgstr "Je dio"
-
-#~ msgctxt "@label"
-#~ msgid "Keyword"
-#~ msgstr "Ključna riječ"
-
-#~ msgctxt "@label modified date of file"
-#~ msgid "Modified"
-#~ msgstr "Mijenjano"
-
-#~ msgctxt "@label"
-#~ msgid "MIME Type"
-#~ msgstr "Mime tip"
-
-#~ msgctxt "@label"
-#~ msgid "Content"
-#~ msgstr "Sadržaj"
-
-#~ msgctxt "@label"
-#~ msgid "Subject"
-#~ msgstr "Predmet"
-
-#~ msgctxt "@label music title"
-#~ msgid "Title"
-#~ msgstr "Naslov"
-
-#~ msgctxt "@label file URL"
-#~ msgid "Location"
-#~ msgstr "Lokacija"
-
-#~ msgctxt "@label"
-#~ msgid "Creator"
-#~ msgstr "Stvaralac"
-
-#~ msgctxt "@label"
-#~ msgid "Average Bitrate"
-#~ msgstr "Prosječni protok bitova"
-
-#~ msgctxt "@label"
-#~ msgid "Channels"
-#~ msgstr "Kanali"
-
-#~ msgctxt "@label number of characters"
-#~ msgid "Characters"
-#~ msgstr "Znakova"
-
-#~ msgctxt "@label"
-#~ msgid "Codec"
-#~ msgstr "Kodek"
-
-#~ msgctxt "@label"
-#~ msgid "Color Depth"
-#~ msgstr "Dubina boja"
-
-#~ msgctxt "@label"
-#~ msgid "Duration"
-#~ msgstr "Trajanje"
-
-#~ msgctxt "@label"
-#~ msgid "Filename"
-#~ msgstr "Naziv datoteke"
-
-#~ msgctxt "@label"
-#~ msgid "Height"
-#~ msgstr "Visina"
-
-#~ msgctxt "@label"
-#~ msgid "Interlace Mode"
-#~ msgstr "Način ispreplitanja"
-
-#~ msgctxt "@label number of lines"
-#~ msgid "Lines"
-#~ msgstr "Redaka"
-
-#~ msgctxt "@label"
-#~ msgid "Programming Language"
-#~ msgstr "Programski jezik"
-
-#~ msgctxt "@label"
-#~ msgid "Width"
-#~ msgstr "Širina"
-
-#~ msgctxt "@label number of words"
-#~ msgid "Words"
-#~ msgstr "Riječi"
-
-#~ msgctxt "@label EXIF aperture value"
-#~ msgid "Aperture"
-#~ msgstr "Otvor leće"
-
-#~ msgctxt "@label EXIF"
-#~ msgid "Exposure Bias Value"
-#~ msgstr "Odstupanje ekspozicije"
-
-#~ msgctxt "@label EXIF"
-#~ msgid "Exposure Time"
-#~ msgstr "Vrijeme ekspozicije"
-
-#~ msgctxt "@label EXIF"
-#~ msgid "Flash"
-#~ msgstr "Bljeskalica"
-
-#~ msgctxt "@label EXIF"
-#~ msgid "Focal Length"
-#~ msgstr "Fokalna duljina"
-
-#~ msgctxt "@label EXIF"
-#~ msgid "Focal Length 35 mm"
-#~ msgstr "Fokalna duljina od 35 mm"
-
-#~ msgctxt "@label EXIF"
-#~ msgid "ISO Speed Ratings"
-#~ msgstr "Vrijednosti ISO brzine"
-
-#~ msgctxt "@label EXIF"
-#~ msgid "Make"
-#~ msgstr "Proizvođač"
-
-#~ msgctxt "@label EXIF"
-#~ msgid "Metering Mode"
-#~ msgstr "Način mjerenja"
-
-#~ msgctxt "@label EXIF"
-#~ msgid "Model"
-#~ msgstr "Model"
-
-#~ msgctxt "@label EXIF"
-#~ msgid "Orientation"
-#~ msgstr "Orijentacija"
-
-#~ msgctxt "@label EXIF"
-#~ msgid "White Balance"
-#~ msgstr "Ravnoteža bjeline"
-
-#~ msgctxt "@label music genre"
-#~ msgid "Genre"
-#~ msgstr "Žanr"
-
-#~ msgctxt "@label music album"
-#~ msgid "Album"
-#~ msgstr "Album"
-
-#~ msgctxt "@label"
-#~ msgid "Performer"
-#~ msgstr "Izvođač"
-
-#~ msgctxt "@label music track number"
-#~ msgid "Track"
-#~ msgstr "Zapis"
-
-#~ msgctxt "@label file type"
-#~ msgid "Type"
-#~ msgstr "Tip"
-
-#~ msgctxt "@label Number of fuzzy translations"
-#~ msgid "Fuzzy Translations"
-#~ msgstr "Neprovjereni prijevodi"
-
-#~ msgctxt "@label Name of last translator"
-#~ msgid "Last Translator"
-#~ msgstr "Posljednji prevoditelj"
-
-#~ msgctxt "@label Number of obsolete translations"
-#~ msgid "Obsolete Translations"
-#~ msgstr "Zastarjeli prijevodi"
-
-#~ msgctxt "@label"
-#~ msgid "Translation Source Date"
-#~ msgstr "Datum izvora prijevoda"
-
-#~ msgctxt "@label Number of total translations"
-#~ msgid "Total Translations"
-#~ msgstr "Ukupno prijevoda"
-
-#~ msgctxt "@label Number of translated strings"
-#~ msgid "Translated"
-#~ msgstr "Prevedeno"
-
-#~ msgctxt "@label"
-#~ msgid "Translation Date"
-#~ msgstr "Datum prijevoda"
-
-#~ msgctxt "@label Number of untranslated strings"
-#~ msgid "Untranslated"
-#~ msgstr "Neprevedeno"
-
-#~ msgid "P&review"
-#~ msgstr "P®led"
-
-#~ msgid "*|All files"
-#~ msgstr "*|Sve datoteke"
-
-#~ msgid "Select Icon"
-#~ msgstr "Odaberi ikonu"
-
-#~ msgid "Icon Source"
-#~ msgstr "Izvor ikone"
-
-#~ msgid "S&ystem icons:"
-#~ msgstr "Ikone susta&va:"
-
-#~ msgid "O&ther icons:"
-#~ msgstr "D&ruge ikone:"
-
-#~ msgid "&Search:"
-#~ msgstr "&Traži:"
-
-#~ msgid "Search interactively for icon names (e.g. folder)."
-#~ msgstr "Interaktivno traženje naziva ikona (npr. direktorija)."
-
-#~ msgid "Actions"
-#~ msgstr "Akcije"
-
-#~ msgid "Animations"
-#~ msgstr "Animacije"
-
-#~ msgid "Applications"
-#~ msgstr "Aplikacije"
-
-#~ msgid "Categories"
-#~ msgstr "Kategorije"
-
-#~ msgid "Devices"
-#~ msgstr "Uređaji"
-
-#~ msgid "Emblems"
-#~ msgstr "Ikonica"
-
-#~ msgid "Emotes"
-#~ msgstr "Smajlići"
-
-#~ msgid "Filesystems"
-#~ msgstr "Datotečni sustavi"
-
-#~ msgid "International"
-#~ msgstr "Međunarodni"
-
-#~ msgid "Mimetypes"
-#~ msgstr "Mimetipovi"
-
-#~ msgid "Places"
-#~ msgstr "Mjesta"
-
-#~ msgid "Status"
-#~ msgstr "Stanje"
-
-#~ msgid "*.png *.xpm *.svg *.svgz|Icon Files (*.png *.xpm *.svg *.svgz)"
-#~ msgstr ""
-#~ "*.png *.xpm *.svg *.svgz|Ikonske datoteke (*.png *.xpm *.svg *.svgz)"
-
-#~ msgctxt "@label"
-#~ msgid "Modified"
-#~ msgstr "Mijenjano"
-
-#~ msgctxt "@label"
-#~ msgid "Owner"
-#~ msgstr "Vlasnik"
-
-#~ msgctxt "@label"
-#~ msgid "Rating"
-#~ msgstr "Ocjena"
-
-#~ msgctxt "@label"
-#~ msgid "Size"
-#~ msgstr "Veličina"
-
-#~ msgctxt "@label"
-#~ msgid "Tags"
-#~ msgstr "Oznake"
-
-#~ msgctxt "@label"
-#~ msgid "Total Size"
-#~ msgstr "Ukupna veličina"
-
-#~ msgctxt "@label"
-#~ msgid "Type"
-#~ msgstr "Tip"
-
-#~ msgid "KFileMetaDataReader"
-#~ msgstr "KFileMetaDataReader"
-
-#~ msgid "KFileMetaDataReader can be used to read metadata from a file"
-#~ msgstr ""
-#~ "KFileMetaDataReader se može koristiti za čitanje meta podataka iz datoteke"
-
-#~ msgid "(C) 2011, Peter Penz"
-#~ msgstr "© 2011. Peter Penz"
-
-#~ msgid "Peter Penz"
-#~ msgstr "Peter Penz"
-
-#~ msgid "Current maintainer"
-#~ msgstr "Trenutni održavatelj"
-
-#~ msgid "Only the meta data that is part of the file is read"
-#~ msgstr "Čitaju se samo meta podaci koji su dio datoteke"
-
-#~ msgid "List of URLs where the meta-data should be read from"
-#~ msgstr "Lista URL-ova s kojih treba učitati meta-podatke"
-
-#~ msgctxt "@label"
-#~ msgid "Add Comment..."
-#~ msgstr "Dodaj komentar…"
-
-#~ msgctxt "@label"
-#~ msgid "Change..."
-#~ msgstr "Promijeni…"
-
-#~ msgctxt "@title:window"
-#~ msgid "Change Comment"
-#~ msgstr "Promijeni komentar"
-
-#~ msgctxt "@title:window"
-#~ msgid "Add Comment"
-#~ msgstr "Dodaj komentar"
-
-#~ msgid "&Skip File"
-#~ msgstr "&Preskoči datoteku"
-
-#~ msgid "No service implementing %1"
-#~ msgstr "Ni jedan servis ne implementira %1"
-
-#~ msgid "Default"
-#~ msgstr "Zadano"
-
-#~ msgid "Link to %1 (%2)"
-#~ msgstr "Link na %1 (%2)"
-
-#~ msgid "Owner:"
-#~ msgstr "Vlasnik:"
-
-#~ msgid "Permissions:"
-#~ msgstr "Ovlasti:"
-
-#~ msgid "All Pictures"
-#~ msgstr "Sve slike"
-
-#~ msgid "Mime Type"
-#~ msgstr "Mime tip"
-
-#~ msgid "Comment"
-#~ msgstr "Komentar"
-
-#~ msgid "Patterns"
-#~ msgstr "Uzorci"
-
-#~ msgid "&Edit..."
-#~ msgstr "&Uređivanje…"
-
-#~ msgid "Click this button to display the familiar KDE mime type editor."
-#~ msgstr ""
-#~ "Kliknite na ovaj gumb da bi prikazali poznati KDE-ov uređivač MIME tipova."
-
-#~ msgid "Acquire Image"
-#~ msgstr "Dohvati sliku"
-
-#~ msgid "OCR Image"
-#~ msgstr "Prepoznaj slova (OCR) na slici"
-
-#~ msgid "The clipboard is empty"
-#~ msgstr "Odlagalište je prazno"
-
-#~ msgid "File '%1' is not readable"
-#~ msgstr "Datoteka '%1' nije čitljiva"
-
-#~ msgid "ERROR: Unknown protocol '%1'"
-#~ msgstr "Grešla: Nepoznati protokol '%1'"
-
-#~ msgid "Authorization Dialog"
-#~ msgstr "Dijalog autorizacije"
-
-#~ msgid "SSL Configuration Module"
-#~ msgstr "SSL konfiguracijski modul"
-
-#~ msgid "Copyright 2010 Andreas Hartmetz"
-#~ msgstr "Copyright 2010. Andreas Hartmetz"
-
-#~ msgid "Andreas Hartmetz"
-#~ msgstr "Andreas Hartmetz"
-
-#~ msgid "SSL Signers"
-#~ msgstr "SSL-potpisnici"
-
-#~ msgid "System certificates"
-#~ msgstr "Certifikati sustava"
-
-#~ msgid "User-added certificates"
-#~ msgstr "Certifikati koje je dodao korisnik"
-
-#~ msgid "Pick Certificates"
-#~ msgstr "Odaberite certifikate"
-
-#~ msgid "Signature Algorithm: "
-#~ msgstr "Algoritam potpisa: "
-
-#~ msgid "Unknown"
-#~ msgstr "Nepoznat"
-
-#~ msgid "Signature Contents:"
-#~ msgstr "Sadržaj potpisa: "
-
-#~ msgctxt "Unknown"
-#~ msgid "Unknown key algorithm"
-#~ msgstr "Nepoznat algoritam ključa"
-
-#~ msgid "Key type: RSA (%1 bit)"
-#~ msgstr "Vrsta ključa: RSA (%1 bita)"
-
-#~ msgid "Modulus: "
-#~ msgstr "Modul: "
-
-#~ msgid "Exponent: 0x"
-#~ msgstr "Eksponent: 0x"
-
-#~ msgid "Key type: DSA (%1 bit)"
-#~ msgstr "Vrsta ključa: DSA(%1 bitova)"
-
-#~ msgid "Prime: "
-#~ msgstr "Prosti:"
-
-#~ msgid "160 bit prime factor: "
-#~ msgstr "160 bitni prosti množitelj: "
-
-#~ msgid "Public key: "
-#~ msgstr "Javni ključ: "
-
-#~ msgid ""
-#~ "Retrieval of the issuer certificate failed. This means the CA's "
-#~ "(Certificate Authority) certificate can not be found."
-#~ msgstr ""
-#~ "Dohvaćanje certifikata izdavatelja nije uspjelo. Ovo znači da CA "
-#~ "(Certificate Authority) certifikat nije pronađen."
-
-#, fuzzy
-#~| msgid ""
-#~| "Certificate signing authority root files could not be found so the "
-#~| "certificate is not verified."
-#~ msgid ""
-#~ "Retrieval of the CRL (Certificate Revocation List) failed. This means the "
-#~ "CA's (Certificate Authority) CRL can not be found."
-#~ msgstr ""
-#~ "Korijenske (root) datoteke ustanove za potpisivanje potvrda nisu nađene "
-#~ "pa potvrda nije provjerena."
-
-#~ msgid ""
-#~ "The decryption of the certificate's signature failed. This means it could "
-#~ "not even be calculated as opposed to just not matching the expected "
-#~ "result."
-#~ msgstr ""
-#~ "Dešifriranje certificiranog potpisa nije uspjelo. Ovo znači da se potpis "
-#~ "čak nije mogao ni izračunati, a ne samo da se ne slaže s očekivanim "
-#~ "rezultatom."
-
-#~ msgid ""
-#~ "The decryption of the CRL's (Certificate Revocation List) signature "
-#~ "failed. This means it could not even be calculated as opposed to just not "
-#~ "matching the expected result."
-#~ msgstr ""
-#~ "Dešifriranje CRL (Certificate Revocation List) potpisa nije uspjelo. Ovo "
-#~ "znači da se potpis čak nije mogao ni izračunati, a ne samo da se ne slaže "
-#~ "s očekivanim rezultatom."
-
-#~ msgid ""
-#~ "The decoding of the public key of the issuer failed. This means that the "
-#~ "CA's (Certificate Authority) certificate can not be used to verify the "
-#~ "certificate you wanted to use."
-#~ msgstr ""
-#~ "Dekodiranje javnog ključa izdavalaca nije uspjelo. To znači da CA-ov "
-#~ "(Certificate Authority) certifikat ne može biti korišten za provjeravanje "
-#~ "certifikata kojeg želite koristiti."
-
-#~ msgid ""
-#~ "The certificate's signature is invalid. This means that the certificate "
-#~ "can not be verified."
-#~ msgstr ""
-#~ "Potpis certifikata nije valjan. To znači da certifikat ne može biti "
-#~ "provjeren."
-
-#~ msgid ""
-#~ "The CRL's (Certificate Revocation List) signature is invalid. This means "
-#~ "that the CRL can not be verified."
-#~ msgstr ""
-#~ "Potpis popisa opoziva certifikata je nevaljan. To znači da isti ne može "
-#~ "biti provjeren."
-
-#~ msgid "The certificate is not valid, yet."
-#~ msgstr "Certifikat još više nije valjan."
-
-#~ msgid "The certificate is not valid, any more."
-#~ msgstr "Certifikat više nije valjan."
-
-#~ msgid "The CRL (Certificate Revocation List) is not valid, yet."
-#~ msgstr "Popis opoziva certifikata još nije valjan."
-
-#~ msgid "The time format of the certificate's 'notBefore' field is invalid."
-#~ msgstr "Format vremena za certifikatovo polje 'notBefore' je nevaljano."
-
-#~ msgid "The time format of the certificate's 'notAfter' field is invalid."
-#~ msgstr "Format vremena za certifikatovo polje 'notAfter' je nevaljano."
-
-#~ msgid ""
-#~ "The time format of the CRL's (Certificate Revocation List) 'lastUpdate' "
-#~ "field is invalid."
-#~ msgstr ""
-#~ "Format vremena za polje 'lastUpdate' popisa opoziva certifikata je "
-#~ "nevaljan."
-
-#~ msgid ""
-#~ "The time format of the CRL's (Certificate Revocation List) 'nextUpdate' "
-#~ "field is invalid."
-#~ msgstr ""
-#~ "Format vremena za polje 'nextUpdate' popisa opoziva certifikata je "
-#~ "nevaljan."
-
-#~ msgid "The OpenSSL process ran out of memory."
-#~ msgstr "OpenSSL proces je ostao bez memorije."
-
-#~ msgid ""
-#~ "The certificate is self-signed and not in the list of trusted "
-#~ "certificates. If you want to accept this certificate, import it into the "
-#~ "list of trusted certificates."
-#~ msgstr ""
-#~ "Certifikat je samopotpisan, ali nije na popisu povjerenih certifikata. "
-#~ "Ako želite prihvatiti ovaj certifikat, ubacite ga na popis povjerenih "
-#~ "certifikata."
-
-#~ msgid ""
-#~ "The certificate is self-signed. While the trust chain could be built up, "
-#~ "the root CA's (Certificate Authority) certificate can not be found."
-#~ msgstr ""
-#~ "Certifikat je samopotpisan. I dok lanac povjerenja može biti izgrađen, "
-#~ "korijenski certifikat vlasništva certifikata ne može biti pronađen."
-
-#~ msgid ""
-#~ "The certificate can not be verified as it is the only certificate in the "
-#~ "trust chain and not self-signed. If you self-sign the certificate, make "
-#~ "sure to import it into the list of trusted certificates."
-#~ msgstr ""
-#~ "Certifikat ne može biti provjeren jer je jedini u lancu povjerenja i nije "
-#~ "samopotpisan. Ako ste samopotpisali certifikat, osigurajte njegovo "
-#~ "ubacivanje u popis povjerenih cerfitikata."
-
-#~ msgid "The certificate chain is longer than the maximum depth specified."
-#~ msgstr "Lanac certifikata je dulji od definirane maksimalne dubine."
-
-#~ msgid ""
-#~ "The length of the trust chain exceeded one of the CA's (Certificate "
-#~ "Authority) 'pathlength' parameters, making all subsequent signatures "
-#~ "invalid."
-#~ msgstr ""
-#~ "Duljina popisa povjerenja je prekoračila broj postavljen od strane "
-#~ "vlasništva certifikata. Zato će svi budući potpisi biti nevaljani."
-
-#~ msgid ""
-#~ "The certificate has not been signed for the purpose you tried to use it "
-#~ "for. This means the CA (Certificate Authority) does not allow this usage."
-#~ msgstr ""
-#~ "Certifikat nije potpisan za namjenu za koju ga pokušavate koristiti. To "
-#~ "znači da vlasništvo certifikata ne dozvoljava njegovo korištenje."
-
-#~ msgid ""
-#~ "The root CA (Certificate Authority) is not trusted for the purpose you "
-#~ "tried to use this certificate for."
-#~ msgstr ""
-#~ "Korijen vlasništva certifikata nije povjeren za namjenu za koju kanite "
-#~ "koristiti ovaj certifikat."
-
-#~ msgid ""
-#~ "The root CA (Certificate Authority) has been marked to be rejected for "
-#~ "the purpose you tried to use it for."
-#~ msgstr ""
-#~ "Korijen vlasništva certifikata je označen da odbija korištenje za namjenu "
-#~ "za koju ga pokušavate koristiti."
-
-#, fuzzy
-#~| msgid ""
-#~| "The IP address of the host %1 does not match the one the certificate was "
-#~| "issued to."
-#~ msgid ""
-#~ "The certificate's CA (Certificate Authority) does not match the CA name "
-#~ "of the certificate."
-#~ msgstr "IP adresa računala %1 ne odgovara onoj navedenoj u potvrdi."
-
-#, fuzzy
-#~| msgid ""
-#~| "The IP address of the host %1 does not match the one the certificate was "
-#~| "issued to."
-#~ msgid ""
-#~ "The CA (Certificate Authority) certificate's key ID does not match the "
-#~ "key ID in the 'Issuer' section of the certificate you are trying to use."
-#~ msgstr "IP adresa računala %1 ne odgovara onoj navedenoj u potvrdi."
-
-#~ msgid ""
-#~ "The CA (Certificate Authority) certificate's key ID and name do not match "
-#~ "the key ID and name in the 'Issuer' section of the certificate you are "
-#~ "trying to use."
-#~ msgstr ""
-#~ "ID ključa i ime vlasništva certifikata se ne podudaraju sa ID-om ključa i "
-#~ "imenom u području 'Izdavač' certifikata kojeg pokušavate koristiti."
-
-#~ msgid "OpenSSL could not be verified."
-#~ msgstr "OpenSSL ne može biti provjeren."
-
-#~ msgid ""
-#~ "The signature test for this certificate failed. This could mean that the "
-#~ "signature of this certificate or any in its trust path are invalid, could "
-#~ "not be decoded or that the CRL (Certificate Revocation List) could not be "
-#~ "verified. If you see this message, please let the author of the software "
-#~ "you are using know that he or she should use the new, more specific error "
-#~ "messages."
-#~ msgstr ""
-#~ "Test potpisa za ovaj certifikat nije uspio. To može značiti da je potpis "
-#~ "ovog certifikata ili bilo kojeg u njegovoj putanji povjerenja nevaljan, "
-#~ "ne može biti dekodiran ili njegov popis opoziva ne može biti provjeren. "
-#~ "Ako vidite ovu poruku, molim obavijestite autora ovog softvera da bi on/"
-#~ "ona trebao/la koristiti novije, preciznije poruke o pogreškama."
-
-#~ msgid ""
-#~ "Certificate signing authority root files could not be found so the "
-#~ "certificate is not verified."
-#~ msgstr ""
-#~ "Korijenske (root) datoteke ustanove za potpisivanje potvrda nisu nađene "
-#~ "pa potvrda nije provjerena."
-
-#~ msgid "SSL support was not found."
-#~ msgstr "Podrška za SSL nije pronađena."
-
-#~ msgid "Private key test failed."
-#~ msgstr "Testiranje privatnog ključa nije uspjelo."
-
-#~ msgid "This certificate is not relevant."
-#~ msgstr "Ova potvrda nije važeća."
-
-#~ msgid "Certificate password"
-#~ msgstr "Zaporka certifikata"
-
-#~ msgid "GMT"
-#~ msgstr "GMT"
-
-#~ msgid "Certificate"
-#~ msgstr "Potvrda"
-
-#~ msgid "Save selection for this host."
-#~ msgstr "Snimi izbor za ovaj poslužitelj."
-
-#~ msgid "Send certificate"
-#~ msgstr "Pošalji certifikat"
-
-#~ msgid "KDE SSL Certificate Dialog"
-#~ msgstr "KDE dijalog za SSL potvrde"
-
-#~ msgid ""
-#~ "The server %1 requests a certificate. Select a "
-#~ "certificate to use from the list below:"
-#~ msgstr ""
-#~ "Poslužitelj %1 zahtijeva certifikat. Odaberite certifikat "
-#~ "koji želite koristiti iz popisa:"
-
-#~ msgid "KDE Certificate Request"
-#~ msgstr "KDE zahtjev potvrde"
-
-#~ msgid "KDE Certificate Request - Password"
-#~ msgstr "KDE zahtjev potvrde – zaporka"
-
-#~ msgid "Unsupported key size."
-#~ msgstr "Nepodržana veličina ključa."
-
-#~ msgid "KDE"
-#~ msgstr "KDE"
-
-#~ msgid "Please wait while the encryption keys are generated..."
-#~ msgstr "Molimo čekajte dok se generiraju enkripcijski ključevi…"
-
-#~ msgid "Do you wish to store the passphrase in your wallet file?"
-#~ msgstr "Želite li pohraniti zaporku u vašu datoteku novčanika?"
-
-#~ msgid "Store"
-#~ msgstr "Pohraniti"
-
-#~ msgid "Do Not Store"
-#~ msgstr "Ne pohranjuj"
-
-#~ msgid "2048 (High Grade)"
-#~ msgstr "2048 (Visoka ocjena)"
-
-#~ msgid "1024 (Medium Grade)"
-#~ msgstr "1024 (Srednja ocjena)"
-
-#~ msgid "768 (Low Grade)"
-#~ msgstr "768 (Niski Stupanj)"
-
-#~ msgid "512 (Low Grade)"
-#~ msgstr "512 (Niski Stupanj)"
-
-#~ msgid "No SSL support."
-#~ msgstr "Nema podrške za SSL."
-
-#~ msgid "KMailService"
-#~ msgstr "KMailService"
-
-#~ msgid "Mail service"
-#~ msgstr "mail servis"
-
-#~ msgid "Error connecting to server."
-#~ msgstr "Greška prilikom spajanja na poslužitelj."
-
-#~ msgid "Not connected."
-#~ msgstr "Nisam spojen"
-
-#~ msgid "Time out waiting for server interaction."
-#~ msgstr "Prekoračenje vremena kod ostvarivanja veze."
-
-#~ msgid "Server said: \"%1\""
-#~ msgstr "Poslužitelj je rekao : \"%1\""
-
-#~ msgid "KSendBugMail"
-#~ msgstr "KSendBugMail"
-
-#~ msgid "Sends a bug report by email"
-#~ msgstr "Pošalji izvještaj o grešci e-poštom"
-
-#~ msgid "(c) 2000 Stephan Kulow"
-#~ msgstr "© 2000 Stephan Kulow"
-
-#~ msgid "Stephan Kulow"
-#~ msgstr "Stephan Kulow"
-
-#~ msgid "Author"
-#~ msgstr "Autor"
-
-#~ msgid "Subject line"
-#~ msgstr "Linija s temom"
-
-#~ msgid "Recipient"
-#~ msgstr "Primatelj"
-
-#~ msgid "telnet service"
-#~ msgstr "telnet usluga"
-
-#~ msgid "telnet protocol handler"
-#~ msgstr "rukovoditelj telnet protokola"
-
-#~ msgctxt "NAME OF TRANSLATORS"
-#~ msgid "Your names"
-#~ msgstr "Andrej Dundović, Marko Dimjašević"
-
-#~ msgctxt "EMAIL OF TRANSLATORS"
-#~ msgid "Your emails"
-#~ msgstr "adundovi@gmail.com, marko@dimjasevic.net"
-
-#~ msgid "Organization / Common Name"
-#~ msgstr "Organizacija / uobičajen naziv"
-
-#~ msgid "Organizational Unit"
-#~ msgstr "Organizacijska jedinica"
-
-#~ msgid "Display..."
-#~ msgstr "Prikaži…"
-
-#~ msgid "Disable"
-#~ msgstr "Onemogući"
-
-#~ msgid "Enable"
-#~ msgstr "Omogući"
-
-#~ msgid "Subject Information "
-#~ msgstr "Informacije o subjektu "
-
-#~ msgid "Issuer Information "
-#~ msgstr "Informacije o izdavaocu "
-
-#~ msgid "Other "
-#~ msgstr "Ostalo "
-
-#~ msgid "Validity period"
-#~ msgstr "Period valjanosti"
-
-#~ msgid "Serial number"
-#~ msgstr "Serijski broj"
-
-#~ msgid "MD5 digest"
-#~ msgstr "MD5 sažetak"
-
-#~ msgid "SHA1 digest"
-#~ msgstr "SHA1 sažetak"
-
-#~ msgid ""
-#~ "You have indicated that you wish to obtain or purchase a secure "
-#~ "certificate. This wizard is intended to guide you through the procedure. "
-#~ "You may cancel at any time, and this will abort the transaction."
-#~ msgstr ""
-#~ "Označili ste da želite nabaviti ili kupiti sigurnosni certifikat.Ovaj "
-#~ "čarobnjak je napravljen da vas vodi kroz proceduru. Možete odustatiu bilo "
-#~ "kojem trenutku, a to će prekinuti transakciju."
-
-#~ msgid ""
-#~ "You must now provide a password for the certificate request. Please "
-#~ "choose a very secure password as this will be used to encrypt your "
-#~ "private key."
-#~ msgstr ""
-#~ "Morate upisati zaporku za zahtjev certifikata. Molim vas da odaberete "
-#~ "vrlo sigurnu zaporku jer će se ona koristiti za enkripciju vašeg "
-#~ "privatnog ključa."
-
-#~ msgid "&Repeat password:"
-#~ msgstr "&Ponovite zaporku"
-
-#~ msgid "&Choose password:"
-#~ msgstr "Odaberite &zaporku:"
-
-#~ msgid "Could not read %1"
-#~ msgstr "Ne mogu čitati %1"
-
-#~ msgid "KDE HTTP cache maintenance tool"
-#~ msgstr "Alat za održavanje KDE HTTP međumemorije"
-
-#~ msgid "Empty the cache"
-#~ msgstr "Isprazni međuspremnik"
-
-#~ msgid "Display information about cache file"
-#~ msgstr "Prikaži informacije o datoteci privremene memorije"
-
-#~ msgid "You received a cookie from"
-#~ msgid_plural "You received %1 cookies from"
-#~ msgstr[0] "Primili ste %1 kolačić od"
-#~ msgstr[1] "Primili ste %1 kolačića od"
-#~ msgstr[2] "Primili ste %1 kolačića od"
-
-#~ msgid "Do you want to accept or reject?"
-#~ msgstr "Želite li prihvatiti ili odbiti?"
-
-#~ msgid "HTTP Cookie Daemon"
-#~ msgstr "HTTP Cookie Daemon"
-
-#~ msgid "HTTP cookie daemon"
-#~ msgstr "HTTP servis za kolačiće"
-
-#~ msgid "Shut down cookie jar"
-#~ msgstr "Zatvori staklenku sa kolačićima"
-
-#~ msgid "Remove cookies for domain"
-#~ msgstr "Ukloni kolačiće za domenu"
-
-#~ msgid "Remove all cookies"
-#~ msgstr "Ukloni sve kolačiće"
-
-#~ msgid "Reload configuration file"
-#~ msgstr "Ponovno učitaj konfiguracijsku datoteku"
-
-#~ msgid "The specified folder already exists."
-#~ msgstr "Navedeni direktorij već postoji."
-
-#~ msgid "Retrieving from %1..."
-#~ msgstr "Preuzimam podatke od %1…"
-
-#~ msgid "kio_metainfo"
-#~ msgstr "kio_metainfo"
-
-#~ msgid "No metainfo for %1"
-#~ msgstr "Nema meta informacija za %1"
-
-#~ msgctxt "folder name"
-#~ msgid "New Folder"
-#~ msgstr "Nova mapa"
-
-#~ msgctxt "@label:textbox"
-#~ msgid ""
-#~ "Create new folder in:\n"
-#~ "%1"
-#~ msgstr ""
-#~ "Stvori novu mapu u:\n"
-#~ "%1"
-
-#~ msgctxt "@action:button"
-#~ msgid "New Folder..."
-#~ msgstr "Nova mapa…"
-
-#~ msgctxt "@action:inmenu"
-#~ msgid "New Folder..."
-#~ msgstr "Nova mapa…"
-
-#~ msgctxt "@action:inmenu"
-#~ msgid "Move to Trash"
-#~ msgstr "Premjesti u smeće"
-
-#~ msgctxt "@action:inmenu"
-#~ msgid "Delete"
-#~ msgstr "Izbriši"
-
-#~ msgctxt "@option:check"
-#~ msgid "Show Hidden Folders"
-#~ msgstr "Prikaži skrivene mape"
-
-#~ msgctxt "@action:inmenu"
-#~ msgid "Properties"
-#~ msgstr "Svojstva"
-
-#~ msgid "Show Hidden Folders"
-#~ msgstr "Prikaži skrivene mape"
-
-#~ msgid "Edit file type"
-#~ msgstr "Uređivanje tipa datoteke"
-
-#~ msgid "A newer item named '%1' already exists."
-#~ msgstr "Već postoji novija stavka nazvana %1."
-
-#, fuzzy
-#~| msgid "L&abel:"
-#~ msgid "TextLabel"
-#~ msgstr "N&atpis:"
-
-#~ msgid "Requesting data to send"
-#~ msgstr "Zahtjevam slanje podataka"
-
-#, fuzzy
-#~| msgid "Size:"
-#~ msgctxt "@label"
-#~ msgid "Size:"
-#~ msgstr "Veličina:"
-
-#, fuzzy
-#~| msgid "Type:"
-#~ msgctxt "@label file type"
-#~ msgid "Type:"
-#~ msgstr "Vrsta:"
-
-#, fuzzy
-#~| msgid "Modified:"
-#~ msgctxt "@label"
-#~ msgid "Modified:"
-#~ msgstr "Mijenjano:"
-
-#, fuzzy
-#~| msgid "Owner:"
-#~ msgctxt "@label"
-#~ msgid "Owner:"
-#~ msgstr "Vlasnik:"
-
-#, fuzzy
-#~| msgid "Permissions:"
-#~ msgctxt "@label"
-#~ msgid "Permissions:"
-#~ msgstr "Ovlasti:"
-
-#, fuzzy
-#~| msgid "Type"
-#~ msgctxt "@item::inlistbox"
-#~ msgid "Type"
-#~ msgstr "Vrsta"
-
-#, fuzzy
-#~| msgid "Size"
-#~ msgctxt "@item::inlistbox"
-#~ msgid "Size"
-#~ msgstr "Veličina"
-
-#, fuzzy
-#~ msgctxt "@item::inlistbox"
-#~ msgid "Modified"
-#~ msgstr "Mijenjano:"
-
-#, fuzzy
-#~| msgid "Owner"
-#~ msgctxt "@item::inlistbox"
-#~ msgid "Owner"
-#~ msgstr "Vlasnik"
-
-#, fuzzy
-#~| msgid "Permissions"
-#~ msgctxt "@item::inlistbox"
-#~ msgid "Permissions"
-#~ msgstr "Dozvole"
-
-#~ msgid "Unmounted Icon"
-#~ msgstr "Ikona demonitiranja"
-
-#, fuzzy
-#~| msgid ""
-#~| "This action would overwrite '%1' with itself.\n"
-#~| "Please enter a new file name:"
-#~ msgid "This action will overwrite '%1' with a newer file '%2'."
-#~ msgstr ""
-#~ "Ovaj postupak će prepisati '%1' samim sobom.\n"
-#~ "Molim Vas, unesite novi naziv datoteke:"
-
-#, fuzzy
-#~| msgid ""
-#~| "This action would overwrite '%1' with itself.\n"
-#~| "Please enter a new file name:"
-#~ msgid "This action will overwrite '%1' with a file of the same age '%2'."
-#~ msgstr ""
-#~ "Ovaj postupak će prepisati '%1' samim sobom.\n"
-#~ "Molim Vas, unesite novi naziv datoteke:"
-
-#~ msgctxt "Available space out of total partition size (percent used)"
-#~ msgid "%1 out of %2 (%3% used)"
-#~ msgstr "%1 od %2 (%3% iskorišteno)"
-
-#, fuzzy
-#~ msgctxt "@label"
-#~ msgid "Folder"
-#~ msgstr "Mapa"
-
-#~ msgid "size %1 (%2)"
-#~ msgstr "size %1 (%2)"
-
-#~ msgid "created on %1"
-#~ msgstr "stvoreno na %1"
-
-#~ msgid "modified on %1"
-#~ msgstr "mijenjano %1"
-
-#~ msgid "The source file is '%1'"
-#~ msgstr "Izvorna datoteka je %1"
-
-#~ msgctxt "@action:inmenu"
-#~ msgid "Move to trash"
-#~ msgstr "Premjesti u smeće"
-
-#, fuzzy
-#~| msgctxt "@info"
-#~| msgid "Do you really want to empty the Trash? All items will be deleted."
-#~ msgctxt "@info"
-#~ msgid "Do you really want to empty the trash? All items will be deleted."
-#~ msgstr "Želite li zaista isprazniti smeće? Sve stavke bit će izbrisane."
-
-#, fuzzy
-#~| msgid "Add..."
-#~ msgctxt "@label"
-#~ msgid "Add Tags..."
-#~ msgstr "Dodaj…"
-
-#, fuzzy
-#~| msgid "Create New"
-#~ msgctxt "@label"
-#~ msgid "Create new tag:"
-#~ msgstr "Stvori novi"
-
-#, fuzzy
-#~| msgid "Delete"
-#~ msgctxt "@info"
-#~ msgid "Delete tag"
-#~ msgstr "Izbriši"
-
-#, fuzzy
-#~| msgid "Delete"
-#~ msgctxt "@title"
-#~ msgid "Delete tag"
-#~ msgstr "Izbriši"
-
-#, fuzzy
-#~| msgid "Delete"
-#~ msgctxt "@action:button"
-#~ msgid "Delete"
-#~ msgstr "Izbriši"
-
-#, fuzzy
-#~| msgid "Cancel Job"
-#~ msgctxt "@action:button"
-#~ msgid "Cancel"
-#~ msgstr "Odkaži posao"
-
-#~ msgid "&Meta Info"
-#~ msgstr "&Meta podaci"
-
-#~ msgid "&Auto Skip"
-#~ msgstr "&Automatski preskoči"
-
-#~ msgid ""
-#~ "Do not copy or move any folder that already exists in the destination "
-#~ "folder.\n"
-#~ "You will be prompted again in case of a conflict with an existing file "
-#~ "though."
-#~ msgstr ""
-#~ "Ne kopiraj niti ne premještaj nikakvu mapu koja već postoji u odredišnoj "
-#~ "mapi.\n"
-#~ "Sustav će vas opet tražiti potvrdu ukoliko dođe do sukoba s postojećom "
-#~ "datotekom."
-
-#~ msgid ""
-#~ "Do not copy or move any file that already exists in the destination "
-#~ "folder.\n"
-#~ "You will be prompted again in case of a conflict with an existing "
-#~ "directory though."
-#~ msgstr ""
-#~ "Ne kopiraj niti ne premještaj nikakvu datoteku koja već postoji u "
-#~ "odredišnoj mapi.\n"
-#~ "Sustav će vas opet tražiti potvrdu ukoliko dođe do sukoba s postojećim "
-#~ "direktorijom."
-
-#~ msgctxt "Write files into any existing directory"
-#~ msgid "&Write Into All"
-#~ msgstr "Upiši u s&ve"
-
-#~ msgid "&Overwrite All"
-#~ msgstr "Prepiši s&ve"
-
-#~ msgid ""
-#~ "Files and folders will be copied into any existing directory, alongside "
-#~ "its existing contents.\n"
-#~ "You will be prompted again in case of a conflict with an existing file in "
-#~ "a directory, but not in case of another existing directory."
-#~ msgstr ""
-#~ "Datoteke i mape bit će kopirane u bilo koji postojeći direktorij zajedno "
-#~ "s postojećim sadržajem.\n"
-#~ "Sustav će vas opet tražiti potvrdu ukoliko dođe do sukoba s postojećom "
-#~ "datotekom u direktoriju, ali ne i u slučaju postojanja drugog direktorija."
-
-#~ msgid "R&esume All"
-#~ msgstr "Nastavi sv&e"
-
-#~ msgid "Sends a short bug report to submit@bugs.kde.org"
-#~ msgstr "Šalje kratak opis greške na submit@bugs.kde.org"
-
-#, fuzzy
-#~| msgid "&Edit..."
-#~ msgid "&Edit '%1'..."
-#~ msgstr "&Uređivanje..."
-
-#, fuzzy
-#~ msgid "&Remove '%1'"
-#~ msgstr "Ob&riši zapis"
-
-#~ msgid "Unexpected end of data, some information may be lost."
-#~ msgstr "Neočekivan kraj podataka, neki podaci mogu biti izgubljeni."
-
-#~ msgid "size %1"
-#~ msgstr "veličina %1"
-
-#, fuzzy
-#~ msgid "0 Items"
-#~ msgstr "%1 stavka"
-
-#~ msgid "Add Bookmark"
-#~ msgstr "Dodaj knjižnu oznaku"
-
-#, fuzzy
-#~| msgid " Do you want to retry?"
-#~ msgid " Do you want to retry?"
-#~ msgstr " Želite li pokupati ponovo?"
-
-#~ msgid "Authentication"
-#~ msgstr "Provjera valjanosti"
-
-#~ msgid "Authentication needed for %1 but authentication is disabled."
-#~ msgstr "Autentikacija je potrebna za %1, ali autentikacije je isključena."
-
-#~ msgid ""
-#~ "Unsupported method: authentication will fail. Please submit a bug report."
-#~ msgstr ""
-#~ "Metoda nije podržana: prijavljivanje neće uspjeti. Molim, prijavite "
-#~ "pogrešku."
-
-#, fuzzy
-#~ msgid "No Files"
-#~ msgstr "*|Sve datoteke"
-
-#, fuzzy
-#~ msgid "One File"
-#~ msgid_plural "%1 Files"
-#~ msgstr[0] "%1 datoteka"
-#~ msgstr[1] "%1 datoteka"
-#~ msgstr[2] "%1 datoteka"
-
-#, fuzzy
-#~ msgid "No Folders"
-#~ msgstr "Nova mapa"
-
-#, fuzzy
-#~ msgid "One Folder"
-#~ msgid_plural "%1 Folders"
-#~ msgstr[0] "%1. Mapa"
-#~ msgstr[1] "%1. Mape"
-#~ msgstr[2] "%1 Mapa"
-
-#~ msgid "(%1 Total)"
-#~ msgstr "(%1 Ukupno)"
-
-#, fuzzy
-#~ msgctxt "Items (Folders, Files), Size"
-#~ msgid "%1 (%2, %3), %4"
-#~ msgstr "%1 (port %2 )"
-
-#, fuzzy
-#~| msgid "Icon View"
-#~ msgid "Icon Size"
-#~ msgstr "Ikonski pregled"
-
-#~ msgid ""
-#~ "%1\n"
-#~ "does not appear to be a valid URL.\n"
-#~ msgstr ""
-#~ "%1\n"
-#~ "ne izgleda kao važeći URL.\n"
-
-#~ msgid "Invalid URL"
-#~ msgstr "Neispravan URL"
-
-#~ msgid "Filename Error"
-#~ msgstr "Greška imena datoteke"
-
-#~ msgid "KDE Wallet Service"
-#~ msgstr "KDE Wallet servis"
-
-#, fuzzy
-#~ msgid ""
-#~ "KDE has requested to open the wallet '%1 '. Please enter the "
-#~ "password for this wallet below. "
-#~ msgstr "KDE zahtjeva da otvori wallet „%1“. Unesete lozinku za ovaj wallet."
-
-#, fuzzy
-#~ msgid ""
-#~ "The application '%1 ' has requested to open the wallet '%2"
-#~ "b>'. Please enter the password for this wallet below. "
-#~ msgstr ""
-#~ "Program '%1' zahtjeva otvaranje novčanika '%2'. Molim, unesite lozinku za "
-#~ "novčanik ispod."
-
-#, fuzzy
-#~ msgid ""
-#~ "Error opening the wallet '%1 '. Please try again. (Error "
-#~ "code %2: %3) "
-#~ msgstr ""
-#~ "Nevažeća lozinka za wallet '%1'. Molimo pokušajte ponovo. (Kod greške %2)"
-
-#~ msgid ""
-#~ "KDE has requested to open the wallet. This is used to store sensitive "
-#~ "data in a secure fashion. Please enter a password to use with this wallet "
-#~ "or click cancel to deny the application's request."
-#~ msgstr ""
-#~ "KDE zahtjeva da otvori KDE wallet. To se koristi za pohranjivanje "
-#~ "osetljivihpodataka na bezbjedan način. Molim unesite lozinku za "
-#~ "korištenje ovog wallet-a ili kliknite odustajanje za prekid zahtjeva "
-#~ "programa."
-
-#, fuzzy
-#~ msgid ""
-#~ "The application '%1 ' has requested to open the KDE wallet. "
-#~ "This is used to store sensitive data in a secure fashion. Please enter a "
-#~ "password to use with this wallet or click cancel to deny the "
-#~ "application's request. "
-#~ msgstr ""
-#~ "Program '%1' zahtjeva otvaranje KDE novčanika. Koristi se za "
-#~ "pohranjivanje osjetljivih podataka na siguran način. Molim unesite "
-#~ "lozinku za korištenje ovog novčanika ili otkažite ako želite odbaciti "
-#~ "zahtjev programa. "
-
-#, fuzzy
-#~ msgid ""
-#~ "KDE has requested to create a new wallet named '%1 '. Please "
-#~ "choose a password for this wallet, or cancel to deny the application's "
-#~ "request. "
-#~ msgstr ""
-#~ "KDE zahtjeva da napravi nov Wallet sa imenom „%1“. Odaberite lozinkuza "
-#~ "ovaj Wallet, ili otkažite ako želite odbaciti zahtjev programa."
-
-#, fuzzy
-#~ msgid ""
-#~ "The application '%1 ' has requested to create a new wallet "
-#~ "named '%2 '. Please choose a password for this wallet, or cancel to "
-#~ "deny the application's request. "
-#~ msgstr ""
-#~ "Program '%1' zahtjeva kreiranje novog novčanika imena '%2'. Molim, "
-#~ "odaberite lozinku za ovaj novčanik, ili otkažite ako želite odbaciti "
-#~ "zahtjev programa."
-
-#, fuzzy
-#~ msgid "KDE has requested access to the open wallet '%1 '. "
-#~ msgstr "Program '%1' zahtjeva pristup otvaranju novčanika '%2'."
-
-#, fuzzy
-#~ msgid ""
-#~ "The application '%1 ' has requested access to the open wallet "
-#~ "'%2 '. "
-#~ msgstr "Program '%1' zahtjeva pristup otvaranju novčanika '%2'."
-
-#~ msgid ""
-#~ "Unable to open wallet. The wallet must be opened in order to change the "
-#~ "password."
-#~ msgstr ""
-#~ "Nije moguće otvoriti novčanik. Novčanik mora biti otvoren da biste mogli "
-#~ "mijenjati lozinku."
-
-#, fuzzy
-#~ msgid "Please choose a new password for the wallet '%1 '. "
-#~ msgstr "Molim vas, odaberite novu lozinku za wallet '%1'."
-
-#~ msgid "Error re-encrypting the wallet. Password was not changed."
-#~ msgstr ""
-#~ "Greška prilikom ponovnog šifriranja Wallet-a. Lozinka nije promjenjena."
-
-#~ msgid "Error reopening the wallet. Data may be lost."
-#~ msgstr ""
-#~ "Geška prilikom ponovnog otvaranja Wallet-a. Podaci mogu biti izgubljeni."
-
-#~ msgid ""
-#~ "There have been repeated failed attempts to gain access to a wallet. An "
-#~ "application may be misbehaving."
-#~ msgstr ""
-#~ "Bilo je ponovljenih neuspješnih pokušaja pristupanja novčaniku. Program "
-#~ "se možda ne ponaša kako bi trebalo."
-
-#~ msgid "Passwords match."
-#~ msgstr "Lozinke se poklapaju."
-
-#~ msgid "Passwords do not match."
-#~ msgstr "Lozinke se ne podudaraju."
-
-#~ msgid "KWallet - The KDE Wallet System"
-#~ msgstr "KWallet - KDE sustav novčanika"
-
-#~ msgid ""
-#~ "Welcome to KWallet, the KDE Wallet System. KWallet allows you to store "
-#~ "your passwords and other personal information on disk in an encrypted "
-#~ "file, preventing others from viewing the information. This wizard will "
-#~ "tell you about KWallet and help you configure it for the first time."
-#~ msgstr ""
-#~ "Dobrodošli u KWallet, KDE sustav novčanika. KWallet vam omogućava "
-#~ "pohranjivanje vaše lozinke i drugih osobnih podataka na disk u šifriranoj "
-#~ "datoteci, i tako sprečavanje drugih da vide vaše podatke. Ovaj čarobnjak "
-#~ "će vam ispričati o KWallet i pomoći vam kod prvog podešavanja."
-
-#~ msgid "&Basic setup (recommended)"
-#~ msgstr " &Basic setup (preporučeno)"
-
-#~ msgid "&Advanced setup"
-#~ msgstr "N&apredne postavke"
-
-#~ msgid "Yes, I wish to use the KDE wallet to store my personal information."
-#~ msgstr ""
-#~ "Da, želim koristii KDE novčanik za pohranjivanje mojih osobnih podataka."
-
-#~ msgid "Enter a new password:"
-#~ msgstr "Unesite novu zaporku:"
-
-#~ msgid "Verify password:"
-#~ msgstr "Potvrdi zaporku: "
-
-#~ msgid ""
-#~ "The KDE Wallet system allows you to control the level of security of your "
-#~ "personal data. Some of these settings do impact usability. While the "
-#~ "default settings are generally acceptable for most users, you may wish to "
-#~ "change some of them. You may further tune these settings from the "
-#~ "KWallet control module."
-#~ msgstr ""
-#~ "KDE sustav novčanika dopušta vam nadzor nivoa sigurnosti vaših osobnih "
-#~ "podataka. Neke od ovih postavki smanjuju mogućnost upotrebe. Iako su "
-#~ "uobičajene postavke općenito prihvatljive za većinu korisnika, možda ćete "
-#~ "poželjeti promijeniti neke od njih. Ove postavke možete detaljnjije "
-#~ "podesiti iz KWallet upravljačkog modula."
-
-#~ msgid "Automatically close idle wallets"
-#~ msgstr "Automatski zatvori bezposlene wallete"
-
-#~ msgid "Store network passwords and local passwords in separate wallet files"
-#~ msgstr ""
-#~ "Pohranjuje mrežne i lokalne lozinke u odvojenim datotekama novčanika"
-
-#~ msgid "Allow &Once"
-#~ msgstr "D&opusti jednom"
-
-#~ msgid "Allow &Always"
-#~ msgstr "Dopusti &Always"
-
-#, fuzzy
-#~ msgid "&Deny"
-#~ msgstr "&Otvori"
-
-#, fuzzy
-#~ msgid "Deny &Forever"
-#~ msgstr "&Zauvijek"
-
-#~ msgid "Locality:"
-#~ msgstr "Općina:"
-
-#, fuzzy
-#~ msgctxt "Federal State"
-#~ msgid "State:"
-#~ msgstr ""
-#~ "_: Federal State\n"
-#~ "Stanje:"
-
-#~ msgid "Email:"
-#~ msgstr "E-pošta:"
-
-#, fuzzy
-#~| msgid "An unexpected error (%1) occurred while attempting to %2."
-#~ msgctxt "%1: code, %2: request type"
-#~ msgid "An unexpected error (%1) occurredwhile attempting to %2."
-#~ msgstr "Dogodila se neočekivana greška (%1) kod pokušaja %2."
-
-#, fuzzy
-#~| msgid "Parent Folder"
-#~ msgctxt "@info:tooltip"
-#~ msgid "Parent Folder"
-#~ msgstr "Roditelj direktorija"
-
-#~ msgid "Free disk space:"
-#~ msgstr "Slobodan diskovni prostor:"
-
-#~ msgid "Add a bookmark for the current document"
-#~ msgstr "Dodajte oznaku za trenutni dokument"
-
-#, fuzzy
-#~ msgid "Please specify the filename to save to."
-#~ msgstr "Molimo odaberite datoteku za snimanje."
-
-#~ msgid "Please select the file to open."
-#~ msgstr "Molimo odaberite datoteku za otvaranje."
-
-#~ msgid "Certificate signing authority is unknown or invalid."
-#~ msgstr "Nepoznata ili nepostojeća ustanova koja je izdala potvrdu."
-
-#~ msgid "Certificate is self-signed and thus may not be trustworthy."
-#~ msgstr "Potvrda je potpisana od osobe koja ju nudi i stoga nije pouzdana."
-
-#~ msgid "Signature is untrusted."
-#~ msgstr "Potpis nije siguran."
-
-#~ msgid "Signature test failed."
-#~ msgstr "Testiranje potpisa nije uspjelo."
-
-#~ msgid "Rejected, possibly due to an invalid purpose."
-#~ msgstr "Odbijeno, vjerojatno zbog krivog odgovora."
-
-#, fuzzy
-#~| msgid "Common name:"
-#~ msgid "Common Name:"
-#~ msgstr "Ime:"
-
-#~ msgid "A&ssociation"
-#~ msgstr "Ve&ze"
-
-#~ msgid "Pattern ( example: *.html;*.htm )"
-#~ msgstr "Uzorak ( primjer: *.html;*.htm )"
-
-#~ msgid "Left click previews"
-#~ msgstr "Lijevi klik pregledava"
-
-#~ msgid "C&ryptography Configuration..."
-#~ msgstr "K&riptografske postavke..."
-
-#~ msgid "Chain:"
-#~ msgstr "Lanac:"
-
-#~ msgid "0 - Site Certificate"
-#~ msgstr "0- potvrda stranice"
-
-#~ msgid "Peer certificate:"
-#~ msgstr "Potvrda udaljenog računala:"
-
-#~ msgid "Certificate state:"
-#~ msgstr "Stanje certifikata:"
-
-#~ msgid "Valid until:"
-#~ msgstr "Vrijedi do:"
-
-#~ msgid "Cipher in use:"
-#~ msgstr "Šifrator u uporabi:"
-
-#~ msgid "Cipher strength:"
-#~ msgstr "Snaga šifratora:"
-
-#~ msgid "Connecting to %1..."
-#~ msgstr "Spajam se na %1..."
-
-#~ msgid "Proxy %1 at port %2"
-#~ msgstr "Proxy %1 na portu %2"
-
-#~ msgid "%1 (port %2)"
-#~ msgstr "%1 (port %2 )"
-
-#~ msgid "Unknown View"
-#~ msgstr "Nepoznati pogled"
-
-#~ msgid "Root Folder: %1"
-#~ msgstr "Korijenski Direktorij (Root): %1"
-
-#~ msgid "Home Folder: %1"
-#~ msgstr "Početna mapa: %1"
-
-#~ msgid "Documents: %1"
-#~ msgstr "Dokumenti: %1"
-
-#~ msgid "Desktop: %1"
-#~ msgstr "Radna površina: %1"
-
-#, fuzzy
-#~| msgid ""
-#~| "The desktop entry file\n"
-#~| "%1\n"
-#~| " has an invalid menu entry\n"
-#~| "%2."
-#~ msgid "The desktop menu %1 has an invalid X-KDE-GetActionMenu entry."
-#~ msgstr ""
-#~ "Stavka datoteke na radnoj površini\n"
-#~ "%1\n"
-#~ "ima neispravnu stavku izbornika\n"
-#~ "%2."
-
-#~ msgid ""
-#~ "The desktop entry file\n"
-#~ "%1\n"
-#~ " has an invalid menu entry\n"
-#~ "%2."
-#~ msgstr ""
-#~ "Stavka datoteke na radnoj površini\n"
-#~ "%1\n"
-#~ "ima neispravnu stavku izbornika\n"
-#~ "%2."
-
-#~ msgid "Small Icons"
-#~ msgstr "Malene ikone"
-
-#~ msgid "Large Icons"
-#~ msgstr "Velike ikone"
-
-#~ msgid "Thumbnail Previews"
-#~ msgstr "Maleni pregledi"
-
-#~ msgid "Preview"
-#~ msgstr "Pregled"
-
-#~ msgid "No preview available."
-#~ msgstr "Pogled nije dostupan."
-
-#~ msgid "Stopped"
-#~ msgstr "Zaustavljeno"
-
-#~ msgid "&Automatic preview"
-#~ msgstr "&Automatski pregled"
-
-#~ msgid "&Preview"
-#~ msgstr "&Pregled"
-
-#~ msgid "Edit Quick Access Entry"
-#~ msgstr "Izmijeni zapis brzog pristupa"
-
-#, fuzzy
-#~| msgid ""
-#~| "Please provide a description, URL and icon for this Quick Access "
-#~| "entry. "
-#~ msgid ""
-#~ "Please provide a description, URL and icon for this Quick Access "
-#~ "entry. "
-#~ msgstr ""
-#~ "Molim unesite URL, ikonu i opis za ovaj Quick Entry unos. "
-#~ "qt>"
-
-#~ msgid "&URL:"
-#~ msgstr "URL:"
-
-#~ msgid "Reverse"
-#~ msgstr "Obrnuti redoslijed"
-
-#~ msgid "Separate Folders"
-#~ msgstr "Odvoji direktorije"
-
-#~ msgid "Case Insensitive"
-#~ msgstr "Ne razlikuj VELIKA i mala slova"
-
-#, fuzzy
-#~ msgid ""
-#~ "Error opening the wallet '%1 '. Please try again. (Error "
-#~ "code %2: %3)"
-#~ msgstr ""
-#~ "Nevažeća lozinka za wallet '%1'. Molimo pokušajte ponovo. (Kod greške %2)"
-
-#, fuzzy
-#~ msgid ""
-#~ "This is the currently listed location. The drop-down list also lists "
-#~ "commonly used locations. This includes standard locations, such as your "
-#~ "home folder, as well as locations that have been visited recently."
-#~ msgstr ""
-#~ "Ovdje su izlistane često korištene lokacije. Ovo uključuje standardne "
-#~ "lokacije, kao što su vaša korisnička mapa, kao i lokacije koje su bile "
-#~ "nedavno posjećene."
-
-#~ msgid "Netscape Bookmarks"
-#~ msgstr "Netscape oznake"
-
-#, fuzzy
-#~ msgid "Select Mime Types"
-#~ msgstr "Mime tip"
-
-#, fuzzy
-#~| msgid "Protocol %1 is not a Filesystem"
-#~ msgid "KProtocolinfo Test"
-#~ msgstr "Protokol %1 nije datotečni sustav"
-
-#, fuzzy
-#~ msgid "Source URL"
-#~ msgstr "Izvor:"
-
-#, fuzzy
-#~| msgid "Preview"
-#~ msgid "previewtest"
-#~ msgstr "Pregled"
-
-#, fuzzy
-#~| msgid "Progress Dialog"
-#~ msgid "KIO Properties Dialog Test"
-#~ msgstr "Dijalog o napretku"
-
-#, fuzzy
-#~| msgid "Speed"
-#~ msgid "SpeedApp"
-#~ msgstr "Brzina"
-
-#, fuzzy
-#~| msgid "Cookie Alert"
-#~ msgid "kcookietest"
-#~ msgstr "Upozorenje: Kolačić"
-
-#~ msgid "&Add Entry..."
-#~ msgstr "&Dodaj zapis..."
-
-#~ msgid "%1 (Link)"
-#~ msgstr "%1 (Veza)"
-
-#, fuzzy
-#~ msgid "Hide Quick Access Navigation Panel"
-#~ msgstr "Prikaži kraticu navigacijske ploče "
-
-#, fuzzy
-#~ msgid "Hide Preview"
-#~ msgstr "Pregled"
-
-#~ msgid "Desktop"
-#~ msgstr "Radna površina"
-
-#~ msgid "Documents"
-#~ msgstr "Dokumenti"
-
-#, fuzzy
-#~ msgid "Network Folders"
-#~ msgstr "Nova mapa"
-
-#~ msgid "&Large Icons"
-#~ msgstr "&Velike ikone"
-
-#~ msgid "&Small Icons"
-#~ msgstr "&Malene ikone"
-
-#~ msgid "List all metadata keys which have a value in the given file(s)."
-#~ msgstr ""
-#~ "Popis svih metadata ključeva koji imaju vrijednosti u danim datotekama."
-
-#~ msgid "Prints all metadata values, available in the given file(s)."
-#~ msgstr "Ispis svih metadata vrijednosti, dortupnih u danim datotekama."
-
-#~ msgid ""
-#~ "Opens a KDE properties dialog to allow viewing and modifying of metadata "
-#~ "of the given file(s)"
-#~ msgstr ""
-#~ "Otvara KDE dijalog svojstava, čime omogućava pregledavanje i mijenjanje "
-#~ "metadata danih datoteka"
-
-#~ msgid ""
-#~ "Attempts to set the value 'value' for the metadata key 'key' for the "
-#~ "given file(s)"
-#~ msgstr ""
-#~ "Pokušava postaviti vrijednost ('value') za metadata ključa ('key') za "
-#~ "dane datoteke."
-
-#~ msgid "The file (or a number of files) to operate on."
-#~ msgstr "Datoteka (ili više njih) na kojima će se raditi."
-
-#~ msgid "kfile"
-#~ msgstr "kfile"
-
-#~ msgid "A commandline tool to read and modify metadata of files."
-#~ msgstr "alat naredbenog retka za čitanje i mijenjanje matadata datoteka."
-
-#~ msgid "No files specified"
-#~ msgstr "Nije specifirana niti jedna datoteka"
-
-#~ msgid "Cannot determine metadata"
-#~ msgstr "Nemogu utvrditi metadata"
-
-#~ msgid "Menu Editor"
-#~ msgstr "Uređivač izbornika"
-
-#~ msgid "New..."
-#~ msgstr "Novo..."
-
-#~ msgid "Move Up"
-#~ msgstr "Pomakni gore"
-
-#~ msgid "Move Down"
-#~ msgstr "Pomakni dolje"
-
-#~ msgid ""
-#~ "Could not find mime type\n"
-#~ "%1"
-#~ msgstr ""
-#~ "Ne mogu pronaći mime tip\n"
-#~ "%1"
-
-#~ msgid "Source:"
-#~ msgstr "Izvor:"
-
-#~ msgid "Destination:"
-#~ msgstr "Odredište:"
-
-#~ msgid "&Keep this window open after transfer is complete"
-#~ msgstr "Ostavi prozor otvoren nakon završet&ka prijenosa."
-
-#~ msgid "Open &File"
-#~ msgstr "Otvori &datoteku"
-
-#~ msgid "Open &Destination"
-#~ msgstr "Otvori &Odredište"
-
-#~ msgid "%1 file"
-#~ msgid_plural "%1 files"
-#~ msgstr[0] "%1 datoteka"
-#~ msgstr[1] "%1 datoteke"
-#~ msgstr[2] "%1 datoteka"
-
-#~ msgid "%1 % of %2 "
-#~ msgstr "%1 % od %2 "
-
-#, fuzzy
-#~ msgid "%2 % of 1 file"
-#~ msgid_plural "%2 % of %1 files"
-#~ msgstr[0] "%2 / %1 datoteka%2 / %1 datoteka"
-
-#~ msgid " (Copying)"
-#~ msgstr " (Kopiram)"
-
-#~ msgid " (Moving)"
-#~ msgstr " (Premještam)"
-
-#~ msgid " (Deleting)"
-#~ msgstr " (Brišem)"
-
-#~ msgid " (Creating)"
-#~ msgstr " (Stvaram)"
-
-#, fuzzy
-#~ msgid " (Done)"
-#~ msgstr "%1/s (gotovo)"
-
-#~ msgid "%1 of %2 complete"
-#~ msgstr "završeno %1 od %2 "
-
-#~ msgid "%2 / %1 folder"
-#~ msgid_plural "%2 / %1 folders"
-#~ msgstr[0] "%2 / %1 direktorij"
-#~ msgstr[1] "%2 / %1 direktorija"
-#~ msgstr[2] "%2 / %1 direktorija"
-
-#, fuzzy
-#~ msgid "%2 / %1 file"
-#~ msgid_plural "%2 / %1 files"
-#~ msgstr[0] "%2 / %1 datoteka%2 / %1 datoteka"
-
-#~ msgid "Stalled"
-#~ msgstr "Zastalo"
-
-#~ msgid "%1/s ( %2 remaining )"
-#~ msgstr " %1/s ( preostaje %2 )"
-
-#~ msgid "Copy File(s) Progress"
-#~ msgstr "Napredak kopiranja datoteke/a"
-
-#~ msgid "Move File(s) Progress"
-#~ msgstr "Napredak premještanja datoteke/a"
-
-#~ msgid "Delete File(s) Progress"
-#~ msgstr "Napredak brisanja datoteke/a"
-
-#~ msgid "Loading Progress"
-#~ msgstr "Napredak učitavanja"
-
-#~ msgid "Examining File Progress"
-#~ msgstr "Napredak obrade datoteke/a"
-
-#~ msgid "Resuming from %1"
-#~ msgstr "Nastavljam od %1"
-
-#~ msgid "Not resumable"
-#~ msgstr "Ne može se nastaviti"
-
-#~ msgid "%1/s (done)"
-#~ msgstr "%1/s (gotovo)"
-
-#, fuzzy
-#~ msgid "Resume"
-#~ msgstr "&Nastavi"
-
-#~ msgid " Stalled "
-#~ msgstr " Zastalo "
-
-#~ msgid " %1/s "
-#~ msgstr " %1/s "
-
-#~ msgid ""
-#~ "KIO Exec - Opens remote files, watches modifications, asks for upload"
-#~ msgstr ""
-#~ "KIO Exec - Otvara udaljene fajlove, nadgleda promjene, pita za slanje"
-
-#~ msgid "Treat URLs as local files and delete them afterwards"
-#~ msgstr ""
-#~ "Ponašaj se prema URL-ovima kao lokalnim datotekama i obriši ih nakon toga"
-
-#, fuzzy
-#~ msgid "Suggested file name for the downloaded file"
-#~ msgstr "Odaberite drugo ime za novu datoteku."
-
-#~ msgid "Command to execute"
-#~ msgstr "Naredba koju treba izvršiti"
-
-#~ msgid "URL(s) or local file(s) used for 'command'"
-#~ msgstr "URL(i) ili lokalna(e) datoteka(e) koje se koriste za 'naredbu'"
-
-#~ msgid "'command' expected.\n"
-#~ msgstr "očekivana 'naredba'.\n"
-
-#~ msgid ""
-#~ "The URL %1\n"
-#~ "is malformed"
-#~ msgstr ""
-#~ "URL %1\n"
-#~ "nije valjan"
-
-#~ msgid ""
-#~ "Remote URL %1\n"
-#~ "not allowed with --tempfiles switch"
-#~ msgstr ""
-#~ "Udaljeni URL %1\n"
-#~ "nije dozoljeno koristiti sa --tempfiles opcijom"
-
-#~ msgid ""
-#~ "The supposedly temporary file\n"
-#~ "%1\n"
-#~ "has been modified.\n"
-#~ "Do you still want to delete it?"
-#~ msgstr ""
-#~ "Pretpostavljena privremena datoteka \n"
-#~ "%1\n"
-#~ "je izmjenjena. \n"
-#~ "Želite li ju i dalje obrisati?"
-
-#~ msgid "File Changed"
-#~ msgstr "Datoteka mijenjana"
-
-#, fuzzy
-#~ msgid "Do Not Delete"
-#~ msgstr "Nema ništa za brisanje"
-
-#~ msgid ""
-#~ "The file\n"
-#~ "%1\n"
-#~ "has been modified.\n"
-#~ "Do you want to upload the changes?"
-#~ msgstr ""
-#~ "Datoteka \n"
-#~ "%1\n"
-#~ "je izmjenjena. \n"
-#~ "Želite li dignuti izmjene?"
-
-#, fuzzy
-#~ msgid "Upload"
-#~ msgstr "Čitaj"
-
-#~ msgid "KIOExec"
-#~ msgstr "KIOExec"
-
-#~ msgid "s"
-#~ msgstr "s"
-
-#~ msgid "ms"
-#~ msgstr "ms"
-
-#~ msgid "bps"
-#~ msgstr "bps"
-
-#~ msgid "pixels"
-#~ msgstr "pikseli"
-
-#~ msgid "in"
-#~ msgstr "dolazno"
-
-#~ msgid "cm"
-#~ msgstr "cm"
-
-#~ msgid "B"
-#~ msgstr "B5"
-
-#, fuzzy
-#~ msgid "KiB"
-#~ msgstr "KB"
-
-#~ msgid "fps"
-#~ msgstr "fps"
-
-#~ msgid "dpi"
-#~ msgstr "dpi"
-
-#~ msgid "bpp"
-#~ msgstr "bpp"
-
-#~ msgid "Hz"
-#~ msgstr "Hz"
-
-#~ msgid "mm"
-#~ msgstr "mm"
-
-#~ msgid ""
-#~ "List all supported metadata keys of the given file(s). If mimetype is not "
-#~ "specified, the mimetype of the given files is used."
-#~ msgstr ""
-#~ "Popis svih podržanih metadata ključeva za dane datotek(e). Ako mime tip "
-#~ "nije naveden, onda se koriste mime tipovi danih datoteka."
-
-#~ msgid ""
-#~ "List all preferred metadata keys of the given file(s). If mimetype is not "
-#~ "specified, the mimetype of the given files is used."
-#~ msgstr ""
-#~ "Popis svih poželjnih metadata ključeva za dane datoteke. Ako mime tip "
-#~ "nije naveden, koristiti će se mime tipovi danih datoteka."
-
-#~ msgid "Prints all mimetypes for which metadata support is available."
-#~ msgstr "Ispis svih mime tipova za koje su dostupni podržani metadata."
-
-#~ msgid ""
-#~ "Prints the preferred metadata values, available in the given file(s)."
-#~ msgstr ""
-#~ "Ispis svih poželjnih metadata vrijednosti, dostupnih u datim datotekama."
-
-#, fuzzy
-#~ msgid "The group to get values from or set values to"
-#~ msgstr "Grupa za postavljanje ili dohvatanje vrijednosti."
-
-#~ msgid "No support for metadata extraction found."
-#~ msgstr "Nije nađena podrška za iznalaženje metapodataka."
-
-#~ msgid "Supported MimeTypes:"
-#~ msgstr "Podržani MimeTipovi:"
-
-#~ msgid "Password"
-#~ msgstr "Šifra:"
-
-#, fuzzy
-#~ msgid "You need to supply a username and a password"
-#~ msgstr "Unesite vaše korisničko ime i šifru"
-
-#~ msgid "&Password:"
-#~ msgstr "Š&ifra:"
-
-#~ msgid "&Keep password"
-#~ msgstr "Sačuva&j šifru"
-
-#~ msgid "Shredding: pass %1 of 35"
-#~ msgstr "Uništavanje: prolaz %1 od 35"
-
-#~ msgid "Settings..."
-#~ msgstr "Postavke..."
-
-#~ msgid "Configure Network Operation Window"
-#~ msgstr "Postavke prozora za mrežne postupke"
-
-#~ msgid "Show system tray icon"
-#~ msgstr "Prikaži ikonu trake sustava:"
-
-#~ msgid "Keep network operation window always open"
-#~ msgstr "Ostavite Prozor za mrežne operacije uvijek otvorenim"
-
-#~ msgid "Show column headers"
-#~ msgstr "Prikaži naslove stupaca"
-
-#~ msgid "Show statusbar"
-#~ msgstr "Pokaži statusnu traku"
-
-#~ msgid "Column widths are user adjustable"
-#~ msgstr "Širina stupaca je korisnički podesiva"
-
-#~ msgid "Show information:"
-#~ msgstr "Prikaži informacije"
-
-#~ msgid "URL"
-#~ msgstr "URL"
-
-#~ msgid "%"
-#~ msgstr "%"
-
-#~ msgid "Count"
-#~ msgstr "Broj"
-
-#~ msgctxt "Resume"
-#~ msgid "Res."
-#~ msgstr "Nastavi"
-
-#~ msgid "%1/s"
-#~ msgstr "%1/s"
-
-#~ msgid "Creating"
-#~ msgstr "Stvaram"
-
-#, fuzzy
-#~ msgctxt "Remaining Size"
-#~ msgid " Rem. Size: %1 kB "
-#~ msgstr ""
-#~ "_: Remaining Size\n"
-#~ " Preostala veličina : %1 kB "
-
-#~ msgctxt "Remaining Time"
-#~ msgid " Rem. Time: 00:00:00 "
-#~ msgstr " Vrijeme : 00:00:00 "
-
-#~ msgid "KDE Progress Information UI Server"
-#~ msgstr "KDE Progress Information UI poslužitelj"
-
-#~ msgid "Developer"
-#~ msgstr "Programer"
-
-#~ msgid "Clear input field"
-#~ msgstr "Obriši polje za unos"
-
-#~ msgid "Sounds"
-#~ msgstr "Zvukovi"
-
-#~ msgid "Logging"
-#~ msgstr "Pisanje u dnevnik"
-
-#~ msgid "Program Execution"
-#~ msgstr "Izvršenje programa"
-
-#~ msgid "Message Windows"
-#~ msgstr "Prozori s porukama"
-
-#~ msgid "Passive Windows"
-#~ msgstr "Pasivni prozori"
-
-#~ msgid "Standard Error Output"
-#~ msgstr "Uobičajeni izlaz za greške"
-
-#~ msgid "Taskbar"
-#~ msgstr "Traka sa zadacima"
-
-#~ msgid "Execute a program"
-#~ msgstr "Izvrši program"
-
-#~ msgid "Print to Standard error output"
-#~ msgstr "Ispiši na uobičajeni izlaz za greške"
-
-#~ msgid "Display a messagebox"
-#~ msgstr "Prikaži upozorenja"
-
-#~ msgid "Log to a file"
-#~ msgstr "Zapiši u datoteku"
-
-#~ msgid "Play a sound"
-#~ msgstr "Odsviraj zvuk"
-
-#~ msgid "Flash the taskbar entry"
-#~ msgstr "Osvjetli stavku trake sa zadacima"
-
-#~ msgid "Notification Settings"
-#~ msgstr "Postavke obavijesti"
-
-#, fuzzy
-#~ msgid "Advanced <<"
-#~ msgstr "N&apredne postavke"
-
-#~ msgid "Hide advanced options"
-#~ msgstr "Sakrij napredne opcije"
-
-#, fuzzy
-#~ msgid "Advanced >>"
-#~ msgstr "N&apredne postavke"
-
-#~ msgid "Show advanced options"
-#~ msgstr "Prikaži/sakrij napredne odrednice"
-
-#~ msgid "Are You Sure?"
-#~ msgstr "Da li ste sigurni?"
-
-#~ msgid "Select Sound File"
-#~ msgstr "Odabir zvučne datoteke"
-
-#~ msgid "Select Log File"
-#~ msgstr "Izaberite datoteku dnevnika"
-
-#~ msgid "Select File to Execute"
-#~ msgstr "Odabrite ime datoteke za izvođenje."
-
-#, fuzzy
-#~ msgid "The specified file does not exist."
-#~ msgstr "Navedeni direktorij vjerojatno ne postoji."
-
-#~ msgid "No description available"
-#~ msgstr "Opis nije dostupan"
-
-#, fuzzy
-#~ msgid ""
-#~ msgid_plural "Properties for %1 Selected Items"
-#~ msgstr[0] "Svojstva za %2"
-
-#~ msgid ""
-#~ "Add the selected file types to\n"
-#~ "the list of supported file types."
-#~ msgstr ""
-#~ "Dodaj odabrane vrste datoteka u\n"
-#~ "popis podržanih vrsta."
-
-#~ msgid "E&xecute"
-#~ msgstr "I&zvrši"
-
-#~ msgid "Comman&d:"
-#~ msgstr "Nare&dba:"
-
-#~ msgid ""
-#~ "Following the command, you can have several place holders which will be "
-#~ "replaced with the actual values when the actual program is run:\n"
-#~ "%f - a single file name\n"
-#~ "%F - a list of files; use for applications that can open several local "
-#~ "files at once\n"
-#~ "%u - a single URL\n"
-#~ "%U - a list of URLs\n"
-#~ "%d - the folder of the file to open\n"
-#~ "%D - a list of folders\n"
-#~ "%i - the icon\n"
-#~ "%m - the mini-icon\n"
-#~ "%c - the caption"
-#~ msgstr ""
-#~ "Prateći naredbu, možete imati više simbola koji će biti zamijenjeni "
-#~ "stvarnim vrijednostima kad se pokrene program:\n"
-#~ "%f - ime datoteke\n"
-#~ "%F - lista datoteka; koristi se za programe koji mogu otvoriti više "
-#~ "lokalnih datotekaodjednom\n"
-#~ "%u - jedan URL\n"
-#~ "%U - lista URL-ova\n"
-#~ "%d - mapa datoteke za otvaranje\n"
-#~ "%D - lista mapa\n"
-#~ "%i - ikona\n"
-#~ "%m - mini-ikona\n"
-#~ "%c - komentar"
-
-#~ msgid "Panel Embedding"
-#~ msgstr "Ugrađivanje u ploču"
-
-#~ msgid "&Execute on click:"
-#~ msgstr "&Izvrši na klik:"
-
-#~ msgid "&Window title:"
-#~ msgstr "&Naslov prozora:"
-
-#~ msgid "KDE Wallet Wizard"
-#~ msgstr "KDE Wallet čarobnjak"
-
-#~ msgid "Introduction"
-#~ msgstr "Uvod"
-
-#~ msgid "Password Selection"
-#~ msgstr "Odabir lozinke"
-
-#~ msgid "Security Level"
-#~ msgstr "Sigurnosna Razina"
-
-#~ msgid "Events"
-#~ msgstr "Događaji"
-
-#~ msgid "Quick Controls"
-#~ msgstr "Brze kontrole"
-
-#~ msgid "Apply to &all applications"
-#~ msgstr "Primjeni na sve &aplikacije"
-
-#~ msgid "Turn O&ff All"
-#~ msgstr "Isključi s&ve"
-
-#~ msgid "Allows you to change the behavior for all events at once"
-#~ msgstr "Omogućava istovremenu promjenu ponašanja svih događaja"
-
-#~ msgid "Turn O&n All"
-#~ msgstr "Uključi &sve"
-
-#~ msgid "Print a message to standard &error output"
-#~ msgstr "Ispiši poruku na &uobičajeni izlaz za greške"
-
-#~ msgid "Show a &message in a pop-up window"
-#~ msgstr "Prikaži poruku u pop-up pro&zoru"
-
-#~ msgid "E&xecute a program:"
-#~ msgstr "Izvrši prog&ram"
-
-#~ msgid "Play a &sound:"
-#~ msgstr "Sviraj zvuk"
-
-#~ msgid "Test the Sound"
-#~ msgstr "Provjeri zvuk"
-
-#~ msgid "Mark &taskbar entry"
-#~ msgstr "Označi stavku &trake sa zadaćama"
-
-#~ msgid "&Log to a file:"
-#~ msgstr "Zapiši u dnevnik"
-
-#~ msgid "&Use a passive window that does not interrupt other work"
-#~ msgstr "Koristi &pasivni prozor koji ne druge operacije"
-
-#~ msgid "Less Options"
-#~ msgstr "Manje opcija"
-
-#, fuzzy
-#~ msgid "Player Settings"
-#~ msgstr "Postavke..."
-
-#~ msgid "Quick Actions"
-#~ msgstr "Brze Akcije"
-
-#~ msgid "&Details <<"
-#~ msgstr "&Detalji <<"
-
-#~ msgid "&Details >>"
-#~ msgstr "&Detalji >>"
-
-#~ msgid "Connection was to %1 at port %2"
-#~ msgstr "Veza na računalo %1 port %2"
diff -Nru kde-l10n-hr-4.12.97/messages/frameworks/kio_help4.po kde-l10n-hr-4.13.0/messages/frameworks/kio_help4.po
--- kde-l10n-hr-4.12.97/messages/frameworks/kio_help4.po 2014-01-25 21:41:22.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/frameworks/kio_help4.po 1970-01-01 00:00:00.000000000 +0000
@@ -1,114 +0,0 @@
-# Translation of kio_help4 to Croatian
-#
-# Andrej Dundović , 2009.
-msgid ""
-msgstr ""
-"Project-Id-Version: kio_help4 0\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2014-01-24 18:50+0000\n"
-"PO-Revision-Date: 2009-06-21 20:18+0200\n"
-"Last-Translator: Andrej Dundović \n"
-"Language-Team: Croatian \n"
-"Language: hr\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n"
-"%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"X-Generator: Lokalize 0.3\n"
-"X-Environment: kde\n"
-"X-Accelerator-Marker: &\n"
-"X-Text-Markup: kde4\n"
-
-#: xslt.cpp:138
-msgid "Parsing stylesheet"
-msgstr "Raščlanjenje stilskog oblikovanja"
-
-#: xslt.cpp:162
-msgid "Parsing document"
-msgstr "Raščlanjenje dokumenta"
-
-#: xslt.cpp:172
-msgid "Applying stylesheet"
-msgstr "Primjenjivanje stilskog oblikovanja"
-
-#: xslt.cpp:180
-msgid "Writing document"
-msgstr "Zapisivanje dokumenta"
-
-#~ msgid "Output file"
-#~ msgstr "Izlazna datoteka"
-
-#~ msgid "genshortcutents"
-#~ msgstr "genshortcutents"
-
-#~ msgid "Generates DocBook entities for key shortcuts of standard actions"
-#~ msgstr "Generira DocBook stavke za tipkovničke prečice standardnih akcija"
-
-#~ msgid "There is no documentation available for %1."
-#~ msgstr "Za %1 ne postoji raspoloživa dokumentacija."
-
-#~ msgid "Looking up correct file"
-#~ msgstr "Traženje ispravne datoteke"
-
-#~ msgid "Preparing document"
-#~ msgstr "Pripremanje dokumenta"
-
-#~ msgid "The requested help file could not be parsed: %1"
-#~ msgstr "Zahtjevanu datoteku pomoći nije moguće raščlaniti: %1"
-
-#~ msgid "Saving to cache"
-#~ msgstr "Snimanje u međuspremnik"
-
-#~ msgid "Using cached version"
-#~ msgstr "Upotrebljavanje verzije iz međuspremnika"
-
-#~ msgid "Looking up section"
-#~ msgstr "Traženje poglavlja"
-
-#~ msgid "Could not find filename %1 in %2."
-#~ msgstr "Datoteku naziva %1 pri %2 nije moguće pronaći."
-
-#~ msgid "Stylesheet to use"
-#~ msgstr "Odabrano stilsko oblikovanje"
-
-#~ msgid "Output whole document to stdout"
-#~ msgstr "Cjelokupni dokument izvezi u 'stdout'"
-
-#~ msgid "Output whole document to file"
-#~ msgstr "Cjelokupni dokument izvezi u datoteku"
-
-#~ msgid "Create a ht://dig compatible index"
-#~ msgstr "Izradi indeks kompatibilan s ht://dig"
-
-#~ msgid "Check the document for validity"
-#~ msgstr "Provjeri valjanost dokumenta"
-
-#~ msgid "Create a cache file for the document"
-#~ msgstr "Izradi datoteku međuspremnika za dokument"
-
-#~ msgid "Set the srcdir, for kdelibs"
-#~ msgstr "Postavi 'srcdir', za 'kdelibs'"
-
-#~ msgid "Parameters to pass to the stylesheet"
-#~ msgstr "Parametri koje treba proslijediti u stilsko oblikovanje"
-
-#~ msgid "The file to transform"
-#~ msgstr "Datoteka za pretvaranje"
-
-#~ msgid "XML-Translator"
-#~ msgstr "XML prevoditelj"
-
-#~ msgid "KDE Translator for XML"
-#~ msgstr "KDE prevoditelj za XML"
-
-#~ msgid "Could not write to cache file %1."
-#~ msgstr "Zapisivanje u datoteku međuspremnika %1 nije moguće."
-
-#~ msgctxt "NAME OF TRANSLATORS"
-#~ msgid "Your names"
-#~ msgstr "Renato Pavičić, Andrej Dundovic"
-
-#~ msgctxt "EMAIL OF TRANSLATORS"
-#~ msgid "Your emails"
-#~ msgstr "renato@translator-shop.org, adundovi@gmail.com"
diff -Nru kde-l10n-hr-4.12.97/messages/frameworks/ktexteditor5.po kde-l10n-hr-4.13.0/messages/frameworks/ktexteditor5.po
--- kde-l10n-hr-4.12.97/messages/frameworks/ktexteditor5.po 2014-01-25 21:41:22.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/frameworks/ktexteditor5.po 1970-01-01 00:00:00.000000000 +0000
@@ -1,8853 +0,0 @@
-# Translation of katepart4 to Croatian
-#
-# ivan , 2009.
-# Andrej Dundović , 2009, 2010.
-# DoDo , 2009.
-# Andrej Dundovic , 2009, 2010.
-# Marko Dimjasevic , 2010.
-msgid ""
-msgstr ""
-"Project-Id-Version: katepart4 0\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2014-01-25 14:43+0000\n"
-"PO-Revision-Date: 2010-06-06 14:00+0200\n"
-"Last-Translator: Marko Dimjasevic \n"
-"Language-Team: Croatian \n"
-"Language: hr\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n"
-"%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"X-Generator: Lokalize 1.0\n"
-"X-Poedit-Bookmarks: 40,-1,-1,-1,-1,-1,-1,-1,-1,-1\n"
-"X-Environment: kde\n"
-"X-Accelerator-Marker: &\n"
-"X-Text-Markup: kde4\n"
-
-#: completion/katecompletionconfig.cpp:41
-msgid "Code Completion Configuration"
-msgstr "Postavljanje samodovršavanja koda"
-
-#: completion/katecompletionconfig.cpp:115
-#: completion/katecompletionconfig.cpp:144
-msgid "Always"
-msgstr "Uvijek"
-
-#: completion/katecompletionmodel.cpp:172
-msgid "Argument-hints"
-msgstr "Prema argumentima"
-
-#: completion/katecompletionmodel.cpp:173
-msgid "Best matches"
-msgstr "Prema najboljem odabiru"
-
-#: completion/katecompletionmodel.cpp:812
-msgid "Namespaces"
-msgstr "Imenska mjesta (Namespaces)"
-
-#: completion/katecompletionmodel.cpp:814
-msgid "Classes"
-msgstr "Razredi"
-
-#: completion/katecompletionmodel.cpp:816
-msgid "Structs"
-msgstr "Strukture"
-
-#: completion/katecompletionmodel.cpp:818
-msgid "Unions"
-msgstr "Unije"
-
-#: completion/katecompletionmodel.cpp:820
-msgid "Functions"
-msgstr "Funkcije"
-
-#: completion/katecompletionmodel.cpp:822
-msgid "Variables"
-msgstr "&Varijable:"
-
-#: completion/katecompletionmodel.cpp:824
-msgid "Enumerations"
-msgstr "Nabrajanja"
-
-#: completion/katecompletionmodel.cpp:1328
-msgid "Prefix"
-msgstr "Prefiks"
-
-#: completion/katecompletionmodel.cpp:1330
-msgid "Icon"
-msgstr "Ikona"
-
-#: completion/katecompletionmodel.cpp:1332
-msgid "Scope"
-msgstr "Doseg"
-
-#. i18n: ectx: property (text), widget (QTreeWidget, treeWidget)
-#: completion/katecompletionmodel.cpp:1334
-#: dialogs/commandmenuconfigwidget.ui:22 dialogs/katedialogs.cpp:1161
-msgid "Name"
-msgstr "Ime"
-
-#: completion/katecompletionmodel.cpp:1336
-msgid "Arguments"
-msgstr "Argumenti"
-
-#: completion/katecompletionmodel.cpp:1338
-msgid "Postfix"
-msgstr "Postfix"
-
-#: completion/katecompletionmodel.cpp:2043
-msgid "Public"
-msgstr "Javno"
-
-#: completion/katecompletionmodel.cpp:2046
-msgid "Protected"
-msgstr "Zaštićeno"
-
-#: completion/katecompletionmodel.cpp:2049
-msgid "Private"
-msgstr "Privatno"
-
-#: completion/katecompletionmodel.cpp:2052
-msgid "Static"
-msgstr "Statično"
-
-#: completion/katecompletionmodel.cpp:2055
-msgid "Constant"
-msgstr "Konstante"
-
-#: completion/katecompletionmodel.cpp:2058
-msgid "Namespace"
-msgstr "Imensko mjesto (Namespace)"
-
-#: completion/katecompletionmodel.cpp:2061
-msgid "Class"
-msgstr "Razred"
-
-#: completion/katecompletionmodel.cpp:2064
-msgid "Struct"
-msgstr "Struktura"
-
-#: completion/katecompletionmodel.cpp:2067
-msgid "Union"
-msgstr "Unija"
-
-#: completion/katecompletionmodel.cpp:2070
-msgid "Function"
-msgstr "Funkcija"
-
-#: completion/katecompletionmodel.cpp:2073
-msgid "Variable"
-msgstr "Varijabla"
-
-#: completion/katecompletionmodel.cpp:2076
-msgid "Enumeration"
-msgstr "Nabrajanje"
-
-#: completion/katecompletionmodel.cpp:2079
-msgid "Template"
-msgstr "Predložak"
-
-#: completion/katecompletionmodel.cpp:2082
-msgid "Virtual"
-msgstr "Virtualno"
-
-#: completion/katecompletionmodel.cpp:2085
-msgid "Override"
-msgstr "Zaobiđi"
-
-#: completion/katecompletionmodel.cpp:2088
-msgid "Inline"
-msgstr "&Ugrađeno"
-
-#: completion/katecompletionmodel.cpp:2091
-msgid "Friend"
-msgstr "Prijatelj"
-
-#: completion/katecompletionmodel.cpp:2094
-msgid "Signal"
-msgstr "Signal"
-
-#: completion/katecompletionmodel.cpp:2097
-msgid "Slot"
-msgstr "Utor"
-
-#: completion/katecompletionmodel.cpp:2100
-msgid "Local Scope"
-msgstr "&Lokalne doseg"
-
-#: completion/katecompletionmodel.cpp:2103
-msgid "Namespace Scope"
-msgstr "Doseg imenskog mjesta"
-
-#: completion/katecompletionmodel.cpp:2106
-msgid "Global Scope"
-msgstr "Globalni doseg"
-
-#: completion/katecompletionmodel.cpp:2109
-msgid "Unknown Property"
-msgstr "Nepoznato svojstvo"
-
-#. i18n: ectx: property (title), widget (QGroupBox, gbWordCompletion)
-#: completion/katewordcompletion.cpp:92 dialogs/completionconfigtab.ui:28
-msgid "Auto Word Completion"
-msgstr "Automatsko dovršavanje riječi"
-
-#: completion/katewordcompletion.cpp:341
-msgid "Shell Completion"
-msgstr "Dovršavanje u ljusci"
-
-#: completion/katewordcompletion.cpp:346
-msgid "Reuse Word Above"
-msgstr "Ponovno upotrijebi riječ iznad"
-
-#: completion/katewordcompletion.cpp:351
-msgid "Reuse Word Below"
-msgstr "Ponovno upotrijebi riječ ispod"
-
-#. i18n: ectx: Menu (file)
-#: data/katepartui.rc:4
-msgid "&File"
-msgstr "&Datoteka"
-
-#. i18n: ectx: Menu (edit)
-#: data/katepartui.rc:16
-msgid "&Edit"
-msgstr "&Uredi"
-
-#. i18n: ectx: Menu (edit_find_menu)
-#: data/katepartui.rc:35
-msgid "Find Variants"
-msgstr ""
-
-#. i18n: ectx: Menu (edit_matching_bracket)
-#: data/katepartui.rc:43
-#, fuzzy
-#| msgid "Move to Matching Bracket"
-msgid "Matching Bracket"
-msgstr "Pomakni do pripadajuće zagrade"
-
-#. i18n: ectx: Menu (view)
-#: data/katepartui.rc:50
-msgid "&View"
-msgstr "&Prikaz"
-
-#. i18n: ectx: Menu (codefolding)
-#: data/katepartui.rc:68
-msgid "&Code Folding"
-msgstr "&Preklapanje koda"
-
-#. i18n: ectx: Menu (tools)
-#: data/katepartui.rc:91
-msgid "&Tools"
-msgstr "&Alati"
-
-#. i18n: ectx: Menu (wordcompletion)
-#: data/katepartui.rc:104
-msgid "Word Completion"
-msgstr "Dovršavanje riječi"
-
-#. i18n: ectx: Menu (spelling)
-#: data/katepartui.rc:110 spellcheck/spellingmenu.cpp:97
-msgid "Spelling"
-msgstr "Pravopis"
-
-#. i18n: ectx: Menu (settings)
-#: data/katepartui.rc:133
-msgid "&Settings"
-msgstr "&Postavke"
-
-#. i18n: ectx: ToolBar (mainToolBar)
-#: data/katepartui.rc:155
-msgid "Main Toolbar"
-msgstr "Glavna alatna traka"
-
-#. i18n: ectx: property (title), widget (QGroupBox, gbBorders)
-#: dialogs/bordersappearanceconfigwidget.ui:9 dialogs/katedialogs.cpp:768
-msgid "Borders"
-msgstr "Rubovi"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkShowFoldingMarkers)
-#: dialogs/bordersappearanceconfigwidget.ui:15
-#, fuzzy
-#| msgid ""
-#| "If this option is checked, every new view will display marks for code "
-#| "folding, if code folding is available."
-msgid ""
-"If this option is checked, every new view will display marks for folding."
-msgstr ""
-"Ako je ova opcija odabrana, svaki će novi prikaz prikazati oznake za "
-"preklapanje koda, ako je preklapanje koda dostupno. "
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkShowFoldingMarkers)
-#: dialogs/bordersappearanceconfigwidget.ui:18
-#, fuzzy
-#| msgid "Show Folding &Markers"
-msgid "Show &folding markers"
-msgstr "Pokaži oznake preklapanja"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkIconBorder)
-#: dialogs/bordersappearanceconfigwidget.ui:25
-msgid ""
-"If this option is checked, every new view will display an icon border on "
-"the left hand side.
The icon border shows bookmark signs, for instance."
-"
"
-msgstr ""
-"Ako je ova opcija označena, svaki novi prikaz će prikazati obrub za ikone "
-"na lijevoj strani.
Obrub za ikone pokazuje npr. znakove oznaka.
"
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkIconBorder)
-#: dialogs/bordersappearanceconfigwidget.ui:28
-msgid "Show &icon border"
-msgstr "Pokaži rub za &ikone"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkLineNumbers)
-#: dialogs/bordersappearanceconfigwidget.ui:35
-msgid ""
-"If this option is checked, every new view will display line numbers on the "
-"left hand side."
-msgstr ""
-"Ako je ova opcija označena, svaki će novi prikaz prikazati brojeve redaka na "
-"lijevoj strani."
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkLineNumbers)
-#: dialogs/bordersappearanceconfigwidget.ui:38
-msgid "Show &line numbers"
-msgstr "Pokaži brojeve &linija"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkShowLineModification)
-#: dialogs/bordersappearanceconfigwidget.ui:45
-#, fuzzy
-#| msgid ""
-#| "If this option is checked, every new view will display line numbers on "
-#| "the left hand side."
-msgid ""
-"If this option is checked, a small indicator for modified and saved lines is "
-"shown on the left hand side."
-msgstr ""
-"Ako je ova opcija označena, svaki će novi prikaz prikazati brojeve redaka na "
-"lijevoj strani."
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkShowLineModification)
-#: dialogs/bordersappearanceconfigwidget.ui:48
-#, fuzzy
-#| msgid "Show Folding &Markers"
-msgid "Show line modification markers"
-msgstr "Pokaži oznake preklapanja"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkScrollbarMarks)
-#: dialogs/bordersappearanceconfigwidget.ui:55
-msgid ""
-"If this option is checked, every new view will show marks on the vertical "
-"scrollbar.
These marks will show bookmarks, for instance.
"
-msgstr ""
-"Ako je ova opcija označena, svaki novi prikaz će prikazati oznake na "
-"okomitom klizaču.
Te oznake će prikazivati npr. korisničke oznake "
-"(bookmarks).
"
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkScrollbarMarks)
-#: dialogs/bordersappearanceconfigwidget.ui:58
-msgid "Show &scrollbar marks"
-msgstr "Pokaži oznake klizača"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkScrollbarMiniMap)
-#: dialogs/bordersappearanceconfigwidget.ui:65
-#, fuzzy
-#| msgid ""
-#| "If this option is checked, every new view will display line numbers on "
-#| "the left hand side."
-msgid ""
-"If this option is checked, every new view will show a mini map on the "
-"vertical scrollbar."
-msgstr ""
-"Ako je ova opcija označena, svaki će novi prikaz prikazati brojeve redaka na "
-"lijevoj strani."
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkScrollbarMiniMap)
-#: dialogs/bordersappearanceconfigwidget.ui:68
-#, fuzzy
-#| msgid "Show &scrollbar marks"
-msgid "Show scrollbar mini-map"
-msgstr "Pokaži oznake klizača"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkScrollbarMiniMapAll)
-#: dialogs/bordersappearanceconfigwidget.ui:84
-#, fuzzy
-#| msgid ""
-#| "If this option is checked, every new view will display line numbers on "
-#| "the left hand side."
-msgid ""
-"If this option is checked, every new view will show a mini map of the whole "
-"document on the vertical scrollbar."
-msgstr ""
-"Ako je ova opcija označena, svaki će novi prikaz prikazati brojeve redaka na "
-"lijevoj strani."
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkScrollbarMiniMapAll)
-#: dialogs/bordersappearanceconfigwidget.ui:87
-#, fuzzy
-#| msgid "Save the current document"
-msgid "Map the whole document"
-msgstr "Spremi trenutni dokument"
-
-#. i18n: ectx: property (text), widget (QLabel, labelMiniMapWidth)
-#: dialogs/bordersappearanceconfigwidget.ui:97
-#, fuzzy
-msgid "Minimap Width"
-msgstr "&Minimalno podudaranje"
-
-#. i18n: ectx: property (text), widget (QLabel, lblShowScrollbars)
-#: dialogs/bordersappearanceconfigwidget.ui:157
-msgid "Scrollbars visibility:"
-msgstr ""
-
-#. i18n: ectx: property (text), item, widget (QComboBox, cmbShowScrollbars)
-#: dialogs/bordersappearanceconfigwidget.ui:168 dialogs/katedialogs.cpp:772
-msgid "Always On"
-msgstr "Uvijek uključen"
-
-#. i18n: ectx: property (text), item, widget (QComboBox, cmbShowScrollbars)
-#: dialogs/bordersappearanceconfigwidget.ui:173
-msgid "Show When Needed"
-msgstr ""
-
-#. i18n: ectx: property (text), item, widget (QComboBox, cmbShowScrollbars)
-#: dialogs/bordersappearanceconfigwidget.ui:178
-#, fuzzy
-#| msgid "Always On"
-msgid "Always Off"
-msgstr "Uvijek uključen"
-
-#. i18n: ectx: property (whatsThis), widget (QGroupBox, gbSortBookmarks)
-#: dialogs/bordersappearanceconfigwidget.ui:191
-msgid ""
-"Choose how the bookmarks should be ordered in the Bookmarks menu."
-msgstr "Odaberite kako će se oznake poredati u izborniku Oznake ."
-
-#. i18n: ectx: property (title), widget (QGroupBox, gbSortBookmarks)
-#: dialogs/bordersappearanceconfigwidget.ui:194
-msgid "Sort Bookmarks Menu"
-msgstr "Sortiraj izbornik oznaka"
-
-#. i18n: ectx: property (whatsThis), widget (QRadioButton, rbSortBookmarksByCreation)
-#: dialogs/bordersappearanceconfigwidget.ui:200
-msgid ""
-"Each new bookmark will be added to the bottom, independently from where it "
-"is placed in the document."
-msgstr ""
-"Svaka nova oznaka će biti dodana na dno, neovisno o tome gdjeje stavljena u "
-"dokumentu. "
-
-#. i18n: ectx: property (text), widget (QRadioButton, rbSortBookmarksByCreation)
-#: dialogs/bordersappearanceconfigwidget.ui:203
-msgid "By c&reation"
-msgstr "Po &vremenu nastanka"
-
-#. i18n: ectx: property (whatsThis), widget (QRadioButton, rbSortBookmarksByPosition)
-#: dialogs/bordersappearanceconfigwidget.ui:210
-msgid "The bookmarks will be ordered by the line numbers they are placed at."
-msgstr "Oznake će biti poredane po brojevima redaka na koje su postavljene. "
-
-#. i18n: ectx: property (text), widget (QRadioButton, rbSortBookmarksByPosition)
-#: dialogs/bordersappearanceconfigwidget.ui:213
-msgid "By &position"
-msgstr "Po &mjestu"
-
-#. i18n: ectx: property (text), widget (QTreeWidget, treeWidget)
-#. i18n: ectx: property (text), widget (QTableWidget, tblNormalModeMappings)
-#: dialogs/commandmenuconfigwidget.ui:27 dialogs/viinputmodeconfigwidget.ui:78
-msgid "Command"
-msgstr "Naredba"
-
-#. i18n: ectx: property (text), widget (QTreeWidget, treeWidget)
-#: dialogs/commandmenuconfigwidget.ui:32
-msgid "Description"
-msgstr "Opis"
-
-#. i18n: ectx: property (text), widget (QPushButton, btnEditEntry)
-#: dialogs/commandmenuconfigwidget.ui:48
-msgid "Edit Entry..."
-msgstr "Uredi unos…"
-
-#. i18n: ectx: property (text), widget (QPushButton, btnRemoveEntry)
-#: dialogs/commandmenuconfigwidget.ui:58
-msgid "Remove Entry"
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QPushButton, btnAddEntry)
-#: dialogs/commandmenuconfigwidget.ui:78
-msgid "Add Entry..."
-msgstr "Dodaj unos…"
-
-#. i18n: ectx: property (title), widget (QGroupBox, gbNotes)
-#: dialogs/commandmenuconfigwidget.ui:93
-msgid "Further Notes"
-msgstr "Daljnje bilješke"
-
-#. i18n: ectx: property (text), widget (QLabel, lblNotes)
-#: dialogs/commandmenuconfigwidget.ui:108
-msgid ""
-"The entries are accessible through the submenu Commands in the "
-"Tools menu. For faster access it is possible to assign shortcuts"
-"b> in the shortcut configuration page after applying the changes.
"
-msgstr ""
-"Unosi su dostupni kroz podizbornik Naredbe u izborniku Alati"
-"b>. Za brži pristup tim unosima moguće je pridružiti prečac unutar "
-"stranice za podešavanje prečaca nakon primjenjivanja promjena.
"
-
-#. i18n: ectx: property (title), widget (QGroupBox, gbEdit)
-#: dialogs/commandmenueditwidget.ui:12
-msgid "Edit Command"
-msgstr "Uredi naredbu"
-
-#. i18n: ectx: property (text), widget (QLabel, lblCommand)
-#: dialogs/commandmenueditwidget.ui:26
-msgid "&Associated command:"
-msgstr "Pridružene n&aredbe:"
-
-#. i18n: ectx: property (text), widget (QLabel, lblName)
-#: dialogs/commandmenueditwidget.ui:69 dialogs/filetypeconfigwidget.ui:72
-msgid "&Name:"
-msgstr "&Ime:"
-
-#. i18n: ectx: property (toolTip), widget (KIconButton, btnIcon)
-#: dialogs/commandmenueditwidget.ui:87
-msgid "Choose an icon."
-msgstr "Odaberite ikonu."
-
-#. i18n: ectx: property (whatsThis), widget (KIconButton, btnIcon)
-#: dialogs/commandmenueditwidget.ui:90
-msgid "This icon will be displayed in the menu and toolbar.
"
-msgstr "Ova ikona bit će prikazana unutar izbornika i alatne trake.
"
-
-#. i18n: ectx: property (text), widget (QLabel, lblDescription)
-#: dialogs/commandmenueditwidget.ui:102
-#, fuzzy
-#| msgid "&Section:"
-msgid "&Description:"
-msgstr "&Sekcija:"
-
-#. i18n: ectx: property (text), widget (QLabel, lblCategory)
-#: dialogs/commandmenueditwidget.ui:115
-msgid "&Category:"
-msgstr "&Kategorija:"
-
-#. i18n: ectx: property (title), widget (QGroupBox, gbGeneral)
-#. i18n: ectx: property (title), widget (QGroupBox, gbViInputMode)
-#: dialogs/completionconfigtab.ui:12 dialogs/katedialogs.cpp:687
-#: dialogs/katedialogs.cpp:764 dialogs/katedialogs.cpp:935
-#: dialogs/viinputmodeconfigwidget.ui:12
-msgid "General"
-msgstr "Opće"
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkAutoCompletionEnabled)
-#: dialogs/completionconfigtab.ui:18
-#, fuzzy
-msgid "Enable &auto completion"
-msgstr "Iskači s popisom nadopunjavanja"
-
-#. i18n: ectx: property (text), widget (QLabel, label)
-#: dialogs/completionconfigtab.ui:42
-msgid "Minimal word length to complete:"
-msgstr "Minimalna duljina riječi za dovršavanje:"
-
-#. i18n: ectx: property (toolTip), widget (QCheckBox, removeTail)
-#: dialogs/completionconfigtab.ui:67
-msgid "Remove tail of a previous word when completion item chosen from a list"
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QCheckBox, removeTail)
-#: dialogs/completionconfigtab.ui:70
-#, fuzzy
-#| msgid "Re&move trailing spaces"
-msgid "Remove tail on complete"
-msgstr "&Ukloni praznine na kraju retka"
-
-#. i18n: ectx: property (title), widget (QGroupBox, sorting)
-#: dialogs/completionconfigwidget.ui:17
-msgid "Sorting"
-msgstr "Sortiranje"
-
-#. i18n: ectx: property (text), widget (QCheckBox, sortingAlphabetical)
-#: dialogs/completionconfigwidget.ui:37
-msgid "Alphabetical"
-msgstr "Po abecedi"
-
-#. i18n: ectx: property (text), widget (QCheckBox, sortingReverse)
-#: dialogs/completionconfigwidget.ui:44
-msgid "Reverse"
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QCheckBox, sortingCaseSensitive)
-#: dialogs/completionconfigwidget.ui:51
-msgid "Case sensitive"
-msgstr "Osjetljivost na veličinu slova"
-
-#. i18n: ectx: property (text), widget (QCheckBox, sortingInheritanceDepth)
-#: dialogs/completionconfigwidget.ui:58
-msgid "Inheritance depth"
-msgstr "Dubina nasljeđivanja"
-
-#. i18n: ectx: property (text), widget (QLabel, label_2)
-#: dialogs/completionconfigwidget.ui:85
-msgid "Order of Groupings (select a grouping method to configure):"
-msgstr ""
-"Redoslijed grupiranja (odaberite metodu grupiranja koju želite podesiti):"
-
-#. i18n: ectx: property (text), widget (QToolButton, groupingOrderUp)
-#. i18n: ectx: property (text), widget (QToolButton, groupingUp)
-#. i18n: ectx: property (text), widget (QToolButton, columnUp)
-#: dialogs/completionconfigwidget.ui:105 dialogs/completionconfigwidget.ui:242
-#: dialogs/completionconfigwidget.ui:414
-msgid "^"
-msgstr "^"
-
-#. i18n: ectx: property (text), widget (QToolButton, groupingOrderDown)
-#. i18n: ectx: property (text), widget (QToolButton, groupingDown)
-#. i18n: ectx: property (text), widget (QToolButton, columnDown)
-#: dialogs/completionconfigwidget.ui:112 dialogs/completionconfigwidget.ui:249
-#: dialogs/completionconfigwidget.ui:421
-msgid "\\/"
-msgstr "\\/"
-
-#. i18n: ectx: property (title), widget (QGroupBox, filtering)
-#: dialogs/completionconfigwidget.ui:128
-msgid "Filtering"
-msgstr "Filtriranje"
-
-#. i18n: ectx: property (text), widget (QCheckBox, filteringContextMatchOnly)
-#: dialogs/completionconfigwidget.ui:143
-msgid "Suitable context matches only"
-msgstr "Podudaranje samo u odgovarajućem kontekstu"
-
-#. i18n: ectx: property (text), widget (QCheckBox, filteringHideAttributes)
-#: dialogs/completionconfigwidget.ui:150
-msgid "Hide completions with the following attributes:"
-msgstr "Sakrij dopune sa sljedećim atributima:"
-
-#. i18n: ectx: property (text), widget (QLabel, label6)
-#: dialogs/completionconfigwidget.ui:162
-msgid "Maximum inheritance depth:"
-msgstr "Maksimalna dubina nasljeđivanja"
-
-#. i18n: ectx: property (specialValueText), widget (QSpinBox, filteringMaximumInheritanceDepth)
-#: dialogs/completionconfigwidget.ui:172
-msgid "Infinity"
-msgstr "Beskonačno"
-
-#. i18n: ectx: property (title), widget (QGroupBox, grouping)
-#: dialogs/completionconfigwidget.ui:190
-msgid "Grouping"
-msgstr "Grupiranje"
-
-#. i18n: ectx: property (text), widget (QTreeWidget, groupingMethods)
-#: dialogs/completionconfigwidget.ui:209
-msgid "Grouping Method"
-msgstr "Metoda grupiranja"
-
-#. i18n: ectx: property (text), item, widget (QTreeWidget, groupingMethods)
-#: dialogs/completionconfigwidget.ui:214
-msgid "Scope type (local, namespace, global)"
-msgstr "Vrsta dosega (lokalno, imenski prostor, globalno)"
-
-#. i18n: ectx: property (text), item, widget (QTreeWidget, groupingMethods)
-#: dialogs/completionconfigwidget.ui:219
-msgid "Scope (eg. per class)"
-msgstr "Doseg (npr. po klasi)"
-
-#. i18n: ectx: property (text), item, widget (QTreeWidget, groupingMethods)
-#: dialogs/completionconfigwidget.ui:224
-msgid "Access type (public etc.)"
-msgstr "Vrsta pristupa (javni i sl.)"
-
-#. i18n: ectx: property (text), item, widget (QTreeWidget, groupingMethods)
-#: dialogs/completionconfigwidget.ui:229
-msgid "Item type (function etc.)"
-msgstr "Vrsta stavke (funkcija i sl.)"
-
-#. i18n: ectx: property (text), widget (QLabel, label)
-#: dialogs/completionconfigwidget.ui:279
-#, fuzzy
-#| msgid "Footer Properties"
-msgid "Access Grouping Properties"
-msgstr "Svojstva podnožja"
-
-#. i18n: ectx: property (text), widget (QCheckBox, accessConst)
-#: dialogs/completionconfigwidget.ui:286
-msgid "Include const in grouping"
-msgstr "Uključiti konstantu u grupiranje"
-
-#. i18n: ectx: property (text), widget (QCheckBox, accessStatic)
-#: dialogs/completionconfigwidget.ui:293
-msgid "Include static in grouping"
-msgstr "Uključi statičke u grupiranju"
-
-#. i18n: ectx: property (text), widget (QCheckBox, accessSignalSlot)
-#: dialogs/completionconfigwidget.ui:300
-msgid "Include signals and slots in grouping"
-msgstr "Uvrsti signale i priključnice u grupiranje"
-
-#. i18n: ectx: property (text), widget (QLabel, label_3)
-#: dialogs/completionconfigwidget.ui:330
-#, fuzzy
-#| msgid "Footer Properties"
-msgid "Item Grouping properties"
-msgstr "Svojstva podnožja"
-
-#. i18n: ectx: property (text), widget (QCheckBox, itemTemplate)
-#: dialogs/completionconfigwidget.ui:337
-msgid "Include templates in grouping"
-msgstr "Uvrsti predloške u grupiranje"
-
-#. i18n: ectx: property (title), widget (QGroupBox, columnMerging)
-#: dialogs/completionconfigwidget.ui:366
-msgid "Column Merging"
-msgstr "Spajanje stupaca"
-
-#. i18n: ectx: property (text), widget (QTreeWidget, columnMergeTree)
-#: dialogs/completionconfigwidget.ui:391
-msgid "Columns"
-msgstr "Stupci"
-
-#. i18n: ectx: property (text), widget (QTreeWidget, columnMergeTree)
-#: dialogs/completionconfigwidget.ui:396
-msgid "Merged"
-msgstr "Spojeno"
-
-#. i18n: ectx: property (text), widget (QTreeWidget, columnMergeTree)
-#: dialogs/completionconfigwidget.ui:401
-msgid "Shown"
-msgstr "Prikazano"
-
-#. i18n: ectx: property (title), widget (QGroupBox, gbStaticWordWrap)
-#: dialogs/editconfigwidget.ui:12
-msgid "Static Word Wrap"
-msgstr "Statičko prijelom"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkStaticWordWrap)
-#: dialogs/editconfigwidget.ui:18
-msgid ""
-"Automatically start a new line of text when the current line exceeds the "
-"length specified by the Wrap words at: option.
This option does "
-"not wrap existing lines of text - use the Apply Static Word Wrap "
-"option in the Tools menu for that purpose.
If you want lines to "
-"be visually wrapped instead, according to the width of the view, "
-"enable Dynamic Word Wrap in the Appearance config page.
"
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkStaticWordWrap)
-#: dialogs/editconfigwidget.ui:21
-msgid "Enable static &word wrap"
-msgstr "Uključi statičko &prelamanje teksta"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkShowStaticWordWrapMarker)
-#: dialogs/editconfigwidget.ui:28
-msgid ""
-"If this option is checked, a vertical line will be drawn at the word wrap "
-"column as defined in the Editing properties.
Note "
-"that the word wrap marker is only drawn if you use a fixed pitch font.
"
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkShowStaticWordWrapMarker)
-#: dialogs/editconfigwidget.ui:31
-#, fuzzy
-msgid "Show static word wra&p marker (if applicable)"
-msgstr "Pokaži marker statičkog prijeloma (ako je primjenjivo)"
-
-#. i18n: ectx: property (text), widget (QLabel, lblWordWrap)
-#: dialogs/editconfigwidget.ui:43
-#, fuzzy
-#| msgid "Wrap words at:"
-msgid "W&rap words at:"
-msgstr "Prijelom riječi na:"
-
-#. i18n: ectx: property (whatsThis), widget (QSpinBox, sbWordWrap)
-#: dialogs/editconfigwidget.ui:53
-msgid ""
-"If the Word Wrap option is selected this entry determines the length (in "
-"characters) at which the editor will automatically start a new line."
-msgstr ""
-"Ako je odabrano prelamanje riječi onda ovo odeđuje duljinu (broj znakova) na "
-"kojem će uređivač samostalno početi pisati u novi red."
-
-#. i18n: ectx: property (title), widget (QGroupBox, gbMisc)
-#. i18n: ectx: property (title), widget (QGroupBox, cbNavigationMisc)
-#: dialogs/editconfigwidget.ui:87 dialogs/navigationconfigwidget.ui:84
-msgid "Misc"
-msgstr "Preostalo"
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkSmartCopyCut)
-#: dialogs/editconfigwidget.ui:93
-msgid "Copy/Cut the current line if no selection"
-msgstr "Kopiraj/izreži trenutnu liniju ako nema odabranog"
-
-#. i18n: ectx: property (text), widget (QLabel, lblFiletype)
-#: dialogs/filetypeconfigwidget.ui:14
-msgid "&Filetype:"
-msgstr "Vrsta &datoteke:"
-
-#. i18n: ectx: property (whatsThis), widget (KComboBox, cmbFiletypes)
-#: dialogs/filetypeconfigwidget.ui:24
-msgid "Select the filetype you want to change."
-msgstr "Odaberite tip datoteke koji želite promijeniti."
-
-#. i18n: ectx: property (whatsThis), widget (QPushButton, btnNew)
-#: dialogs/filetypeconfigwidget.ui:31
-#, fuzzy
-msgid "Create a new file type."
-msgstr "Spremi trenutni dokument"
-
-#. i18n: ectx: property (text), widget (QPushButton, btnNew)
-#: dialogs/filetypeconfigwidget.ui:34
-msgid "&New"
-msgstr "&Novo"
-
-#. i18n: ectx: property (whatsThis), widget (QPushButton, btnDelete)
-#: dialogs/filetypeconfigwidget.ui:41
-msgid "Delete the current file type."
-msgstr "Izbriši trenutni tip datoteke."
-
-#. i18n: ectx: property (text), widget (QPushButton, btnDelete)
-#: dialogs/filetypeconfigwidget.ui:44 schema/kateschemaconfig.cpp:910
-msgid "&Delete"
-msgstr "O&briši"
-
-#. i18n: ectx: property (title), widget (QGroupBox, gbProperties)
-#: dialogs/filetypeconfigwidget.ui:66 mode/katemodeconfigpage.cpp:268
-msgid "Properties"
-msgstr "Svojstva"
-
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, edtName)
-#: dialogs/filetypeconfigwidget.ui:82
-msgid ""
-"The name of the filetype will be the text of the corresponding menu item."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QLabel, lblSection)
-#: dialogs/filetypeconfigwidget.ui:89
-msgid "&Section:"
-msgstr "&Sekcija:"
-
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, edtSection)
-#: dialogs/filetypeconfigwidget.ui:99
-msgid "The section name is used to organize the file types in menus."
-msgstr ""
-"Ime odjeljenja koje se koristi za organizaciju vrsta datoteka po izbornicima."
-
-#. i18n: ectx: property (text), widget (QLabel, lblVariables)
-#: dialogs/filetypeconfigwidget.ui:106
-#, fuzzy
-msgid "&Variables:"
-msgstr "&varijable:"
-
-#. i18n: ectx: property (whatsThis), widget (VariableLineEdit, edtVariables)
-#: dialogs/filetypeconfigwidget.ui:116
-msgid ""
-"This string allows to configure Kate's settings for the files selected by "
-"this mimetype using Kate variables. Almost any configuration option can be "
-"set, such as highlight, indent-mode, encoding, etc.
For a full list of "
-"known variables, see the manual.
"
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QLabel, lblHl)
-#: dialogs/filetypeconfigwidget.ui:123
-#, fuzzy
-msgid "&Highlighting:"
-msgstr "Osvjetljavanje"
-
-#. i18n: ectx: property (text), widget (QLabel, lblIndenter)
-#: dialogs/filetypeconfigwidget.ui:136
-msgid "&Indentation Mode:"
-msgstr "Način &uvlačenja:"
-
-#. i18n: ectx: property (text), widget (QLabel, lblExtensions)
-#: dialogs/filetypeconfigwidget.ui:149
-msgid "File e&xtensions:"
-msgstr "Nastavci datoteka:"
-
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, edtFileExtensions)
-#: dialogs/filetypeconfigwidget.ui:159
-msgid ""
-"The wildcards mask allows to select files by filename. A typical mask uses "
-"an asterisk and the file extension, for example *.txt; *.text
. "
-"The string is a semicolon-separated list of masks."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QLabel, lblMimeTypes)
-#: dialogs/filetypeconfigwidget.ui:166
-msgid "MIME &types:"
-msgstr "&MIME tipovi:"
-
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, edtMimeTypes)
-#: dialogs/filetypeconfigwidget.ui:181
-msgid ""
-"The mime type mask allows to select files by mimetype. The string is a "
-"semicolon-separated list of mimetypes, for example text/plain; text/"
-"english
."
-msgstr ""
-
-#. i18n: ectx: property (whatsThis), widget (QToolButton, btnMimeTypes)
-#: dialogs/filetypeconfigwidget.ui:188
-msgid "Displays a wizard that helps you easily select mimetypes."
-msgstr "Prikazuje čarobnjaka koji vam pomaže da lakše odaberete MIME vrste."
-
-#. i18n: ectx: property (text), widget (QLabel, lblPriority)
-#: dialogs/filetypeconfigwidget.ui:197
-msgid "P&riority:"
-msgstr "Prio&ritet"
-
-#. i18n: ectx: property (whatsThis), widget (QSpinBox, sbPriority)
-#: dialogs/filetypeconfigwidget.ui:207
-msgid ""
-"Sets priority for this file type. If more than one file type selects the "
-"same file, the one with the highest priority will be used."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QPushButton, btnDownload)
-#: dialogs/filetypeconfigwidget.ui:232
-#, fuzzy
-#| msgid "Highlighting Rules"
-msgid "Download Highlighting Files..."
-msgstr "Osvjetljavanje"
-
-#. i18n: ectx: property (text), widget (QLabel, lblMode)
-#: dialogs/indentationconfigwidget.ui:17
-msgid "Default indentation mode:"
-msgstr "Zadan način uvlačenja:"
-
-#. i18n: ectx: property (whatsThis), widget (KComboBox, cmbMode)
-#: dialogs/indentationconfigwidget.ui:27
-msgid ""
-"This is a list of available indentation modes. The specified indentation "
-"mode will be used for all new documents. Be aware that it is also possible "
-"to set the indentation mode with document variables, modes or a .kateconfig "
-"file."
-msgstr ""
-
-#. i18n: ectx: property (title), widget (QGroupBox, gbIndentationMode)
-#: dialogs/indentationconfigwidget.ui:49
-#, fuzzy
-#| msgid "Indentation"
-msgid "Indent using"
-msgstr "Uvlačenje"
-
-#. i18n: ectx: property (text), widget (QRadioButton, rbIndentWithTabs)
-#: dialogs/indentationconfigwidget.ui:55
-#, fuzzy
-#| msgid "Tabulators"
-msgid "&Tabulators"
-msgstr "Tabulatori"
-
-#. i18n: ectx: property (text), widget (QRadioButton, rbIndentWithSpaces)
-#: dialogs/indentationconfigwidget.ui:62
-#, fuzzy
-#| msgid "&Replace"
-msgid "&Spaces"
-msgstr "&Zamijeni"
-
-#. i18n: ectx: property (text), widget (QLabel, lblIndentWidth)
-#: dialogs/indentationconfigwidget.ui:69
-#, fuzzy
-#| msgid "Indentation width:"
-msgid "&Indentation width:"
-msgstr "Širina uvlačenja:"
-
-#. i18n: ectx: property (text), widget (QRadioButton, rbIndentMixed)
-#: dialogs/indentationconfigwidget.ui:79
-#, fuzzy
-#| msgid "Tabulators"
-msgid "Tabulators &and Spaces"
-msgstr "Tabulatori"
-
-#. i18n: ectx: property (text), widget (QLabel, lblTabWidth)
-#: dialogs/indentationconfigwidget.ui:99
-msgid "Tab wi&dth:"
-msgstr "Širina ta&bulatora:"
-
-#. i18n: ectx: property (whatsThis), widget (QSpinBox, sbIndentWidth)
-#: dialogs/indentationconfigwidget.ui:125
-msgid ""
-"The indentation width is the number of spaces which is used to indent a "
-"line. If the option Insert spaces instead of tabulators in the "
-"section Editing is disabled, a Tab character is inserted if "
-"the indentation is divisible by the tab width."
-msgstr ""
-
-#. i18n: ectx: property (title), widget (QGroupBox, gbProperties)
-#: dialogs/indentationconfigwidget.ui:144
-msgid "Indentation Properties"
-msgstr "Svojstva uvlačenja"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkKeepExtraSpaces)
-#: dialogs/indentationconfigwidget.ui:150
-msgid ""
-"If this option is disabled, changing the indentation level aligns a line to "
-"a multiple of the width specified in Indentation width ."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkKeepExtraSpaces)
-#: dialogs/indentationconfigwidget.ui:153
-#, fuzzy
-#| msgid "&Keep extra spaces"
-msgid "&Keep extra spaces"
-msgstr "Sačuvaj dodatne &razmake"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkIndentPaste)
-#: dialogs/indentationconfigwidget.ui:160
-msgid ""
-"If this option is selected, pasted code from the clipboard is indented. "
-"Triggering the undo -action removes the indentation."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkIndentPaste)
-#: dialogs/indentationconfigwidget.ui:163
-#, fuzzy
-#| msgid "Adjust indentation of code pasted from the clipboard"
-msgid "Adjust indentation of code &pasted from the clipboard"
-msgstr "Prilagodi uvlačenje odlomaka koda zalijepljenog iz odlagališta"
-
-#. i18n: ectx: property (title), widget (QGroupBox, gbKeys)
-#: dialogs/indentationconfigwidget.ui:173
-msgid "Indentation Actions"
-msgstr "Radnje uvlačenja"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkBackspaceUnindents)
-#: dialogs/indentationconfigwidget.ui:179
-msgid ""
-"If this option is selected, the Backspace key decreases the "
-"indentation level if the cursor is located in the leading blank space of a "
-"line."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkBackspaceUnindents)
-#: dialogs/indentationconfigwidget.ui:182
-#, fuzzy
-#| msgid "&Backspace key indents"
-msgid "&Backspace key in leading blank space unindents"
-msgstr "&Backspace tipka uvlači"
-
-#. i18n: ectx: property (text), widget (QLabel, label)
-#: dialogs/indentationconfigwidget.ui:192
-msgid ""
-" \n"
-"Tab key action (if no selection exists) Tab "
-"to align the current line in the current code block like in emacs, make "
-"Tab a shortcut to the action Align .\">More ... "
-"a>
"
-msgstr ""
-
-#. i18n: ectx: property (whatsThis), widget (QRadioButton, rbTabAdvances)
-#: dialogs/indentationconfigwidget.ui:225
-msgid ""
-"If this option is selected, the Tab key always inserts white space so "
-"that the next tab position is reached. If the option Insert spaces "
-"instead of tabulators in the section Editing is enabled, spaces "
-"are inserted; otherwise, a single tabulator is inserted."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QRadioButton, rbTabAdvances)
-#: dialogs/indentationconfigwidget.ui:228
-#, fuzzy
-#| msgid "Always advance to the next tab position"
-msgid "Always advance to the &next tab position"
-msgstr "Uvijek napreduj prema sljedećoj poziciji tabulatora"
-
-#. i18n: ectx: property (whatsThis), widget (QRadioButton, rbTabIndents)
-#: dialogs/indentationconfigwidget.ui:235
-msgid ""
-"If this option is selected, the Tab key always indents the current "
-"line by the number of character positions specified in Indentation width"
-"b>."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QRadioButton, rbTabIndents)
-#: dialogs/indentationconfigwidget.ui:238
-#, fuzzy
-#| msgid "Always increase indentation level"
-msgid "Always increase indentation &level"
-msgstr "Uvijek povećavaj razinu uvlačenja odlomka"
-
-#. i18n: ectx: property (whatsThis), widget (QRadioButton, rbTabSmart)
-#: dialogs/indentationconfigwidget.ui:245
-msgid ""
-"If this option is selected, the Tab key either indents the current "
-"line or advances to the next tab position. If the insertion point is at "
-"or before the first non-space character in the line, or if there is a "
-"selection, the current line is indented by the number of character positions "
-"specified in Indentation width .
If the insertion point is located "
-"after the first non-space character in the line and there is no selection, "
-"white space is inserted so that the next tab position is reached: if the "
-"option Insert spaces instead of tabulators in the section Editing"
-"b> is enabled, spaces are inserted; otherwise, a single tabulator is "
-"inserted."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QRadioButton, rbTabSmart)
-#: dialogs/indentationconfigwidget.ui:248
-#, fuzzy
-#| msgid "Increase indentation level if in leading blank space"
-msgid "Increase indentation level if in l&eading blank space"
-msgstr "Povećaj razinu uvlačenja odlomka ukoliko mu prethodi prazni prostor"
-
-#: dialogs/katedialogs.cpp:225 dialogs/katedialogs.cpp:228
-#, fuzzy
-#| msgid " character"
-#| msgid_plural " characters"
-msgctxt "spinbox special value for 1"
-msgid "1 character"
-msgstr " znak"
-
-#: dialogs/katedialogs.cpp:226 dialogs/katedialogs.cpp:229
-#, fuzzy
-#| msgid " character"
-#| msgid_plural " characters"
-msgctxt "suffix for spinbox >1"
-msgid " characters"
-msgstr " znak"
-
-#: dialogs/katedialogs.cpp:450
-#, fuzzy
-#| msgid "Unable to open %1"
-msgid "Unable to open the config file for reading."
-msgstr "Ne mogu otvoriti %1"
-
-#: dialogs/katedialogs.cpp:450
-#, fuzzy
-#| msgid "Unable to open %1"
-msgid "Unable to open file"
-msgstr "Ne mogu otvoriti %1"
-
-#: dialogs/katedialogs.cpp:666
-#, fuzzy
-#| msgid " character"
-#| msgid_plural " characters"
-msgctxt "suffix for spinbox >1 wrap words at (value is at 20 or larger)"
-msgid " characters"
-msgstr " znak"
-
-#: dialogs/katedialogs.cpp:688
-msgid "Text Navigation"
-msgstr ""
-
-#: dialogs/katedialogs.cpp:689
-msgid "Indentation"
-msgstr "Uvlačenje"
-
-#: dialogs/katedialogs.cpp:690
-#, fuzzy
-msgid "Auto Completion"
-msgstr "Iskači s popisom nadopunjavanja"
-
-#: dialogs/katedialogs.cpp:691 utils/kateglobal.cpp:102
-msgid "Vi Input Mode"
-msgstr "VI način unošenja"
-
-#: dialogs/katedialogs.cpp:692
-msgid "Spellcheck"
-msgstr "Provjera pravopisa"
-
-#: dialogs/katedialogs.cpp:770
-msgid "Off"
-msgstr "Isključi"
-
-#: dialogs/katedialogs.cpp:771
-msgid "Follow Line Numbers"
-msgstr "Prati brojeve linija"
-
-#. i18n: ectx: property (title), widget (QGroupBox, groupBox)
-#: dialogs/katedialogs.cpp:936 dialogs/textareaappearanceconfigwidget.ui:102
-msgid "Advanced"
-msgstr "Napredno"
-
-#: dialogs/katedialogs.cpp:937
-msgid "Modes && Filetypes"
-msgstr "Modovi && tipovi datoteka"
-
-#: dialogs/katedialogs.cpp:991
-msgid ""
-"You did not provide a backup suffix or prefix. Using default suffix: '~'"
-msgstr ""
-"Niste ponudili sufiks ili prefiks u imenu sigurnosne kopije. Koristi se "
-"zadani sufiks: '~'"
-
-#: dialogs/katedialogs.cpp:992
-#, fuzzy
-msgid "No Backup Suffix or Prefix"
-msgstr "Nema nastavka sigurosnog spremanja"
-
-#: dialogs/katedialogs.cpp:1003
-msgid ""
-"Selected directory for swap file storage does not exist. Do you want to "
-"create it?"
-msgstr ""
-
-#: dialogs/katedialogs.cpp:1004
-msgid "Missing Swap File Directory"
-msgstr ""
-
-#: dialogs/katedialogs.cpp:1061
-msgid "KDE Default"
-msgstr "Zadano KDE-om"
-
-#: dialogs/katedialogs.cpp:1149
-msgid "Highlight Download"
-msgstr "Osvjetljavanje skidanja"
-
-#: dialogs/katedialogs.cpp:1156
-msgid "Select the syntax highlighting files you want to update:"
-msgstr ""
-
-#: dialogs/katedialogs.cpp:1161
-msgid "Installed"
-msgstr "Instalirano"
-
-#: dialogs/katedialogs.cpp:1161
-msgid "Latest"
-msgstr "Posljednji"
-
-#: dialogs/katedialogs.cpp:1168
-msgid "Note: New versions are selected automatically."
-msgstr "Primjetite: Nove inačice odabrane su automatski"
-
-#: dialogs/katedialogs.cpp:1175
-msgid "&Install"
-msgstr "&Instaliraj"
-
-#: dialogs/katedialogs.cpp:1218
-msgid ""
-"The list of highlightings could not be found on / retrieved from the server"
-msgstr ""
-
-#: dialogs/katedialogs.cpp:1326
-msgid "&Go to line:"
-msgstr "&Idi na redak:"
-
-#: dialogs/katedialogs.cpp:1332
-msgid "Go"
-msgstr "Kreni"
-
-#: dialogs/katedialogs.cpp:1394
-#, fuzzy
-#| msgid "&Section:"
-msgid "Dictionary:"
-msgstr "&Sekcija:"
-
-#: dialogs/katedialogs.cpp:1442
-#, fuzzy
-msgid "File Was Deleted on Disk"
-msgstr ""
-"Datoteka %1 je izmjenjena (promenjena) na disku od strane drugog programa!\n"
-"\n"
-
-#: dialogs/katedialogs.cpp:1443
-msgid "&Save File As..."
-msgstr "Spremi datoteku &kao…"
-
-#: dialogs/katedialogs.cpp:1445
-msgid "Lets you select a location and save the file again."
-msgstr "Dopušta vam odabiranje lokacije i ponovno spremanje datoteke."
-
-#: dialogs/katedialogs.cpp:1447
-#, fuzzy
-msgid "File Changed on Disk"
-msgstr ""
-"Datoteka %1 je izmjenjena (promenjena) na disku od strane drugog programa!\n"
-"\n"
-
-#: dialogs/katedialogs.cpp:1448 document/katedocument.cpp:3880
-msgid "&Reload File"
-msgstr "&Ponovno učitaj datoteku"
-
-#: dialogs/katedialogs.cpp:1450
-msgid ""
-"Reload the file from disk. If you have unsaved changes, they will be lost."
-msgstr ""
-
-#: dialogs/katedialogs.cpp:1464 document/katedocument.cpp:3878
-msgid "What do you want to do?"
-msgstr "Što želite napraviti?"
-
-#: dialogs/katedialogs.cpp:1475 document/katedocument.cpp:3881
-msgid "&Ignore Changes"
-msgstr ""
-
-#: dialogs/katedialogs.cpp:1476
-msgid "Ignore the changes. You will not be prompted again."
-msgstr "Ignoriraj promjene. Više nećete biti upitani."
-
-#: dialogs/katedialogs.cpp:1482
-msgid ""
-"Do nothing. Next time you focus the file, or try to save it or close it, you "
-"will be prompted again."
-msgstr ""
-
-#: dialogs/katedialogs.cpp:1491
-msgid "Overwrite the disk file with the editor content."
-msgstr "Prepiši datoteku na disku sa sadržajem iz uređivača."
-
-#: dialogs/katedialogs.cpp:1565 swapfile/kateswapdiffcreator.cpp:137
-msgid ""
-"The diff command failed. Please make sure that diff(1) is installed and in "
-"your PATH."
-msgstr ""
-
-#: dialogs/katedialogs.cpp:1567 swapfile/kateswapdiffcreator.cpp:139
-msgid "Error Creating Diff"
-msgstr "Greška pri kreiranju Diff-a"
-
-#: dialogs/katedialogs.cpp:1576 swapfile/kateswapdiffcreator.cpp:147
-msgid "The files are identical."
-msgstr ""
-
-#: dialogs/katedialogs.cpp:1577 dialogs/katedialogs.cpp:1581
-#: swapfile/kateswapdiffcreator.cpp:148
-msgid "Diff Output"
-msgstr "Diff ispis"
-
-#: dialogs/katedialogs.cpp:1580
-#, fuzzy
-#| msgid "Besides white space changes, the files are identical."
-msgid "Ignoring amount of white space changed, the files are identical."
-msgstr "Osim promjena u praznim mjestima, datoteke su identične."
-
-#: dialogs/katedialogs.cpp:1605
-msgid ""
-"Ignoring means that you will not be warned again (unless the disk file "
-"changes once more): if you save the document, you will overwrite the file on "
-"disk; if you do not save then the disk file (if present) is what you have."
-msgstr ""
-
-#: dialogs/katedialogs.cpp:1609
-msgid "You Are on Your Own"
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkIgnoreWhiteSpaces)
-#: dialogs/modonhdwidget.ui:23
-msgid "Ignore white space changes"
-msgstr ""
-
-#. i18n: ectx: property (whatsThis), widget (QPushButton, btnDiff)
-#: dialogs/modonhdwidget.ui:30
-msgid ""
-"Calculates the difference between the editor contents and the disk file "
-"using diff(1)."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QPushButton, btnDiff)
-#: dialogs/modonhdwidget.ui:33
-msgid "&View Difference"
-msgstr "&Prikaži razliku"
-
-#. i18n: ectx: property (title), widget (QGroupBox, gbCursorMovement)
-#: dialogs/navigationconfigwidget.ui:12
-msgid "Text Cursor Movement"
-msgstr "Pomicanje kursora teksta:"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkSmartHome)
-#: dialogs/navigationconfigwidget.ui:18
-#, fuzzy
-msgid ""
-"When selected, pressing the home key will cause the cursor to skip "
-"whitespace and go to the start of a line's text. The same applies for the "
-"end key."
-msgstr ""
-"Kad je odabrano, pritisak na HOME tipku će uzrokovati da kursur preskoči "
-"prazninu i ode na početak teksta linije. "
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkSmartHome)
-#: dialogs/navigationconfigwidget.ui:21
-msgid "Smart ho&me and smart end"
-msgstr "Pa&metni početak i kraj retka"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkPagingMovesCursor)
-#: dialogs/navigationconfigwidget.ui:28
-msgid ""
-"Selects whether the PageUp and PageDown keys should alter the vertical "
-"position of the cursor relative to the top of the view."
-msgstr ""
-"Određuje da li PageUp i PageDown tipke treba da mijenjaju uspravnu poziciju "
-"pokazivača u odnosu na vrh prikaza."
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkPagingMovesCursor)
-#: dialogs/navigationconfigwidget.ui:31
-msgid "&PageUp/PageDown moves cursor"
-msgstr "&PageUp/PageDown pomiče pokazivač"
-
-#. i18n: ectx: property (text), widget (QLabel, lblAutoCenterCursor)
-#: dialogs/navigationconfigwidget.ui:43
-#, fuzzy
-#| msgid "&Autocenter cursor (lines):"
-msgid "&Autocenter cursor:"
-msgstr "&Automatsko centriranje kursora (na redak):"
-
-#. i18n: ectx: property (whatsThis), widget (QSpinBox, sbAutoCenterCursor)
-#: dialogs/navigationconfigwidget.ui:53
-msgid ""
-"Sets the number of lines to maintain visible above and below the cursor when "
-"possible."
-msgstr ""
-"Namješta broj redaka da se zadržava vidljivim iznad i ispod pokazivača kad "
-"je moguće."
-
-#. i18n: ectx: property (specialValueText), widget (QSpinBox, sbAutoCenterCursor)
-#. i18n: ectx: property (specialValueText), widget (QSpinBox, spbSwapFileSync)
-#. i18n: ectx: property (specialValueText), widget (QSpinBox, sbDynamicWordWrapDepth)
-#: dialogs/navigationconfigwidget.ui:56 dialogs/opensaveconfigadvwidget.ui:199
-#: dialogs/textareaappearanceconfigwidget.ui:57
-msgid "Disabled"
-msgstr "Onemogućeno"
-
-#. i18n: ectx: property (suffix), widget (QSpinBox, sbAutoCenterCursor)
-#: dialogs/navigationconfigwidget.ui:59
-#, fuzzy
-#| msgctxt "substituted into the previous message"
-#| msgid "1 line"
-#| msgid_plural "%1 lines"
-msgid " lines"
-msgstr "%1 redak"
-
-#. i18n: ectx: property (text), widget (QLabel, lblTextSelectionMode)
-#: dialogs/navigationconfigwidget.ui:92
-#, fuzzy
-#| msgid "Selection Mode"
-msgid "Text selection mode:"
-msgstr "Način odabira"
-
-#. i18n: ectx: property (text), item, widget (QComboBox, cbTextSelectionMode)
-#: dialogs/navigationconfigwidget.ui:103
-#, fuzzy
-#| msgctxt "@item:intable Text context"
-#| msgid "Normal"
-msgid "Normal"
-msgstr "Normalno"
-
-#. i18n: ectx: property (text), item, widget (QComboBox, cbTextSelectionMode)
-#: dialogs/navigationconfigwidget.ui:108
-#, fuzzy
-#| msgid "P&ersistent"
-msgid "Persistent"
-msgstr "&Postojan"
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkScrollPastEnd)
-#: dialogs/navigationconfigwidget.ui:131
-msgid "Allow scrolling past the end of the document"
-msgstr ""
-
-#. i18n: ectx: property (title), widget (QGroupBox, gbConfigFile)
-#: dialogs/opensaveconfigadvwidget.ui:17
-msgid "Folder Config File"
-msgstr "Datoteka za konfiguraciju mape"
-
-#. i18n: ectx: property (text), widget (QLabel, label)
-#: dialogs/opensaveconfigadvwidget.ui:28
-msgid "Search &depth for config file:"
-msgstr "Traži &dubinu za konfiguracijsku datoteku:"
-
-#. i18n: ectx: property (whatsThis), widget (QGroupBox, gbBackup)
-#: dialogs/opensaveconfigadvwidget.ui:56
-msgid ""
-"
Backing up on save will cause Kate to copy the disk file to '<"
-"prefix><filename><suffix>' before saving changes.
The "
-"suffix defaults to ~ and prefix is empty by default."
-msgstr ""
-
-#. i18n: ectx: property (title), widget (QGroupBox, gbBackup)
-#: dialogs/opensaveconfigadvwidget.ui:59
-msgid "Backup on Save"
-msgstr "Sigurnosno spremanje"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkBackupLocalFiles)
-#: dialogs/opensaveconfigadvwidget.ui:68
-#, fuzzy
-#| msgid "Check this if you want backups of local files when saving"
-msgid ""
-"If this option is enabled, backups for local files will be created when "
-"saving."
-msgstr ""
-"Označite ovo ako želite sigurnosne kopije lokalnih datoteka tijekom "
-"spremanja."
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkBackupLocalFiles)
-#: dialogs/opensaveconfigadvwidget.ui:71
-#, fuzzy
-#| msgid "&Remote files"
-msgid "&Local files"
-msgstr "&udaljene datoteke"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkBackupRemoteFiles)
-#: dialogs/opensaveconfigadvwidget.ui:78
-#, fuzzy
-#| msgid "Check this if you want backups of remote files when saving"
-msgid ""
-"If this option is enabled, backups for remote files will be created when "
-"saving."
-msgstr ""
-"Označite ovo ako želite sigurnosne kopije udaljenih datoteka tijekom "
-"spremanja."
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkBackupRemoteFiles)
-#: dialogs/opensaveconfigadvwidget.ui:81
-msgid "&Remote files"
-msgstr "&udaljene datoteke"
-
-#. i18n: ectx: property (text), widget (QLabel, label_5)
-#: dialogs/opensaveconfigadvwidget.ui:88
-#, fuzzy
-msgid "&Prefix:"
-msgstr "&Sufiks:"
-
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, edtBackupPrefix)
-#: dialogs/opensaveconfigadvwidget.ui:98
-#, fuzzy
-msgid "Enter the prefix to prepend to the backup file names."
-msgstr ""
-"Unesite nastavak koji se dodaje na imena datoteka sigurnosnog spremanja."
-
-#. i18n: ectx: property (text), widget (QLabel, label_6)
-#: dialogs/opensaveconfigadvwidget.ui:105
-msgid "&Suffix:"
-msgstr "&Sufiks:"
-
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, edtBackupSuffix)
-#: dialogs/opensaveconfigadvwidget.ui:115
-#, fuzzy
-#| msgid "Enter the suffix to add to the backup file names"
-msgid "Enter the suffix to append to the backup file names."
-msgstr ""
-"Unesite nastavak koji se dodaje na imena datoteka sigurnosnog spremanja."
-
-#. i18n: ectx: property (title), widget (QGroupBox, gpSwapFileOptions)
-#: dialogs/opensaveconfigadvwidget.ui:131
-msgid "Swap File Options"
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QLabel, lblSwapFileMode)
-#: dialogs/opensaveconfigadvwidget.ui:137
-msgid "Swap file:"
-msgstr ""
-
-#. i18n: ectx: property (text), item, widget (QComboBox, cmbSwapFileMode)
-#: dialogs/opensaveconfigadvwidget.ui:148
-#, fuzzy
-#| msgid "Disabled"
-msgid "Disable"
-msgstr "Onemogućeno"
-
-#. i18n: ectx: property (text), item, widget (QComboBox, cmbSwapFileMode)
-#: dialogs/opensaveconfigadvwidget.ui:153
-msgid "Enable"
-msgstr ""
-
-#. i18n: ectx: property (text), item, widget (QComboBox, cmbSwapFileMode)
-#: dialogs/opensaveconfigadvwidget.ui:158
-msgid "Alternative Directory"
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QLabel, lblSwapDirectory)
-#: dialogs/opensaveconfigadvwidget.ui:166
-msgid "Directory"
-msgstr ""
-
-#. i18n: ectx: property (placeholderText), widget (KUrlRequester, kurlSwapDirectory)
-#: dialogs/opensaveconfigadvwidget.ui:182
-msgid "Directory for swp files"
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QLabel, lblSwapFileSync)
-#: dialogs/opensaveconfigadvwidget.ui:189
-msgid "Sync every:"
-msgstr ""
-
-#. i18n: ectx: property (suffix), widget (QSpinBox, spbSwapFileSync)
-#: dialogs/opensaveconfigadvwidget.ui:202
-#, fuzzy
-#| msgctxt "Language"
-#| msgid "Bash"
-msgid "s"
-msgstr "Bash"
-
-#. i18n: ectx: property (text), widget (QLabel, label_2)
-#: dialogs/opensaveconfigadvwidget.ui:221
-msgid ""
-"Be aware, that disabling the swap file synchronization may lead to data loss "
-"in case of a system crash."
-msgstr ""
-
-#. i18n: ectx: property (title), widget (QGroupBox, gbFileFormat)
-#: dialogs/opensaveconfigwidget.ui:12
-msgid "File Format"
-msgstr "Format datoteka"
-
-#. i18n: ectx: property (text), widget (QLabel, lblEncoding)
-#: dialogs/opensaveconfigwidget.ui:23
-msgid "&Encoding:"
-msgstr "&Kodiranje:"
-
-#. i18n: ectx: property (whatsThis), widget (KComboBox, cmbEncoding)
-#: dialogs/opensaveconfigwidget.ui:33
-msgid ""
-"This defines the standard encoding to use to open/save files, if not changed "
-"in the open/save dialog or by using a command line option."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QLabel, lblEncodingDetection)
-#: dialogs/opensaveconfigwidget.ui:40
-#, fuzzy
-#| msgid "Encoding auto&detection:"
-msgid "&Encoding Detection:"
-msgstr "Auto&matsko otkrivanje uznačivanja:"
-
-#. i18n: ectx: property (whatsThis), widget (KComboBox, cmbEncodingDetection)
-#: dialogs/opensaveconfigwidget.ui:50
-msgid ""
-"if neither the encoding chosen as standard above, nor the encoding specified "
-"in the open/save dialog, nor the encoding specified on command line match "
-"the content of the file, this detection will be run."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QLabel, lblEncodingDetection2)
-#: dialogs/opensaveconfigwidget.ui:57
-#, fuzzy
-#| msgid "&Encoding:"
-msgid "&Fallback Encoding:"
-msgstr "&Kodiranje:"
-
-#. i18n: ectx: property (whatsThis), widget (KComboBox, cmbEncodingFallback)
-#: dialogs/opensaveconfigwidget.ui:67
-msgid ""
-"This defines the fallback encoding to try for opening files if neither the "
-"encoding chosen as standard above, nor the encoding specified in the open/"
-"save dialog, nor the encoding specified on command line match the content of "
-"the file. Before this is used, an attempt will be made to determine the "
-"encoding to use by looking for a byte order marker at start of file: if one "
-"is found, the right unicode encoding will be chosen; otherwise encoding "
-"detection will run, if both fail fallback encoding will be tried."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QLabel, lblEOL)
-#: dialogs/opensaveconfigwidget.ui:74
-msgid "E&nd of line:"
-msgstr "&Kraj retka:"
-
-#. i18n: ectx: property (text), item, widget (KComboBox, cmbEOL)
-#: dialogs/opensaveconfigwidget.ui:85
-msgid "UNIX"
-msgstr "UNIX"
-
-#. i18n: ectx: property (text), item, widget (KComboBox, cmbEOL)
-#: dialogs/opensaveconfigwidget.ui:90
-#, fuzzy
-msgid "DOS/Windows"
-msgstr "Dos/Windows"
-
-#. i18n: ectx: property (text), item, widget (KComboBox, cmbEOL)
-#: dialogs/opensaveconfigwidget.ui:95
-msgid "Macintosh"
-msgstr "Macintosh"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkDetectEOL)
-#: dialogs/opensaveconfigwidget.ui:105
-msgid ""
-"If this option is enabled the editor will autodetect the end of line type. "
-"The first found end of line type will be used for the whole file."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkDetectEOL)
-#: dialogs/opensaveconfigwidget.ui:108
-#, fuzzy
-msgid "A&utomatic end of line detection"
-msgstr "Automatsko uvlačenje"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkEnableBOM)
-#: dialogs/opensaveconfigwidget.ui:115
-msgid ""
-"The byte order mark is a special sequence at the beginning of unicode "
-"encoded documents. It helps editors to open text documents with the correct "
-"unicode encoding. The byte order mark is not visible in the displayed "
-"document."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkEnableBOM)
-#: dialogs/opensaveconfigwidget.ui:118
-msgid "Enable byte order marker"
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QLabel, label)
-#: dialogs/opensaveconfigwidget.ui:125
-msgid "Line Length Limit:"
-msgstr ""
-
-#. i18n: ectx: property (specialValueText), widget (QSpinBox, lineLengthLimit)
-#: dialogs/opensaveconfigwidget.ui:135
-#, fuzzy
-msgid "Unlimited"
-msgstr "Neograničeno"
-
-#. i18n: ectx: property (title), widget (QGroupBox, gbCleanups)
-#: dialogs/opensaveconfigwidget.ui:151
-#, fuzzy
-#| msgid "Automatic Cleanups on Load/Save"
-msgid "Automatic Cleanups on Save"
-msgstr "Automatsko čiščenje prilikom učitavanja/snimanja"
-
-#. i18n: ectx: property (whatsThis), widget (QLabel, lblRemoveTrailingSpaces)
-#. i18n: ectx: property (whatsThis), widget (QComboBox, cbRemoveTrailingSpaces)
-#: dialogs/opensaveconfigwidget.ui:159 dialogs/opensaveconfigwidget.ui:172
-msgid ""
-"Depending on the choice, trailing spaces are removed when saving a document, "
-"either in the entire document or only of modified lines."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QLabel, lblRemoveTrailingSpaces)
-#: dialogs/opensaveconfigwidget.ui:162
-#, fuzzy
-#| msgid "Re&move trailing spaces"
-msgid "Re&move trailing spaces:"
-msgstr "&Ukloni praznine na kraju retka"
-
-#. i18n: ectx: property (text), item, widget (QComboBox, cbRemoveTrailingSpaces)
-#: dialogs/opensaveconfigwidget.ui:176
-msgid "Never"
-msgstr ""
-
-#. i18n: ectx: property (text), item, widget (QComboBox, cbRemoveTrailingSpaces)
-#: dialogs/opensaveconfigwidget.ui:181
-#, fuzzy
-#| msgid "&End of Line"
-msgid "On Modified Lines"
-msgstr "&Idi na kraj retka"
-
-#. i18n: ectx: property (text), item, widget (QComboBox, cbRemoveTrailingSpaces)
-#: dialogs/opensaveconfigwidget.ui:186
-#, fuzzy
-#| msgid "&Word Wrap Document"
-msgid "In Entire Document"
-msgstr "&dokument s prijelomom teksta"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkNewLineAtEof)
-#: dialogs/opensaveconfigwidget.ui:209
-msgid ""
-"On save, a line break is appended to the document if not already present. "
-"The line break is visible after reloading the file."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkNewLineAtEof)
-#: dialogs/opensaveconfigwidget.ui:212
-msgid "Append newline at end of file on save"
-msgstr ""
-
-#. i18n: ectx: property (whatsThis), widget (QGroupBox, gbWordWrap)
-#: dialogs/textareaappearanceconfigwidget.ui:9 view/kateview.cpp:520
-msgid ""
-"If this option is checked, the text lines will be wrapped at the view border "
-"on the screen."
-msgstr ""
-"Ako je ova opcija odabrana, reci teksta bit će omotani na rubu vidljivog "
-"dijela ekrana. "
-
-#. i18n: ectx: property (title), widget (QGroupBox, gbWordWrap)
-#: dialogs/textareaappearanceconfigwidget.ui:12 view/kateview.cpp:517
-msgid "&Dynamic Word Wrap"
-msgstr "Dinamičko omatanje riječi"
-
-#. i18n: ectx: property (text), widget (QLabel, lblDynamicWordWrapIndicators)
-#: dialogs/textareaappearanceconfigwidget.ui:21
-msgid "Dynamic &word wrap indicators (if applicable):"
-msgstr "Indikatori dinamičkog omatanja teksta (ako je dostupno):"
-
-#. i18n: ectx: property (whatsThis), widget (KComboBox, cmbDynamicWordWrapIndicator)
-#: dialogs/textareaappearanceconfigwidget.ui:31
-msgid "Choose when the Dynamic Word Wrap Indicators should be displayed."
-msgstr "Odaberite kad se dinamički indikatori omatanja riječi trebaju pokazati"
-
-#. i18n: ectx: property (text), widget (QLabel, lblDynamicWordWrapIndicators_2)
-#: dialogs/textareaappearanceconfigwidget.ui:38
-msgid "Align dynamically wrapped lines to indentation depth:"
-msgstr "Poravnaj dinamički prelomljene retke na dubinu uvlačenja:"
-
-#. i18n: ectx: property (whatsThis), widget (QSpinBox, sbDynamicWordWrapDepth)
-#: dialogs/textareaappearanceconfigwidget.ui:54
-#, no-c-format
-msgid ""
-"
Enables the start of dynamically wrapped lines to be aligned vertically "
-"to the indentation level of the first line. This can help to make code and "
-"markup more readable.
Additionally, this allows you to set a maximum "
-"width of the screen, as a percentage, after which dynamically wrapped lines "
-"will no longer be vertically aligned. For example, at 50%, lines whose "
-"indentation levels are deeper than 50% of the width of the screen will not "
-"have vertical alignment applied to subsequent wrapped lines.
"
-msgstr ""
-"Omogućuje okomito poravnavanje početka dinamičko prelomljenih riječi "
-"prema prvoj liniji. Ovo može učitinti kod čitljivijim.
Dodatno, ovo "
-"omogućuje postavljanje najveće širine zaslona, u postocima, nakon koje "
-"dinamično poravnate linije više neće biti okomito poravnate. Na primjer, na "
-"50%, linije čije uvlačenje je veće od 50% širine zaslona neće biti okomito "
-"poravnate.
"
-
-#. i18n: ectx: property (suffix), widget (QSpinBox, sbDynamicWordWrapDepth)
-#: dialogs/textareaappearanceconfigwidget.ui:60
-#, no-c-format
-msgid "% of View Width"
-msgstr "% od vidljive širine"
-
-#. i18n: ectx: property (title), widget (QGroupBox, gbWhitespaceHighlighting)
-#: dialogs/textareaappearanceconfigwidget.ui:76
-#, fuzzy
-#| msgid "Highlighting"
-msgid "Whitespace Highlighting"
-msgstr "Osvjetljavanje"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkShowTabs)
-#: dialogs/textareaappearanceconfigwidget.ui:82
-msgid ""
-"The editor will display a symbol to indicate the presence of a tab in the "
-"text."
-msgstr "Uređivač će pokazati simbol koji označava tabulator u tekstu."
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkShowTabs)
-#: dialogs/textareaappearanceconfigwidget.ui:85
-#, fuzzy
-msgid "&Highlight tabulators"
-msgstr "Osvjetljavanje"
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkShowSpaces)
-#: dialogs/textareaappearanceconfigwidget.ui:92
-#, fuzzy
-#| msgid "Highlighting Rules"
-msgid "Highlight trailing &spaces"
-msgstr "Osvjetljavanje"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkShowIndentationLines)
-#: dialogs/textareaappearanceconfigwidget.ui:108
-msgid ""
-"If this is enabled, the editor will display vertical lines to help identify "
-"indent lines."
-msgstr ""
-"Ako je ova opcija označena, uređivač će prikazivati okomite retke za pomoć "
-"određivanja uvučenih redaka."
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkShowIndentationLines)
-#: dialogs/textareaappearanceconfigwidget.ui:111
-msgid "Show i&ndentation lines"
-msgstr "Prikaži &uvučene retke"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkShowWholeBracketExpression)
-#: dialogs/textareaappearanceconfigwidget.ui:118
-msgid ""
-"If this is enabled, the range between the selected matching brackets will be "
-"highlighted."
-msgstr ""
-"Ako je ovo omogućeno, dio teksta izmežu odabranih odgovarajućih zagrada će "
-"biti naglašen."
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkShowWholeBracketExpression)
-#: dialogs/textareaappearanceconfigwidget.ui:121
-msgid "Highlight range between selected brackets"
-msgstr "Naglasi dio teksta između odabranih zagrada"
-
-#. i18n: ectx: property (toolTip), widget (QCheckBox, chkAnimateBracketMatching)
-#: dialogs/textareaappearanceconfigwidget.ui:128
-#, fuzzy
-#| msgid "Select to Matching Bracket"
-msgid "Flash matching brackets"
-msgstr "Označi do pripadajuće zagrade"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkAnimateBracketMatching)
-#: dialogs/textareaappearanceconfigwidget.ui:131
-msgid ""
-"If this is enabled, matching brackets are animated for better visibility."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkAnimateBracketMatching)
-#: dialogs/textareaappearanceconfigwidget.ui:134
-#, fuzzy
-msgid "Animate bracket matching"
-msgstr "&Minimalno podudaranje"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkViInputModeDefault)
-#: dialogs/viinputmodeconfigwidget.ui:18
-msgid ""
-"When selected, the vi input mode will be enabled when opening a new view. "
-"You can still toggle the vi input mode on/off for a particular view in the "
-"Edit menu."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkViInputModeDefault)
-#: dialogs/viinputmodeconfigwidget.ui:21
-msgid "Use Vi input mode"
-msgstr "Koristi Vi način unosa"
-
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkViCommandsOverride)
-#: dialogs/viinputmodeconfigwidget.ui:28
-msgid ""
-"When selected, vi commands will override Kate's built-in commands. For "
-"example: Ctrl+R will redo, and override the standard action (showing the "
-"search and replace dialog)."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QCheckBox, chkViCommandsOverride)
-#: dialogs/viinputmodeconfigwidget.ui:31
-msgid "Let Vi commands override Kate shortcuts"
-msgstr ""
-
-#. i18n: ectx: property (whatsThis), widget (QGroupBox, groupBox)
-#: dialogs/viinputmodeconfigwidget.ui:46
-msgid ""
-"Key mapping is used to change the meaning of typed keys. This allows you to "
-"move commands to other keys or make special keypresses for doing a series of "
-"commands.\n"
-"\n"
-"Example:\n"
-"\"\" → \"I-- \"\n"
-"\n"
-"This will prepend \"-- \" to a line when pressing F2."
-msgstr ""
-
-#. i18n: ectx: property (title), widget (QGroupBox, groupBox)
-#: dialogs/viinputmodeconfigwidget.ui:49
-msgid "Key Mapping"
-msgstr ""
-
-#. i18n: ectx: attribute (title), widget (QWidget, tab)
-#: dialogs/viinputmodeconfigwidget.ui:59
-#, fuzzy
-#| msgid "Normal Text"
-msgid "Normal mode"
-msgstr "Normalni tekst"
-
-#. i18n: ectx: property (text), widget (QTableWidget, tblNormalModeMappings)
-#: dialogs/viinputmodeconfigwidget.ui:83
-msgid "Replacement"
-msgstr "Zamjena"
-
-#. i18n: ectx: property (text), widget (QTableWidget, tblNormalModeMappings)
-#: dialogs/viinputmodeconfigwidget.ui:88
-msgid "Recursive?"
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QPushButton, btnRemoveSelectedNormal)
-#: dialogs/viinputmodeconfigwidget.ui:98
-msgid "Remove selected"
-msgstr "Ukloni odabrano"
-
-#. i18n: ectx: property (text), widget (QPushButton, btnAddNewNormal)
-#: dialogs/viinputmodeconfigwidget.ui:105
-msgid "Add new mapping"
-msgstr ""
-
-#. i18n: ectx: property (toolTip), widget (QPushButton, btnImportNormal)
-#: dialogs/viinputmodeconfigwidget.ui:112
-msgid ""
-"Read a vimrc file and attempt to import mappings specified with the \"[n]"
-"noremap\" command."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QPushButton, btnImportNormal)
-#: dialogs/viinputmodeconfigwidget.ui:115
-msgid "Import from vimrc file"
-msgstr ""
-
-#: document/katebuffer.cpp:182
-#, fuzzy
-#| msgid "New Filetype"
-msgctxt "short translation, user created new file"
-msgid "New file"
-msgstr "Nova vrsta datoteke"
-
-#: document/katebuffer.cpp:190
-#, kde-format
-msgid "The file %1 does not exist."
-msgstr ""
-
-#: document/katedocument.cpp:1999
-#, fuzzy, kde-format
-msgid ""
-"The file %1 could not be loaded, as it was not possible to read from it. Check if you have read access to this file."
-msgstr ""
-"Datoteka %1 nije mogla biti učitana, pošto ju je nemoguće čitati!\n"
-"\n"
-"Provjerite da li imate pravo čitanja za ovu datoteku."
-
-#: document/katedocument.cpp:2002
-msgctxt "translators: you can also translate 'Try Again' with 'Reload'"
-msgid "Try Again"
-msgstr ""
-
-#: document/katedocument.cpp:2005 document/katedocument.cpp:5590
-msgid "&Close"
-msgstr ""
-
-#: document/katedocument.cpp:2006 document/katedocument.cpp:5591
-msgid "Close message"
-msgstr ""
-
-#: document/katedocument.cpp:2017
-#, fuzzy, kde-format
-msgid ""
-"The file %1 could not be loaded, as it was not possible to read from it.\n"
-"\n"
-"Check if you have read access to this file."
-msgstr ""
-"Datoteka %1 nije mogla biti učitana, pošto ju je nemoguće čitati!\n"
-"\n"
-"Provjerite da li imate pravo čitanja za ovu datoteku."
-
-#: document/katedocument.cpp:2137
-#, kde-format
-msgid ""
-"The file %1 was opened with %2 encoding but contained invalid characters."
-" It is set to read-only mode, as saving might destroy its content. Either reopen the file with the correct encoding chosen or enable the read-"
-"write mode again in the menu to be able to edit it."
-msgstr ""
-
-#: document/katedocument.cpp:2147
-#, kde-format
-msgid ""
-"The file %1 was opened with %2 encoding but contained invalid characters. It "
-"is set to read-only mode, as saving might destroy its content. Either reopen "
-"the file with the correct encoding chosen or enable the read-write mode "
-"again in the menu to be able to edit it."
-msgstr ""
-
-#: document/katedocument.cpp:2158
-#, kde-format
-msgid ""
-"The file %1 was opened and contained lines longer than the configured Line "
-"Length Limit (%2 characters). The longest of those lines was %3 "
-"characters long Those lines were wrapped and the document is set to read-"
-"only mode, as saving will modify its content."
-msgstr ""
-
-#: document/katedocument.cpp:2163
-msgid "Temporarily raise limit and reload file"
-msgstr ""
-
-#: document/katedocument.cpp:2166
-msgid "Close"
-msgstr ""
-
-#: document/katedocument.cpp:2172
-#, kde-format
-msgid ""
-"The file %1 was opened and contained lines longer than the configured Line "
-"Length Limit (%2 characters). The longest of those lines was %3 "
-"characters long Those lines were wrapped and the document is set to read-"
-"only mode, as saving will modify its content."
-msgstr ""
-
-#: document/katedocument.cpp:2194
-msgid ""
-"Do you really want to save this unmodified file? You could overwrite changed "
-"data in the file on disk."
-msgstr ""
-"Da li zaista želite da snimite ovaj neizmjenjen fajl? Možete prepisati "
-"izmjenjene podatke u fajlu na disku."
-
-#: document/katedocument.cpp:2194
-msgid "Trying to Save Unmodified File"
-msgstr ""
-
-#: document/katedocument.cpp:2194 document/katedocument.cpp:2199
-#: document/katedocument.cpp:2211
-msgid "Save Nevertheless"
-msgstr "Spremi bez obzira"
-
-#: document/katedocument.cpp:2199
-msgid ""
-"Do you really want to save this file? Both your open file and the file on "
-"disk were changed. There could be some data lost."
-msgstr ""
-"Da li zaista želite da snimite ovaj fajl? I vaš otvoreni fajl i fajl na "
-"disku su izmjenjeni, može doći do gubitka djela podataka."
-
-#: document/katedocument.cpp:2199 document/katedocument.cpp:2211
-#: document/katedocument.cpp:2453
-msgid "Possible Data Loss"
-msgstr ""
-
-#: document/katedocument.cpp:2211
-#, fuzzy
-msgid ""
-"The selected encoding cannot encode every unicode character in this "
-"document. Do you really want to save it? There could be some data lost."
-msgstr ""
-"Dokument nije mogao biti spremljen jer odabrano kodiranje ne može kodirati "
-"svaki unicode znak u njemu! Ako niste sigurni koje kodiranje bi trebali "
-"koristiti, pokušajte sa UTF-8 ili UTF-16."
-
-#: document/katedocument.cpp:2278
-#, kde-format
-msgid ""
-"For file %1 no backup copy could be created before saving. If an error "
-"occurs while saving, you might lose the data of this file. A reason could be "
-"that the media you write to is full or the directory of the file is read-"
-"only for you."
-msgstr ""
-
-#: document/katedocument.cpp:2281
-msgid "Failed to create backup copy."
-msgstr "Stvaranje sigurnosne kopije nije uspjelo."
-
-#: document/katedocument.cpp:2282
-msgid "Try to Save Nevertheless"
-msgstr "Pokušaj spremiti unatoč tome"
-
-#: document/katedocument.cpp:2321 document/katedocument.cpp:4003
-#, fuzzy, kde-format
-msgid ""
-"The document could not be saved, as it was not possible to write to %1.\n"
-"\n"
-"Check that you have write access to this file or that enough disk space is "
-"available."
-msgstr ""
-"Dokument nije mogao biti snimljen, pošto je nemoguće pisati u %1!\n"
-"\n"
-"Provjerite da li imate pravo upisa u ovaj fajl ili da li ima dovoljno "
-"praznog prostora na disku."
-
-#: document/katedocument.cpp:2452
-msgid "Do you really want to continue to close this file? Data loss may occur."
-msgstr ""
-"Da li zaista želite da nastavite za zatvaranjem ovog fajla? Ovo može "
-"prouzrokovati gubitak podataka."
-
-#: document/katedocument.cpp:2453
-msgid "Close Nevertheless"
-msgstr "Zatvori unatoč tome"
-
-#: document/katedocument.cpp:3770
-#, fuzzy
-msgid "Untitled"
-msgstr "Neograničeno"
-
-#: document/katedocument.cpp:3806 document/katedocument.cpp:3971
-#: document/katedocument.cpp:4626
-msgid "Save File"
-msgstr "Spremi datoteku"
-
-#: document/katedocument.cpp:3813
-msgid "Save failed"
-msgstr "Spremanje nije uspjelo"
-
-#: document/katedocument.cpp:3879
-#, fuzzy
-msgid "File Was Changed on Disk"
-msgstr ""
-"Datoteka %1 je izmjenjena (promenjena) na disku od strane drugog programa!\n"
-"\n"
-
-#: document/katedocument.cpp:3987
-#, fuzzy
-#| msgid "Save File"
-msgid "Save Copy of File"
-msgstr "Spremi datoteku"
-
-#: document/katedocument.cpp:4218
-msgid ""
-"Using deprecated modeline 'remove-trailing-space'. Please replace with "
-"'remove-trailing-spaces modified;', see http://docs.kde.org/stable/en/kde-"
-"baseapps/kate/config-variables.html#variable-remove-trailing-spaces"
-msgstr ""
-
-#: document/katedocument.cpp:4223
-msgid ""
-"Using deprecated modeline 'replace-trailing-space-save'. Please replace with "
-"'remove-trailing-spaces all;', see http://docs.kde.org/stable/en/kde-"
-"baseapps/kate/config-variables.html#variable-remove-trailing-spaces"
-msgstr ""
-
-#: document/katedocument.cpp:4501
-#, fuzzy, kde-format
-msgid "The file '%1' was modified by another program."
-msgstr ""
-"Datoteka %1 je izmjenjena (obrisana) na disku od strane drugog programa!\n"
-"\n"
-
-#: document/katedocument.cpp:4504
-#, fuzzy, kde-format
-msgid "The file '%1' was created by another program."
-msgstr ""
-"Datoteka %1 je izmjenjena (obrisana) na disku od strane drugog programa!\n"
-"\n"
-
-#: document/katedocument.cpp:4507
-#, fuzzy, kde-format
-msgid "The file '%1' was deleted by another program."
-msgstr ""
-"Datoteka %1 je izmjenjena (obrisana) na disku od strane drugog programa!\n"
-"\n"
-
-#: document/katedocument.cpp:4654
-#, kde-format
-msgid ""
-"A file named \"%1\" already exists. Are you sure you want to overwrite it?"
-msgstr ""
-"Datoteka sa imenom \"%1\" već postoji. Jeste li sigurni da ju želite "
-"prepisati?"
-
-#: document/katedocument.cpp:4656
-msgid "Overwrite File?"
-msgstr "Prepiši datoteku?"
-
-#: document/katedocument.cpp:4864
-#, kde-format
-msgid ""
-"The document \"%1\" has been modified.\n"
-"Do you want to save your changes or discard them?"
-msgstr ""
-"Datoteka \"%1\" je izmijenjena.\n"
-"Želite li sačuvati ili odbaciti promjene?"
-
-#: document/katedocument.cpp:4866
-#, fuzzy
-#| msgid "&Word Wrap Document"
-msgid "Close Document"
-msgstr "&dokument s prijelomom teksta"
-
-#: document/katedocument.cpp:4999
-#, kde-format
-msgid "The file %2 is still loading."
-msgstr ""
-
-#: document/katedocument.cpp:5006
-msgid "&Abort Loading"
-msgstr ""
-
-#: export/exporter.cpp:64
-#, fuzzy
-msgid "Export File as HTML"
-msgstr "Izvezi datoteku kao "
-
-#: mode/katemodeconfigpage.cpp:60
-msgid ""
-msgstr ""
-
-#: mode/katemodeconfigpage.cpp:71
-msgid "Use Default"
-msgstr "Koristi uobičajeno"
-
-#: mode/katemodeconfigpage.cpp:184
-msgid "New Filetype"
-msgstr "Nova vrsta datoteke"
-
-#: mode/katemodeconfigpage.cpp:238
-#, kde-format
-msgid "Properties of %1"
-msgstr "Svojstva %1"
-
-#: mode/katemodeconfigpage.cpp:288
-msgid ""
-"Select the MimeTypes you want for this file type.\n"
-"Please note that this will automatically edit the associated file extensions "
-"as well."
-msgstr ""
-"Odaberite MIME tipove koje želite za ovu vrstu datoteke.\n"
-"Imajte na umu da će ovo automatski da promijeni i pridužene nastavke "
-"izbornicima datoteka."
-
-#: mode/katemodeconfigpage.cpp:290
-msgid "Select Mime Types"
-msgstr "Izaberite Mime Tipove"
-
-#: printing/printconfigwidgets.cpp:49
-msgid "Te&xt Settings"
-msgstr "Postavke &teksta"
-
-#: printing/printconfigwidgets.cpp:53
-msgid "Print line &numbers"
-msgstr "Ispiši &brojeve redaka"
-
-#: printing/printconfigwidgets.cpp:56
-msgid "Print &legend"
-msgstr "Pokaži &legendu"
-
-#: printing/printconfigwidgets.cpp:65
-msgid ""
-"If enabled, line numbers will be printed on the left side of the page(s)."
-"
"
-msgstr ""
-
-#: printing/printconfigwidgets.cpp:67
-#, fuzzy
-#| msgid ""
-#| "Print a box displaying typographical conventions for the document "
-#| "type, as defined by the syntax highlighting being used."
-msgid ""
-"
Print a box displaying typographical conventions for the document type, "
-"as defined by the syntax highlighting being used.
"
-msgstr ""
-"Ispisivanje okvira koji prikazuje tipografske konvencije za vrste "
-"dokumenta, kako je određeno naglašenom sintaksom koja se upotrebljava."
-
-#: printing/printconfigwidgets.cpp:119
-msgid "Hea&der && Footer"
-msgstr "&Zaglavlje i podnožje"
-
-#: printing/printconfigwidgets.cpp:126
-msgid "Pr&int header"
-msgstr "Zaglavlje &ispisa"
-
-#: printing/printconfigwidgets.cpp:128
-msgid "Pri&nt footer"
-msgstr "Pod&nožje ispisa"
-
-#: printing/printconfigwidgets.cpp:134
-msgid "Header/footer font:"
-msgstr "Font za zaglavlje/podnožje:"
-
-#: printing/printconfigwidgets.cpp:139
-msgid "Choo&se Font..."
-msgstr "Odaberi &font…"
-
-#: printing/printconfigwidgets.cpp:145
-msgid "Header Properties"
-msgstr "Svojstva zaglavlja"
-
-#: printing/printconfigwidgets.cpp:149
-msgid "&Format:"
-msgstr "&Oblik:"
-
-#: printing/printconfigwidgets.cpp:171 printing/printconfigwidgets.cpp:217
-msgid "Colors:"
-msgstr "Boje:"
-
-#: printing/printconfigwidgets.cpp:178 printing/printconfigwidgets.cpp:224
-msgid "Foreground:"
-msgstr "Prednji plan:"
-
-#: printing/printconfigwidgets.cpp:183
-msgid "Bac&kground"
-msgstr "Po&zadina"
-
-#: printing/printconfigwidgets.cpp:189
-msgid "Footer Properties"
-msgstr "Svojstva podnožja"
-
-#: printing/printconfigwidgets.cpp:194
-msgid "For&mat:"
-msgstr "O&blik:"
-
-#: printing/printconfigwidgets.cpp:229
-msgid "&Background"
-msgstr "&Pozadina"
-
-#: printing/printconfigwidgets.cpp:258
-msgid "
Format of the page header. The following tags are supported:
"
-msgstr ""
-"Oblik zaglavlja stranice. Podržane su sljedeće oznake oblikovanja:
"
-
-#: printing/printconfigwidgets.cpp:260
-msgid ""
-"%u : current user name%d : complete date/"
-"time in short format%D : complete date/time in long format"
-"li>%h : current time%y : current date in short "
-"format%Y : current date in long format%f : "
-"file name%U : full URL of the document%p : "
-"page number%P : total amount of pages "
-msgstr ""
-
-#: printing/printconfigwidgets.cpp:274
-msgid "Format of the page footer. The following tags are supported:
"
-msgstr ""
-"Oblik podnožjastranice. Podržane su sljedeće oznake oblikovanja:
"
-
-#: printing/printconfigwidgets.cpp:353
-#, kde-format
-msgid "%1, %2pt"
-msgstr ""
-
-#: printing/printconfigwidgets.cpp:372
-msgid "Add Placeholder..."
-msgstr ""
-
-#: printing/printconfigwidgets.cpp:374
-#, fuzzy
-#| msgid "Current line:"
-msgid "Current User Name"
-msgstr "Trenutni redak: "
-
-#: printing/printconfigwidgets.cpp:376
-msgid "Complete Date/Time (short format)"
-msgstr ""
-
-#: printing/printconfigwidgets.cpp:378
-msgid "Complete Date/Time (long format)"
-msgstr ""
-
-#: printing/printconfigwidgets.cpp:380
-#, fuzzy
-#| msgid "Current line:"
-msgid "Current Time"
-msgstr "Trenutni redak: "
-
-#: printing/printconfigwidgets.cpp:382
-msgid "Current Date (short format)"
-msgstr ""
-
-#: printing/printconfigwidgets.cpp:384
-msgid "Current Date (long format)"
-msgstr ""
-
-#: printing/printconfigwidgets.cpp:386
-#, fuzzy
-#| msgid "File Masks"
-msgid "File Name"
-msgstr "Datotečne maske"
-
-#: printing/printconfigwidgets.cpp:388
-msgid "Full document URL"
-msgstr ""
-
-#: printing/printconfigwidgets.cpp:390
-#, fuzzy
-#| msgid "Daniel Naber"
-msgid "Page Number"
-msgstr "Daniel Naber"
-
-#: printing/printconfigwidgets.cpp:392
-msgid "Total Amount of Pages"
-msgstr ""
-
-#: printing/printconfigwidgets.cpp:501
-msgid "L&ayout"
-msgstr "&Raspored"
-
-#: printing/printconfigwidgets.cpp:507 schema/kateschemaconfig.cpp:897
-msgid "&Schema:"
-msgstr "S&hema:"
-
-#: printing/printconfigwidgets.cpp:514
-msgid "Draw bac&kground color"
-msgstr "Crtaj po&zadinsku boju"
-
-#: printing/printconfigwidgets.cpp:517
-msgid "Draw &boxes"
-msgstr "Crtaj &okvire"
-
-#: printing/printconfigwidgets.cpp:521
-msgid "Box Properties"
-msgstr "Svojstva okvira"
-
-#: printing/printconfigwidgets.cpp:525
-msgid "W&idth:"
-msgstr "Ši&rina:"
-
-#: printing/printconfigwidgets.cpp:533
-msgid "&Margin:"
-msgstr "&Margina:"
-
-#: printing/printconfigwidgets.cpp:541
-msgid "Co&lor:"
-msgstr "&Boja:"
-
-#: printing/printconfigwidgets.cpp:563
-msgid "Select the color scheme to use for the print."
-msgstr ""
-
-#: printing/printconfigwidgets.cpp:565
-msgid ""
-"If enabled, the background color of the editor will be used.
This "
-"may be useful if your color scheme is designed for a dark background.
"
-msgstr ""
-
-#: printing/printconfigwidgets.cpp:568
-msgid ""
-"If enabled, a box as defined in the properties below will be drawn around "
-"the contents of each page. The Header and Footer will be separated from the "
-"contents with a line as well.
"
-msgstr ""
-
-#: printing/printconfigwidgets.cpp:572
-msgid "The width of the box outline"
-msgstr "Širina obruba okvira"
-
-#: printing/printconfigwidgets.cpp:574
-msgid "The margin inside boxes, in pixels"
-msgstr "Margina unutar okvira, u pikselima"
-
-#: printing/printconfigwidgets.cpp:576
-msgid "The line color to use for boxes"
-msgstr "Boja retka koji se koriste za okvire"
-
-#: printing/printpainter.cpp:274
-msgid "(Selection of) "
-msgstr "(Izbor)"
-
-#: printing/printpainter.cpp:530
-#, kde-format
-msgid "Typographical Conventions for %1"
-msgstr "Tipografske konvencije za %1"
-
-#: printing/printpainter.cpp:561
-msgid "text"
-msgstr "tekst"
-
-#. i18n: ectx: property (text), widget (QLabel, label)
-#: schema/howtoimportschema.ui:17
-#, fuzzy
-#| msgid "What do you want to do?"
-msgid "How do you want to import the schema?"
-msgstr "Što želite napraviti?"
-
-#. i18n: ectx: property (text), widget (QRadioButton, radioReplaceCurrent)
-#: schema/howtoimportschema.ui:24
-#, fuzzy
-msgid "Replace current schema?"
-msgstr "Postavke tipkovnice"
-
-#. i18n: ectx: property (text), widget (QRadioButton, radioReplaceExisting)
-#: schema/howtoimportschema.ui:34 schema/kateschemaconfig.cpp:1055
-#, fuzzy, no-c-format, kde-format
-msgid "Replace existing schema %1"
-msgstr "Postavke tipkovnice"
-
-#. i18n: ectx: property (text), widget (QRadioButton, radioAsNew)
-#: schema/howtoimportschema.ui:43
-#, fuzzy
-#| msgid "Name for New Schema"
-msgid "Import as new schema:"
-msgstr "Ime za novu shemu"
-
-#: schema/katecolortreewidget.cpp:53 schema/katecolortreewidget.cpp:80
-msgid "Use default color from the KDE color scheme"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:60
-#, fuzzy
-#| msgid "Font & Color Schemas"
-msgid "Use KDE Color Scheme"
-msgstr "Palete pisama i boja"
-
-#: schema/kateschemaconfig.cpp:87
-#, fuzzy
-#| msgid "Unset Background Color"
-msgid "Editor Background Colors"
-msgstr "Makni boju pozadine"
-
-#: schema/kateschemaconfig.cpp:89
-#, fuzzy
-msgid "Text Area"
-msgstr "Pozadina tekst područja:"
-
-#: schema/kateschemaconfig.cpp:91
-msgid "Sets the background color of the editing area.
"
-msgstr "Podešava boju pozadine područja uređivanja teksta.
"
-
-#: schema/kateschemaconfig.cpp:95
-#, fuzzy
-#| msgid "Selected text:"
-msgid "Selected Text"
-msgstr "Označeni tekst:"
-
-#: schema/kateschemaconfig.cpp:97
-msgid ""
-"Sets the background color of the selection.
To set the text color "
-"for selected text, use the "Configure Highlighting " dialog."
-"
"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:101
-#, fuzzy
-#| msgid "Current line:"
-msgid "Current Line"
-msgstr "Trenutni redak: "
-
-#: schema/kateschemaconfig.cpp:103
-msgid ""
-"Sets the background color of the currently active line, which means the "
-"line where your cursor is positioned.
"
-msgstr ""
-"Postavlja boju pozadine trenutno aktivnog retka, tj. retka u kojem je "
-"pokazivač.
"
-
-#: schema/kateschemaconfig.cpp:107
-#, fuzzy
-#| msgid "Highlighting"
-msgid "Search Highlight"
-msgstr "Osvjetljavanje"
-
-#: schema/kateschemaconfig.cpp:109
-#, fuzzy
-#| msgid "Sets the background color of the editing area.
"
-msgid "Sets the background color of search results.
"
-msgstr "Podešava boju pozadine područja uređivanja teksta.
"
-
-#: schema/kateschemaconfig.cpp:113
-#, fuzzy
-#| msgid "Highlighting"
-msgid "Replace Highlight"
-msgstr "Osvjetljavanje"
-
-#: schema/kateschemaconfig.cpp:115
-#, fuzzy
-#| msgid "Sets the background color of the editing area.
"
-msgid "Sets the background color of replaced text.
"
-msgstr "Podešava boju pozadine područja uređivanja teksta.
"
-
-#: schema/kateschemaconfig.cpp:122
-#, fuzzy
-#| msgid "Show &Icon Border"
-msgid "Icon Border"
-msgstr "Pokaži okvir &ikona"
-
-#: schema/kateschemaconfig.cpp:124
-#, fuzzy
-#| msgctxt "@title:column Text style"
-#| msgid "Background"
-msgid "Background Area"
-msgstr "Pozadina"
-
-#: schema/kateschemaconfig.cpp:126
-#, fuzzy
-#| msgid "Sets the background color of the editing area.
"
-msgid "Sets the background color of the icon border.
"
-msgstr "Podešava boju pozadine područja uređivanja teksta.
"
-
-#: schema/kateschemaconfig.cpp:130
-#, fuzzy
-#| msgid "Line numbers:"
-msgid "Line Numbers"
-msgstr "Brojevi redaka:"
-
-#: schema/kateschemaconfig.cpp:132
-#, fuzzy
-#| msgid "This icon will be displayed in the menu and toolbar.
"
-msgid "This color will be used to draw the line numbers (if enabled).
"
-msgstr "Ova ikona bit će prikazana unutar izbornika i alatne trake.
"
-
-#: schema/kateschemaconfig.cpp:136
-msgid "Separator"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:138
-msgid ""
-"This color will be used to draw the line between line numbers and the "
-"icon borders, if both are enabled.
"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:142
-#, fuzzy
-#| msgid "Word wrap markers:"
-msgid "Word Wrap Marker"
-msgstr "Markeri prijeloma teksta:"
-
-#: schema/kateschemaconfig.cpp:144
-msgid ""
-"Sets the color of Word Wrap-related markers:
Static Word Wrap"
-"dt> A vertical line which shows the column where text is going to be "
-"wrapped Dynamic Word Wrap An arrow shown to the left of "
-"visually-wrapped lines "
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:149
-msgid "Code Folding"
-msgstr "Sklapanje koda"
-
-#: schema/kateschemaconfig.cpp:151
-#, fuzzy
-#| msgid "Sets the background color of the editing area.
"
-msgid "Sets the color of the code folding bar.
"
-msgstr "Podešava boju pozadine područja uređivanja teksta.
"
-
-#: schema/kateschemaconfig.cpp:155
-#, fuzzy
-#| msgid "Scroll Line Up"
-msgid "Modified Lines"
-msgstr "Pomakni za liniju gure"
-
-#: schema/kateschemaconfig.cpp:157
-#, fuzzy
-#| msgid "Sets the color of the tabulator marks:
"
-msgid ""
-"Sets the color of the line modification marker for modified lines.
"
-msgstr "Postavlja boju za markere tabulatora:
"
-
-#: schema/kateschemaconfig.cpp:161
-#, fuzzy
-#| msgid "Save File"
-msgid "Saved Lines"
-msgstr "Spremi datoteku"
-
-#: schema/kateschemaconfig.cpp:163
-#, fuzzy
-#| msgid "Sets the color of the tabulator marks:
"
-msgid "Sets the color of the line modification marker for saved lines.
"
-msgstr "Postavlja boju za markere tabulatora:
"
-
-#: schema/kateschemaconfig.cpp:170
-#, fuzzy
-#| msgid "Selection Mode"
-msgid "Text Decorations"
-msgstr "Način odabira"
-
-#: schema/kateschemaconfig.cpp:172
-msgid "Spelling Mistake Line"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:174
-#, fuzzy
-#| msgid "Sets the color of the tabulator marks:
"
-msgid ""
-"Sets the color of the line that is used to indicate spelling mistakes.
"
-msgstr "Postavlja boju za markere tabulatora:
"
-
-#: schema/kateschemaconfig.cpp:178
-#, fuzzy
-#| msgid "Tab markers:"
-msgid "Tab and Space Markers"
-msgstr "Markeri tabulatora:"
-
-#: schema/kateschemaconfig.cpp:180
-#, fuzzy
-#| msgid "Sets the color of the tabulator marks:
"
-msgid "Sets the color of the tabulator marks.
"
-msgstr "Postavlja boju za markere tabulatora:
"
-
-#: schema/kateschemaconfig.cpp:184
-#, fuzzy
-#| msgid "Indentation"
-msgid "Indentation Line"
-msgstr "Uvlačenje"
-
-#: schema/kateschemaconfig.cpp:186
-#, fuzzy
-#| msgid "Sets the color of the tabulator marks:
"
-msgid "Sets the color of the vertical indentation lines.
"
-msgstr "Postavlja boju za markere tabulatora:
"
-
-#: schema/kateschemaconfig.cpp:190
-#, fuzzy
-#| msgid "Bracket highlight:"
-msgid "Bracket Highlight"
-msgstr "Bojanje zagrada:"
-
-#: schema/kateschemaconfig.cpp:192
-msgid ""
-"Sets the bracket matching color. This means, if you place the cursor e.g. "
-"at a ( , the matching ) will be highlighted with this color.
"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:200
-#, fuzzy
-#| msgid "Colors"
-msgid "Marker Colors"
-msgstr "Boje"
-
-#: schema/kateschemaconfig.cpp:202 view/kateviewhelpers.cpp:1212
-msgid "Bookmark"
-msgstr "Knjižna bilješka"
-
-#: schema/kateschemaconfig.cpp:204
-msgid ""
-"Sets the background color of mark type.
Note : The marker "
-"color is displayed lightly because of transparency.
"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:208
-msgid "Active Breakpoint"
-msgstr "Aktivna točka prekida"
-
-#: schema/kateschemaconfig.cpp:213
-msgid "Reached Breakpoint"
-msgstr "Dosegnuta točka prekida"
-
-#: schema/kateschemaconfig.cpp:218
-msgid "Disabled Breakpoint"
-msgstr "Onemogućena točka prekida"
-
-#: schema/kateschemaconfig.cpp:223
-msgid "Execution"
-msgstr "Provedba"
-
-#: schema/kateschemaconfig.cpp:228
-msgid "Warning"
-msgstr "Upozoranje"
-
-#: schema/kateschemaconfig.cpp:233
-msgid "Error"
-msgstr "Greška"
-
-#: schema/kateschemaconfig.cpp:241
-msgid "Text Templates & Snippets"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:245
-#, fuzzy
-#| msgctxt "@title:column Text style"
-#| msgid "Background"
-msgid "Background"
-msgstr "Pozadina"
-
-#: schema/kateschemaconfig.cpp:250
-msgid "Editable Placeholder"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:255
-msgid "Focused Editable Placeholder"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:260
-msgid "Not Editable Placeholder"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:489
-msgid ""
-"This list displays the default styles for the current schema and offers "
-"the means to edit them. The style name reflects the current style settings."
-"p>
To edit the colors, click the colored squares, or select the color to "
-"edit from the popup menu.
You can unset the Background and Selected "
-"Background colors from the popup menu when appropriate.
"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:590
-msgid "H&ighlight:"
-msgstr "O&svjetljavanje:"
-
-#: schema/kateschemaconfig.cpp:600 schema/kateschemaconfig.cpp:914
-#, fuzzy
-#| msgid "E&xport as HTML..."
-msgid "Export..."
-msgstr "&Izvoz u HTML …"
-
-#: schema/kateschemaconfig.cpp:604 schema/kateschemaconfig.cpp:918
-#, fuzzy
-#| msgid "Normal &Color..."
-msgid "Import..."
-msgstr "Normaln&e boje"
-
-#: schema/kateschemaconfig.cpp:637
-msgid ""
-"This list displays the contexts of the current syntax highlight mode and "
-"offers the means to edit them. The context name reflects the current style "
-"settings.
To edit using the keyboard, press <SPACE>"
-"strong> and choose a property from the popup menu.
To edit the colors, "
-"click the colored squares, or select the color to edit from the popup menu."
-"p>
You can unset the Background and Selected Background colors from the "
-"context menu when appropriate.
"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:658
-#, fuzzy
-#| msgid "Highlighting for Scheme"
-msgid "Loading all highlightings for schema"
-msgstr "Osvjetljavanje Scheme"
-
-#: schema/kateschemaconfig.cpp:779
-msgid "Importing colors for single highlighting"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:781 schema/kateschemaconfig.cpp:852
-#: schema/kateschemaconfig.cpp:971 schema/kateschemaconfig.cpp:1102
-#, fuzzy
-#| msgid "Font & Color Schemas"
-msgid "Kate color schema"
-msgstr "Palete pisama i boja"
-
-#: schema/kateschemaconfig.cpp:795
-msgid "File is not a single highlighting color file"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:796 schema/kateschemaconfig.cpp:1113
-#, fuzzy
-#| msgid "File Format"
-msgid "Fileformat error"
-msgstr "Format datoteka"
-
-#: schema/kateschemaconfig.cpp:806
-#, kde-format
-msgid "The selected file contains colors for a non existing highlighting:%1"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:807
-msgid "Import failure"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:830
-#, kde-format
-msgid "Colors have been imported for highlighting: %1"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:831
-msgid "Import has finished"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:850
-#, kde-format
-msgid "Exporting colors for single highlighting: %1"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:906
-msgid "&New..."
-msgstr "&Novo…"
-
-#: schema/kateschemaconfig.cpp:929
-msgid "Colors"
-msgstr "Boje"
-
-#: schema/kateschemaconfig.cpp:933
-msgid "Font"
-msgstr "Pismo"
-
-#: schema/kateschemaconfig.cpp:937
-#, fuzzy
-#| msgid "Normal Text Styles"
-msgid "Default Text Styles"
-msgstr "Stilovi običnog teksta"
-
-#: schema/kateschemaconfig.cpp:941
-msgid "Highlighting Text Styles"
-msgstr "Stilovi isticanja teksta"
-
-#: schema/kateschemaconfig.cpp:947
-#, kde-format
-msgid "&Default schema for %1:"
-msgstr "Po&drazumjevana shema za %1:"
-
-#: schema/kateschemaconfig.cpp:969
-#, fuzzy, kde-format
-#| msgid "Font & Color Schemas"
-msgid "Exporting color schema: %1"
-msgstr "Palete pisama i boja"
-
-#: schema/kateschemaconfig.cpp:1001
-msgid "Exporting schema"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:1100
-#, fuzzy
-#| msgid "Font & Color Schemas"
-msgid "Importing Color Schema"
-msgstr "Palete pisama i boja"
-
-#: schema/kateschemaconfig.cpp:1112
-msgid "The file does not contain a full color schema."
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:1119
-#, fuzzy
-#| msgid "Namespace"
-msgid "Name unspecified"
-msgstr "Imensko mjesto (Namespace)"
-
-#: schema/kateschemaconfig.cpp:1169
-msgid "Importing schema"
-msgstr ""
-
-#: schema/kateschemaconfig.cpp:1312
-msgid "Name for New Schema"
-msgstr "Ime za novu shemu"
-
-#: schema/kateschemaconfig.cpp:1312
-msgid "Name:"
-msgstr "Ime:"
-
-#: schema/kateschemaconfig.cpp:1312 schema/kateschemaconfig.cpp:1320
-msgid "New Schema"
-msgstr "Nova shema"
-
-#: schema/kateschemaconfig.cpp:1320
-#, kde-format
-msgid ""
-"The schema %1 already exists.
Please choose a different schema name."
-"
"
-msgstr ""
-
-#: schema/katestyletreewidget.cpp:137
-msgctxt "@title:column Meaning of text in editor"
-msgid "Context"
-msgstr "Kontekst"
-
-#: schema/katestyletreewidget.cpp:137
-msgctxt "@title:column Text style"
-msgid "Normal"
-msgstr "Obično"
-
-#: schema/katestyletreewidget.cpp:137
-msgctxt "@title:column Text style"
-msgid "Selected"
-msgstr "Odabrano"
-
-#: schema/katestyletreewidget.cpp:137
-msgctxt "@title:column Text style"
-msgid "Background"
-msgstr "Pozadina"
-
-#: schema/katestyletreewidget.cpp:137
-msgctxt "@title:column Text style"
-msgid "Background Selected"
-msgstr "Odabrana pozadina"
-
-#: schema/katestyletreewidget.cpp:139
-msgid "Use Default Style"
-msgstr "Koristi uobičajeni stil"
-
-#: schema/katestyletreewidget.cpp:233
-msgid "&Bold"
-msgstr "&Podebljano"
-
-#: schema/katestyletreewidget.cpp:238
-msgid "&Italic"
-msgstr "Kurz&iv"
-
-#: schema/katestyletreewidget.cpp:243
-msgid "&Underline"
-msgstr "Pod&vučeno"
-
-#: schema/katestyletreewidget.cpp:248
-msgid "S&trikeout"
-msgstr "Precrtano"
-
-#: schema/katestyletreewidget.cpp:255
-msgid "Normal &Color..."
-msgstr "Normaln&e boje"
-
-#: schema/katestyletreewidget.cpp:258
-msgid "&Selected Color..."
-msgstr "Odabrana &boja…"
-
-#: schema/katestyletreewidget.cpp:261
-msgid "&Background Color..."
-msgstr "Boja pozadine…"
-
-#: schema/katestyletreewidget.cpp:264
-msgid "S&elected Background Color..."
-msgstr "Odabrana boja pozadine…"
-
-#: schema/katestyletreewidget.cpp:270
-#, fuzzy
-#| msgid "Normal &Color..."
-msgid "Unset Normal Color"
-msgstr "Normaln&e boje"
-
-#: schema/katestyletreewidget.cpp:273
-#, fuzzy
-#| msgid "Unset Selected Background Color"
-msgid "Unset Selected Color"
-msgstr "Makni odabranu boju pozadine"
-
-#: schema/katestyletreewidget.cpp:279
-msgid "Unset Background Color"
-msgstr "Makni boju pozadine"
-
-#: schema/katestyletreewidget.cpp:284
-msgid "Unset Selected Background Color"
-msgstr "Makni odabranu boju pozadine"
-
-#: schema/katestyletreewidget.cpp:290
-msgid "Use &Default Style"
-msgstr "&Uobičajeni stil stavki"
-
-#: schema/katestyletreewidget.cpp:404
-msgctxt "No text or background color set"
-msgid "None set"
-msgstr "Ništa nije postavljeno"
-
-#: schema/katestyletreewidget.cpp:637
-msgid ""
-"\"Use Default Style\" will be automatically unset when you change any style "
-"properties."
-msgstr ""
-"\"Koristi podrazumjevani stil\" će biti automatski deselektiran čim "
-"promjenite bilo koju značajku stila."
-
-#: schema/katestyletreewidget.cpp:638
-msgid "Kate Styles"
-msgstr "Kate Stilovi"
-
-#: script/data/commands/emmet.js:18
-msgid ""
-"Expands the abbreviation using Emmet expressions; see http://code.google.com/"
-"p/zen-coding/wiki/ZenHTMLSelectorsEn"
-msgstr ""
-
-#: script/data/commands/emmet.js:19
-msgid ""
-"Wraps the selected text in XML tags constructed from the provided Emmet "
-"expression (defaults to div)."
-msgstr ""
-
-#: script/data/commands/emmet.js:20
-msgid "Moves the caret to the current tag's pair"
-msgstr ""
-
-#: script/data/commands/emmet.js:21
-msgid ""
-"Select contents of HTML/XML tag, moving inward on continuous invocations"
-msgstr ""
-
-#: script/data/commands/emmet.js:22
-msgid ""
-"Select contents of HTML/XML tag, moving outwards on continuous invocations"
-msgstr ""
-
-#: script/data/commands/emmet.js:23
-msgid "Move to the next edit point (tag or empty attribute)."
-msgstr ""
-
-#: script/data/commands/emmet.js:24
-msgid "Move to the previous edit point (tag or empty attribute)."
-msgstr ""
-
-#: script/data/commands/emmet.js:25
-msgid "Select next edit point (tag or empty attribute)."
-msgstr ""
-
-#: script/data/commands/emmet.js:26
-msgid "Select previous edit point (tag or empty attribute)."
-msgstr ""
-
-#: script/data/commands/emmet.js:27
-msgid "Toggle comment of current tag or CSS selector"
-msgstr ""
-
-#: script/data/commands/emmet.js:28
-msgid "Deletes tag under cursor"
-msgstr ""
-
-#: script/data/commands/emmet.js:29
-msgid "Splits or joins a tag"
-msgstr ""
-
-#: script/data/commands/emmet.js:30
-msgid "Evaluates a simple math expression"
-msgstr ""
-
-#: script/data/commands/emmet.js:31
-msgid "Decrement number under cursor by 1"
-msgstr ""
-
-#: script/data/commands/emmet.js:32
-msgid "Decrement number under cursor by 10"
-msgstr ""
-
-#: script/data/commands/emmet.js:33
-msgid "Decrement number under cursor by 0.1"
-msgstr ""
-
-#: script/data/commands/emmet.js:34
-msgid "Increment number under cursor by 1"
-msgstr ""
-
-#: script/data/commands/emmet.js:35
-msgid "Increment number under cursor by 10"
-msgstr ""
-
-#: script/data/commands/emmet.js:36
-msgid "Increment number under cursor by 0.1"
-msgstr ""
-
-#: script/data/commands/emmet.js:45
-msgid "Emmet"
-msgstr ""
-
-#: script/data/commands/emmet.js:49
-msgid "Expand abbreviation"
-msgstr ""
-
-#: script/data/commands/emmet.js:51
-msgid "Wrap with tag"
-msgstr ""
-
-#: script/data/commands/emmet.js:54
-#, fuzzy
-#| msgid "Move to Matching Bracket"
-msgid "Move cursor to matching tag"
-msgstr "Pomakni do pripadajuće zagrade"
-
-#: script/data/commands/emmet.js:56
-msgid "Select HTML/XML tag contents inwards"
-msgstr ""
-
-#: script/data/commands/emmet.js:58
-msgid "Select HTML/XML tag contents outwards"
-msgstr ""
-
-#: script/data/commands/emmet.js:60
-#, fuzzy
-#| msgctxt "@item:intable Text context"
-#| msgid "Comment"
-msgid "Toggle comment"
-msgstr "Komentar"
-
-#: script/data/commands/emmet.js:62
-msgid "Go to next edit point"
-msgstr ""
-
-#: script/data/commands/emmet.js:64
-#, fuzzy
-#| msgid "Move to Previous Line"
-msgid "Go to previous edit point"
-msgstr "Pomakni se na prethodnu liniju"
-
-#: script/data/commands/emmet.js:66
-#, fuzzy
-#| msgid "Select to Next Line"
-msgid "Select next edit point"
-msgstr "Označi do sljedećeg retka"
-
-#: script/data/commands/emmet.js:68
-#, fuzzy
-#| msgid "Select to Previous Line"
-msgid "Select previous edit point"
-msgstr "Izaberite prethodnu liniju"
-
-#: script/data/commands/emmet.js:70
-msgid "Delete tag under cursor"
-msgstr ""
-
-#: script/data/commands/emmet.js:72
-msgid "Split or join a tag"
-msgstr ""
-
-#: script/data/commands/emmet.js:74
-msgid "Evaluate a simple math expression"
-msgstr ""
-
-#: script/data/commands/emmet.js:76
-msgid "Decrement number by 1"
-msgstr ""
-
-#: script/data/commands/emmet.js:78
-msgid "Decrement number by 10"
-msgstr ""
-
-#: script/data/commands/emmet.js:80
-msgid "Decrement number by 0.1"
-msgstr ""
-
-#: script/data/commands/emmet.js:82
-msgid "Increment number by 1"
-msgstr ""
-
-#: script/data/commands/emmet.js:84
-msgid "Increment number by 10"
-msgstr ""
-
-#: script/data/commands/emmet.js:86
-msgid "Increment number by 0.1"
-msgstr ""
-
-#: script/data/commands/jumpMatchingIndent.js:33
-#, fuzzy
-#| msgctxt "Language Section"
-#| msgid "Configuration"
-msgid "Navigation"
-msgstr "Konfiguracija"
-
-#: script/data/commands/jumpMatchingIndent.js:36
-#: script/data/commands/jumpMatchingIndent.js:50
-#, fuzzy
-#| msgid "Move to Previous Line"
-msgid "Move cursor to previous matching indent"
-msgstr "Pomakni se na prethodnu liniju"
-
-#: script/data/commands/jumpMatchingIndent.js:40
-#: script/data/commands/jumpMatchingIndent.js:53
-#, fuzzy
-#| msgid "Move to Matching Bracket"
-msgid "Move cursor to next matching indent"
-msgstr "Pomakni do pripadajuće zagrade"
-
-#: script/data/commands/quickcoding.js:19
-msgid "Quick Coding"
-msgstr ""
-
-#: script/data/commands/quickcoding.js:22
-msgid "Expand Abbreviation"
-msgstr ""
-
-#: script/data/commands/quickcoding.js:32
-msgid "Expand Quick Coding Abbreviation"
-msgstr ""
-
-#: script/data/commands/utils.js:330 utils/kateglobal.cpp:374
-msgid "Editing"
-msgstr "Uređivanje"
-
-#: script/data/commands/utils.js:333
-#, fuzzy
-#| msgid "Selected text:"
-msgid "Sort Selected Text"
-msgstr "Označeni tekst:"
-
-#: script/data/commands/utils.js:336
-#, fuzzy
-#| msgid "Scroll Line Down"
-msgid "Move Lines Down"
-msgstr "Pomakni za liniju dolje"
-
-#: script/data/commands/utils.js:339
-#, fuzzy
-#| msgid "Scroll Line Up"
-msgid "Move Lines Up"
-msgstr "Pomakni za liniju gure"
-
-#: script/data/commands/utils.js:342
-msgid "Duplicate Selected Lines Up"
-msgstr ""
-
-#: script/data/commands/utils.js:345
-msgid "Duplicate Selected Lines Down"
-msgstr ""
-
-#: script/data/commands/utils.js:348
-#, fuzzy
-#| msgid "Selected text:"
-msgid "URI-encode Selected Text"
-msgstr "Označeni tekst:"
-
-#: script/data/commands/utils.js:351
-#, fuzzy
-#| msgid "Selected text:"
-msgid "URI-decode Selected Text"
-msgstr "Označeni tekst:"
-
-#: script/data/commands/utils.js:361
-#, fuzzy
-#| msgid "Select the entire text of the current document."
-msgid "Sort the selected text or whole document."
-msgstr "Označava cijeli tekst trenutnog dokumenta."
-
-#: script/data/commands/utils.js:363
-#, fuzzy
-#| msgid "Remove selected"
-msgid "Move selected lines down."
-msgstr "Ukloni odabrano"
-
-#: script/data/commands/utils.js:365
-#, fuzzy
-#| msgid "Remove selected"
-msgid "Move selected lines up."
-msgstr "Ukloni odabrano"
-
-#: script/data/commands/utils.js:367
-msgid "Remove duplicate lines from the selected text or whole document."
-msgstr ""
-
-#: script/data/commands/utils.js:369
-msgid ""
-"Sort the selected text or whole document in natural order. Here is an "
-"example to show the difference to the normal sort method: sort(a10, a1, "
-"a2) => a1, a10, a2 natsort(a10, a1, a2) => a1, a2, a10"
-msgstr ""
-
-#: script/data/commands/utils.js:371
-msgid "Trims trailing whitespace from selection or whole document."
-msgstr ""
-
-#: script/data/commands/utils.js:373
-msgid "Trims leading whitespace from selection or whole document."
-msgstr ""
-
-#: script/data/commands/utils.js:375
-msgid "Trims leading and trailing whitespace from selection or whole document."
-msgstr ""
-
-#: script/data/commands/utils.js:377
-msgid ""
-"Joins selected lines or whole document. Optionally pass a separator to put "
-"between each line:join ', '
will e.g. join lines and "
-"separate them by a comma."
-msgstr ""
-
-#: script/data/commands/utils.js:379
-msgid "Removes empty lines from selection or whole document."
-msgstr ""
-
-#: script/data/commands/utils.js:383
-msgid ""
-"Given a JavaScript function as argument, call that for the list of "
-"(selected) lines and replace them with the return value of that callback."
-" Example (join selected lines):each 'function(lines){return "
-"lines.join(\", \");}'
To save you some typing, you can also do "
-"this to achieve the same:each 'lines.join(\", \")'
"
-msgstr ""
-
-#: script/data/commands/utils.js:385
-msgid ""
-"Given a JavaScript function as argument, call that for the list of "
-"(selected) lines and remove those where the callback returns false."
-" Example (see also rmblank
):filter 'function(l)"
-"{return l.length > 0;}'
To save you some typing, you can also do "
-"this to achieve the same:filter 'line.length > 0'
"
-msgstr ""
-
-#: script/data/commands/utils.js:387
-msgid ""
-"Given a JavaScript function as argument, call that for the list of "
-"(selected) lines and replace the line with the return value of the callback."
-" Example (see also ltrim
):map 'function(line)"
-"{return line.replace(/^\\s+/, \"\");}'
To save you some typing, "
-"you can also do this to achieve the same:map 'line.replace(/^\\s"
-"+/, \"\")'
"
-msgstr ""
-
-#: script/data/commands/utils.js:389
-msgid "Duplicates the selected lines up."
-msgstr ""
-
-#: script/data/commands/utils.js:391
-msgid "Duplicates the selected lines down."
-msgstr ""
-
-#: script/data/commands/utils.js:393
-msgid ""
-"Encode special chars in a single line selection, so the result text can be "
-"used as URI."
-msgstr ""
-
-#: script/data/commands/utils.js:395
-msgid "Reverse action of URI encode."
-msgstr ""
-
-#: script/data/indentation/cppstyle.js:2
-#, fuzzy
-#| msgid "C Style"
-msgctxt "Autoindent mode"
-msgid "C++/boost Style"
-msgstr "C stil"
-
-#: script/data/indentation/cstyle.js:2
-#, fuzzy
-#| msgid "C Style"
-msgctxt "Autoindent mode"
-msgid "C Style"
-msgstr "C stil"
-
-#: script/data/indentation/haskell.js:2
-#, fuzzy
-#| msgctxt "Language"
-#| msgid "Haskell"
-msgctxt "Autoindent mode"
-msgid "Haskell"
-msgstr "Haskell"
-
-#: script/data/indentation/latex.js:2
-#, fuzzy
-#| msgid "Latest"
-msgctxt "Autoindent mode"
-msgid "Latex"
-msgstr "Posljednji"
-
-#: script/data/indentation/lilypond.js:2
-#, fuzzy
-#| msgctxt "Language"
-#| msgid "LilyPond"
-msgctxt "Autoindent mode"
-msgid "LilyPond"
-msgstr "LilyPond"
-
-#: script/data/indentation/lisp.js:2
-msgctxt "Autoindent mode"
-msgid "LISP"
-msgstr ""
-
-#: script/data/indentation/lua.js:2
-#, fuzzy
-#| msgctxt "Language"
-#| msgid "Lua"
-msgctxt "Autoindent mode"
-msgid "Lua"
-msgstr "Lua"
-
-#: script/data/indentation/pascal.js:2
-#, fuzzy
-#| msgctxt "Language"
-#| msgid "Pascal"
-msgctxt "Autoindent mode"
-msgid "Pascal"
-msgstr "Pascal"
-
-#: script/data/indentation/python.js:2
-#, fuzzy
-#| msgctxt "Language"
-#| msgid "Python"
-msgctxt "Autoindent mode"
-msgid "Python"
-msgstr "Python"
-
-#: script/data/indentation/ruby.js:2
-#, fuzzy
-#| msgctxt "Language"
-#| msgid "Ruby"
-msgctxt "Autoindent mode"
-msgid "Ruby"
-msgstr "Ruby"
-
-#: script/data/indentation/xml.js:2
-#, fuzzy
-msgctxt "Autoindent mode"
-msgid "XML Style"
-msgstr "C stil"
-
-#: script/katecommandlinescript.cpp:56
-#, kde-format
-msgid "Function '%1' not found in script: %2"
-msgstr ""
-
-#: script/katecommandlinescript.cpp:69
-#, fuzzy, kde-format
-#| msgid "Error: %1"
-msgid "Error calling %1"
-msgstr "Greška: %1"
-
-#: script/katecommandlinescript.cpp:81
-#, kde-format
-msgid "Function 'action' not found in script: %1"
-msgstr ""
-
-#: script/katecommandlinescript.cpp:92
-#, fuzzy, kde-format
-#| msgid "Error: %1"
-msgid "Error calling action(%1)"
-msgstr "Greška: %1"
-
-#: script/katecommandlinescript.cpp:118
-#, kde-format
-msgid "Bad quoting in call: %1. Please escape single quotes with a backslash."
-msgstr ""
-
-#: script/katecommandlinescript.cpp:126 script/katescriptmanager.cpp:346
-#: utils/katecmds.cpp:237 utils/katecmds.cpp:545
-msgid "Could not access view"
-msgstr "Nije moguće pristupiti prikazu"
-
-#: script/katecommandlinescript.cpp:175
-#, kde-format
-msgid "Error calling 'help %1'"
-msgstr ""
-
-#: script/katecommandlinescript.cpp:180
-#, kde-format
-msgid "No help specified for command '%1' in script %2"
-msgstr ""
-
-#: script/katescript.cpp:214
-#, kde-format
-msgid "Error loading script %1\n"
-msgstr ""
-
-#: script/katescript.cpp:215
-#, kde-format
-msgid "Error loading script %1"
-msgstr ""
-
-#: script/katescripthelpers.cpp:50
-#, fuzzy, kde-format
-#| msgid "Unable to open %1"
-msgid "Unable to find '%1'"
-msgstr "Ne mogu otvoriti %1"
-
-#: script/katescriptmanager.cpp:354 script/katescriptmanager.cpp:367
-#, kde-format
-msgid "Command not found: %1"
-msgstr ""
-
-#: script/katescriptmanager.cpp:364
-msgid "Reload all JavaScript files (indenters, command line scripts, etc)."
-msgstr ""
-"Ponovno učitaj sve JacaScript datoteke (intendere, skripte naredbenog retka "
-"i sl.)"
-
-#: search/katesearchbar.cpp:81
-msgid "Add..."
-msgstr "Dodaj…"
-
-#: search/katesearchbar.cpp:349
-msgid "Reached top, continued from bottom"
-msgstr ""
-
-#: search/katesearchbar.cpp:351
-msgid "Reached bottom, continued from top"
-msgstr ""
-
-#: search/katesearchbar.cpp:356
-msgid "Not found"
-msgstr "Nije nađeno."
-
-#: search/katesearchbar.cpp:606
-msgid "Bottom of file reached. Continue from top?"
-msgstr ""
-
-#: search/katesearchbar.cpp:607
-msgid "Top of file reached. Continue from bottom?"
-msgstr ""
-
-#: search/katesearchbar.cpp:608
-#, fuzzy
-#| msgid "Continue from the end?"
-msgid "Continue search?"
-msgstr "Da nastavim s kraja?"
-
-#: search/katesearchbar.cpp:615
-#, fuzzy
-#| msgid "Continue from the end?"
-msgid "Continuing search from top"
-msgstr "Da nastavim s kraja?"
-
-#: search/katesearchbar.cpp:622
-msgid "Continuing search from bottom"
-msgstr ""
-
-#: search/katesearchbar.cpp:666
-#, fuzzy, kde-format
-#| msgid "Not found"
-msgctxt "short translation"
-msgid "1 match found"
-msgid_plural "%1 matches found"
-msgstr[0] "Nije nađeno."
-msgstr[1] "Nije nađeno."
-msgstr[2] "Nije nađeno."
-
-#: search/katesearchbar.cpp:908
-#, fuzzy, kde-format
-#| msgid "%1 replacements have been done"
-msgctxt "short translation"
-msgid "1 replacement made"
-msgid_plural "%1 replacements made"
-msgstr[0] "Izvršeno je %1 zamjena."
-msgstr[1] "Izvršeno je %1 zamjena."
-msgstr[2] "Izvršeno je %1 zamjena."
-
-#: search/katesearchbar.cpp:1101
-msgid "Beginning of line"
-msgstr "Početak retka"
-
-#: search/katesearchbar.cpp:1102
-msgid "End of line"
-msgstr "Kraj retka"
-
-#: search/katesearchbar.cpp:1104
-msgid "Any single character (excluding line breaks)"
-msgstr "Bilo koji znak (bez prekida redaka)"
-
-#: search/katesearchbar.cpp:1106
-msgid "One or more occurrences"
-msgstr ""
-
-#: search/katesearchbar.cpp:1107
-msgid "Zero or more occurrences"
-msgstr ""
-
-#: search/katesearchbar.cpp:1108
-msgid "Zero or one occurrences"
-msgstr "Nula ili jedan događaj"
-
-#: search/katesearchbar.cpp:1109
-msgid " through occurrences"
-msgstr ""
-
-#: search/katesearchbar.cpp:1111
-msgid "Group, capturing"
-msgstr ""
-
-#: search/katesearchbar.cpp:1112
-msgid "Or"
-msgstr "Ili"
-
-#: search/katesearchbar.cpp:1113
-msgid "Set of characters"
-msgstr "Skup znakova"
-
-#: search/katesearchbar.cpp:1114
-msgid "Negative set of characters"
-msgstr "Negativni skup znakova"
-
-#: search/katesearchbar.cpp:1118
-msgid "Whole match reference"
-msgstr ""
-
-#: search/katesearchbar.cpp:1131
-msgid "Reference"
-msgstr ""
-
-#: search/katesearchbar.cpp:1138
-msgid "Line break"
-msgstr "Prekid retka"
-
-#: search/katesearchbar.cpp:1139
-msgid "Tab"
-msgstr "Tabulator"
-
-#: search/katesearchbar.cpp:1142
-msgid "Word boundary"
-msgstr ""
-
-#: search/katesearchbar.cpp:1143
-msgid "Not word boundary"
-msgstr "Bez granica riječi"
-
-#: search/katesearchbar.cpp:1144
-msgid "Digit"
-msgstr "Znamenka"
-
-#: search/katesearchbar.cpp:1145
-msgid "Non-digit"
-msgstr "Bez brojeva"
-
-#: search/katesearchbar.cpp:1146
-msgid "Whitespace (excluding line breaks)"
-msgstr ""
-
-#: search/katesearchbar.cpp:1147
-msgid "Non-whitespace (excluding line breaks)"
-msgstr ""
-
-#: search/katesearchbar.cpp:1148
-msgid "Word character (alphanumerics plus '_')"
-msgstr "Znakovi riječi (alfanumerici plus '_')"
-
-#: search/katesearchbar.cpp:1149
-#, fuzzy
-#| msgid "Character"
-msgid "Non-word character"
-msgstr "Znak"
-
-#: search/katesearchbar.cpp:1152
-msgid "Octal character 000 to 377 (2^8-1)"
-msgstr "Oktalni znakovi 000 do 377 (2^8-1)"
-
-#: search/katesearchbar.cpp:1153
-msgid "Hex character 0000 to FFFF (2^16-1)"
-msgstr "Heksadekadski znakovi 0000 do FFFF (2^16-1)"
-
-#: search/katesearchbar.cpp:1154
-#, fuzzy
-msgid "Backslash"
-msgstr "Sigurnosno spremanje"
-
-#: search/katesearchbar.cpp:1158
-msgid "Group, non-capturing"
-msgstr ""
-
-#: search/katesearchbar.cpp:1159
-msgid "Lookahead"
-msgstr "Gledaj unaprijed"
-
-#: search/katesearchbar.cpp:1160
-msgid "Negative lookahead"
-msgstr ""
-
-#: search/katesearchbar.cpp:1165
-msgid "Begin lowercase conversion"
-msgstr "Započni konverziju u mala slova"
-
-#: search/katesearchbar.cpp:1166
-msgid "Begin uppercase conversion"
-msgstr "Započni konverziju u velika slova"
-
-#: search/katesearchbar.cpp:1167
-msgid "End case conversion"
-msgstr "Završi konverziju veličine slova"
-
-#: search/katesearchbar.cpp:1168
-#, fuzzy
-#| msgid "Begin lowercase conversion"
-msgid "Lowercase first character conversion"
-msgstr "Započni konverziju u mala slova"
-
-#: search/katesearchbar.cpp:1169
-#, fuzzy
-#| msgid "Begin uppercase conversion"
-msgid "Uppercase first character conversion"
-msgstr "Započni konverziju u velika slova"
-
-#: search/katesearchbar.cpp:1170
-msgid "Replacement counter (for Replace All)"
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QLabel, label)
-#: search/searchbarincremental.ui:32 search/searchbarpower.ui:32
-msgid "F&ind:"
-msgstr "Nađ&i:"
-
-#. i18n: ectx: property (toolTip), widget (KComboBox, pattern)
-#: search/searchbarincremental.ui:60 search/searchbarpower.ui:54
-msgid "Text to search for"
-msgstr ""
-
-#. i18n: ectx: property (toolTip), widget (QPushButton, findNext)
-#. i18n: ectx: property (toolTip), widget (QPushButton, next)
-#: search/searchbarincremental.ui:73 search/searchbarpower.ui:67
-msgid "Jump to next match"
-msgstr "Skoči na sljedeće podudaranje"
-
-#. i18n: ectx: property (text), widget (QPushButton, findNext)
-#. i18n: ectx: property (text), widget (QPushButton, next)
-#: search/searchbarincremental.ui:76 search/searchbarpower.ui:70
-#, fuzzy
-#| msgid "Context"
-msgid "&Next"
-msgstr "Kontekst"
-
-#. i18n: ectx: property (toolTip), widget (QPushButton, findPrev)
-#. i18n: ectx: property (toolTip), widget (QPushButton, prev)
-#: search/searchbarincremental.ui:88 search/searchbarpower.ui:77
-#, fuzzy
-#| msgid "Go to the previous bookmark."
-msgid "Jump to previous match"
-msgstr "Povratak na prethodnu oznaku."
-
-#. i18n: ectx: property (text), widget (QPushButton, findPrev)
-#. i18n: ectx: property (text), widget (QPushButton, prev)
-#: search/searchbarincremental.ui:91 search/searchbarpower.ui:80
-#, fuzzy
-msgid "&Previous"
-msgstr "Prethodna oznaka"
-
-#. i18n: ectx: property (text), widget (QCheckBox, matchCase)
-#: search/searchbarincremental.ui:119 search/searchbarpower.ui:214
-msgid "&Match case"
-msgstr "&Podudaranje veličine slova"
-
-#. i18n: ectx: property (toolTip), widget (QToolButton, mutate)
-#: search/searchbarincremental.ui:145
-msgid "Switch to power search and replace bar"
-msgstr "Prebaci u traku za napredno traženje i zamjenjivanje"
-
-#. i18n: ectx: property (text), widget (QLabel, label_3)
-#: search/searchbarpower.ui:92
-#, fuzzy
-msgid "Rep&lace:"
-msgstr "Zamjeni tekst"
-
-#. i18n: ectx: property (toolTip), widget (KComboBox, replacement)
-#: search/searchbarpower.ui:111
-msgid "Text to replace with"
-msgstr "Zamijeni tekst sa"
-
-#. i18n: ectx: property (toolTip), widget (QPushButton, replaceNext)
-#: search/searchbarpower.ui:124
-#, fuzzy
-msgid "Replace next match"
-msgstr "Postavke tipkovnice"
-
-#. i18n: ectx: property (text), widget (QPushButton, replaceNext)
-#: search/searchbarpower.ui:127
-msgid "&Replace"
-msgstr "&Zamijeni"
-
-#. i18n: ectx: property (toolTip), widget (QPushButton, replaceAll)
-#: search/searchbarpower.ui:134
-#, fuzzy
-msgid "Replace all matches"
-msgstr "Zamjeni tekst"
-
-#. i18n: ectx: property (text), widget (QPushButton, replaceAll)
-#: search/searchbarpower.ui:137
-msgid "Replace &All"
-msgstr "Zamijeni &sve"
-
-#. i18n: ectx: property (toolTip), widget (QComboBox, searchMode)
-#: search/searchbarpower.ui:165
-#, fuzzy
-#| msgid "Search"
-msgid "Search mode"
-msgstr "&Traži"
-
-#. i18n: ectx: property (text), item, widget (QComboBox, searchMode)
-#: search/searchbarpower.ui:175
-msgid "Plain text"
-msgstr "Čisti tekst"
-
-#. i18n: ectx: property (text), item, widget (QComboBox, searchMode)
-#: search/searchbarpower.ui:180
-msgid "Whole words"
-msgstr "Cijele riječi"
-
-#. i18n: ectx: property (text), item, widget (QComboBox, searchMode)
-#: search/searchbarpower.ui:185
-msgid "Escape sequences"
-msgstr "Isključujući niz"
-
-#. i18n: ectx: property (text), item, widget (QComboBox, searchMode)
-#: search/searchbarpower.ui:190
-msgid "Regular expression"
-msgstr "Regularni izraz"
-
-#. i18n: ectx: property (toolTip), widget (QCheckBox, matchCase)
-#: search/searchbarpower.ui:211
-#, fuzzy
-msgid "Case-sensitive searching"
-msgstr "Razlikuj velika i mala slova"
-
-#. i18n: ectx: property (text), widget (QCheckBox, selectionOnly)
-#: search/searchbarpower.ui:221
-#, fuzzy
-msgid "Selection &only"
-msgstr "Samo označeno"
-
-#. i18n: ectx: property (text), widget (QLabel, label_2)
-#: search/searchbarpower.ui:230
-msgid "Mo&de:"
-msgstr "Nač&in:"
-
-#. i18n: ectx: property (text), widget (QPushButton, findAll)
-#: search/searchbarpower.ui:243
-msgid "&Find All"
-msgstr ""
-
-#. i18n: ectx: property (toolTip), widget (QToolButton, mutate)
-#: search/searchbarpower.ui:254
-#, fuzzy
-#| msgid "Next Incremental Search Match"
-msgid "Switch to incremental search bar"
-msgstr "Sljedeći"
-
-#: spellcheck/spellcheckdialog.cpp:65
-msgid "Spelling (from cursor)..."
-msgstr "Provjera pravopisa (od pokazivača)…"
-
-#: spellcheck/spellcheckdialog.cpp:68
-msgid "Check the document's spelling from the cursor and forward"
-msgstr "Provjeri pravopis dokumenta od pokazivača pa na dalje"
-
-#: spellcheck/spellcheckdialog.cpp:71
-#, fuzzy
-msgid "Spellcheck Selection..."
-msgstr "Provjera pravopisa"
-
-#: spellcheck/spellcheckdialog.cpp:74
-msgid "Check spelling of the selected text"
-msgstr "Provjeri pravopis odabranog teksta"
-
-#: spellcheck/spellingmenu.cpp:102
-msgid "Ignore Word"
-msgstr "Ignoriraj riječ"
-
-#: spellcheck/spellingmenu.cpp:105
-msgid "Add to Dictionary"
-msgstr "Dodaj u rječnik"
-
-#: swapfile/kateswapfile.cpp:629
-msgid "The file was not closed properly."
-msgstr ""
-
-#: swapfile/kateswapfile.cpp:633
-#, fuzzy
-msgid "View Changes"
-msgstr ""
-"Datoteka %1 je izmjenjena (promenjena) na disku od strane drugog programa!\n"
-"\n"
-
-#: swapfile/kateswapfile.cpp:634
-msgid "Recover Data"
-msgstr ""
-
-#: swapfile/kateswapfile.cpp:635
-#, fuzzy
-#| msgid "Disabled"
-msgid "Discard"
-msgstr "Onemogućeno"
-
-#. i18n: tag language attribute name
-#: syntax/data/abap.xml:3
-msgctxt "Language"
-msgid "ABAP"
-msgstr "ABAP"
-
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#: syntax/data/abap.xml:3 syntax/data/actionscript.xml:3 syntax/data/ada.xml:3
-#: syntax/data/ansforth94.xml:37 syntax/data/ansic89.xml:27
-#: syntax/data/boo.xml:5 syntax/data/c.xml:3 syntax/data/cg.xml:23
-#: syntax/data/cgis.xml:3 syntax/data/clipper.xml:3 syntax/data/clojure.xml:25
-#: syntax/data/commonlisp.xml:26 syntax/data/component-pascal.xml:13
-#: syntax/data/cpp.xml:3 syntax/data/crk.xml:2 syntax/data/cs.xml:2
-#: syntax/data/d.xml:104 syntax/data/e.xml:3 syntax/data/eiffel.xml:13
-#: syntax/data/fortran.xml:3 syntax/data/freebasic.xml:3
-#: syntax/data/fsharp.xml:12 syntax/data/glsl.xml:3 syntax/data/go.xml:29
-#: syntax/data/grammar.xml:6 syntax/data/haskell.xml:3 syntax/data/haxe.xml:15
-#: syntax/data/idl.xml:3 syntax/data/ilerpg.xml:48 syntax/data/inform.xml:5
-#: syntax/data/java.xml:3 syntax/data/julia.xml:32 syntax/data/kbasic.xml:3
-#: syntax/data/lex.xml:23 syntax/data/literate-haskell.xml:3
-#: syntax/data/logtalk.xml:4 syntax/data/lpc.xml:19 syntax/data/m4.xml:41
-#: syntax/data/modelica.xml:19 syntax/data/modula-2.xml:3
-#: syntax/data/monobasic.xml:13 syntax/data/nemerle.xml:4
-#: syntax/data/nesc.xml:3 syntax/data/noweb.xml:3 syntax/data/objectivec.xml:3
-#: syntax/data/objectivecpp.xml:3 syntax/data/ocaml.xml:12
-#: syntax/data/oors.xml:3 syntax/data/opal.xml:3 syntax/data/opencl.xml:3
-#: syntax/data/protobuf.xml:3 syntax/data/purebasic.xml:3
-#: syntax/data/rapidq.xml:3 syntax/data/rsiidl.xml:3 syntax/data/sather.xml:3
-#: syntax/data/scala.xml:3 syntax/data/sml.xml:3 syntax/data/stata.xml:3
-#: syntax/data/tads3.xml:5 syntax/data/vala.xml:25 syntax/data/xharbour.xml:3
-#: syntax/data/yacc.xml:28 syntax/data/zonnon.xml:3
-msgctxt "Language Section"
-msgid "Sources"
-msgstr "Izvorni kod"
-
-#. i18n: tag language attribute name
-#: syntax/data/abc.xml:5
-msgctxt "Language"
-msgid "ABC"
-msgstr "ABC"
-
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#: syntax/data/abc.xml:5 syntax/data/alert.xml:33
-#: syntax/data/alert_indent.xml:29 syntax/data/changelog.xml:3
-#: syntax/data/cmake.xml:29 syntax/data/cue.xml:3
-#: syntax/data/debianchangelog.xml:3 syntax/data/debiancontrol.xml:3
-#: syntax/data/diff.xml:18 syntax/data/email.xml:6 syntax/data/gdb.xml:10
-#: syntax/data/git-rebase.xml:3 syntax/data/jam.xml:24
-#: syntax/data/lilypond.xml:43 syntax/data/m3u.xml:17
-#: syntax/data/makefile.xml:8 syntax/data/mup.xml:3 syntax/data/povray.xml:8
-#: syntax/data/qmake.xml:3 syntax/data/rib.xml:8 syntax/data/rpmspec.xml:11
-#: syntax/data/valgrind-suppression.xml:3
-msgctxt "Language Section"
-msgid "Other"
-msgstr "Ostalo"
-
-#. i18n: tag language attribute name
-#: syntax/data/actionscript.xml:3
-msgctxt "Language"
-msgid "ActionScript 2.0"
-msgstr "ActionScript 2.0"
-
-#. i18n: tag language attribute name
-#: syntax/data/ada.xml:3
-msgctxt "Language"
-msgid "Ada"
-msgstr "Ada"
-
-#. i18n: tag language attribute name
-#: syntax/data/ahdl.xml:3
-msgctxt "Language"
-msgid "AHDL"
-msgstr "AHDL"
-
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#: syntax/data/ahdl.xml:3 syntax/data/spice.xml:4 syntax/data/systemc.xml:10
-#: syntax/data/systemverilog.xml:42 syntax/data/vera.xml:42
-#: syntax/data/verilog.xml:3 syntax/data/vhdl.xml:14
-msgctxt "Language Section"
-msgid "Hardware"
-msgstr "Hardver"
-
-#. i18n: tag language attribute name
-#: syntax/data/ahk.xml:3
-msgctxt "Language"
-msgid "AutoHotKey"
-msgstr ""
-
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#: syntax/data/ahk.xml:3 syntax/data/ample.xml:3 syntax/data/awk.xml:3
-#: syntax/data/bash.xml:11 syntax/data/cubescript.xml:10
-#: syntax/data/dosbat.xml:11 syntax/data/erlang.xml:39
-#: syntax/data/euphoria.xml:32 syntax/data/ferite.xml:3
-#: syntax/data/gnuplot.xml:3 syntax/data/idconsole.xml:3
-#: syntax/data/javascript.xml:6 syntax/data/k.xml:3 syntax/data/ld.xml:4
-#: syntax/data/lsl.xml:14 syntax/data/lua.xml:38 syntax/data/mason.xml:3
-#: syntax/data/mel.xml:23 syntax/data/perl.xml:42 syntax/data/php.xml:67
-#: syntax/data/pig.xml:4 syntax/data/pike.xml:4 syntax/data/python.xml:16
-#: syntax/data/q.xml:3 syntax/data/qml.xml:4 syntax/data/r.xml:11
-#: syntax/data/rexx.xml:3 syntax/data/ruby.xml:33 syntax/data/scheme.xml:43
-#: syntax/data/sed.xml:3 syntax/data/sieve.xml:4 syntax/data/tcl.xml:31
-#: syntax/data/tcsh.xml:11 syntax/data/uscript.xml:3
-#: syntax/data/velocity.xml:3 syntax/data/zsh.xml:11
-msgctxt "Language Section"
-msgid "Scripts"
-msgstr "Skripte"
-
-#. i18n: tag language attribute name
-#: syntax/data/alert.xml:33
-msgctxt "Language"
-msgid "Alerts"
-msgstr "Alarmi"
-
-#. i18n: tag language attribute name
-#: syntax/data/alert_indent.xml:29
-msgctxt "Language"
-msgid "Alerts_indent"
-msgstr "Alerts_indent"
-
-#. i18n: tag language attribute name
-#: syntax/data/ample.xml:3
-#, fuzzy
-#| msgctxt "Language"
-#| msgid "YAML"
-msgctxt "Language"
-msgid "AMPLE"
-msgstr "YAML"
-
-#. i18n: tag language attribute name
-#: syntax/data/ansforth94.xml:37
-msgctxt "Language"
-msgid "ANS-Forth94"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/ansic89.xml:27
-msgctxt "Language"
-msgid "ANSI C89"
-msgstr "ANSI C89"
-
-#. i18n: tag language attribute name
-#: syntax/data/ansys.xml:3
-msgctxt "Language"
-msgid "Ansys"
-msgstr "Ansys"
-
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#: syntax/data/ansys.xml:3 syntax/data/bmethod.xml:3 syntax/data/dot.xml:4
-#: syntax/data/gap.xml:17 syntax/data/gdl.xml:3 syntax/data/matlab.xml:60
-#: syntax/data/maxima.xml:24 syntax/data/octave.xml:18 syntax/data/sci.xml:3
-#: syntax/data/tibasic.xml:3 syntax/data/yacas.xml:3
-msgctxt "Language Section"
-msgid "Scientific"
-msgstr "Znanstveni"
-
-#. i18n: tag language attribute name
-#: syntax/data/apache.xml:15
-#, fuzzy
-msgctxt "Language"
-msgid "Apache Configuration"
-msgstr "Izvorni kod"
-
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#: syntax/data/apache.xml:15 syntax/data/asterisk.xml:19
-#: syntax/data/cisco.xml:3 syntax/data/fstab.xml:4 syntax/data/ini.xml:3
-#: syntax/data/mergetagtext.xml:28 syntax/data/nagios.xml:3
-#: syntax/data/varnish.xml:3 syntax/data/varnishtest.xml:3
-#: syntax/data/winehq.xml:3 syntax/data/xorg.xml:3
-msgctxt "Language Section"
-msgid "Configuration"
-msgstr "Konfiguracija"
-
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#: syntax/data/asm-avr.xml:36 syntax/data/asm-dsp56k.xml:4
-#: syntax/data/asm-m68k.xml:4 syntax/data/asm6502.xml:3
-#: syntax/data/fasm.xml:16 syntax/data/gnuassembler.xml:46
-#: syntax/data/mips.xml:3 syntax/data/nasm.xml:43 syntax/data/picsrc.xml:11
-msgctxt "Language Section"
-msgid "Assembler"
-msgstr "Assembler"
-
-#. i18n: tag language attribute name
-#: syntax/data/asm-avr.xml:36
-msgctxt "Language"
-msgid "AVR Assembler"
-msgstr "AVR Assembler"
-
-#. i18n: tag language attribute name
-#: syntax/data/asm-dsp56k.xml:4
-msgctxt "Language"
-msgid "Motorola DSP56k"
-msgstr "Motorola DSP56k"
-
-#. i18n: tag language attribute name
-#: syntax/data/asm-m68k.xml:4
-msgctxt "Language"
-msgid "Motorola 68k (VASM/Devpac)"
-msgstr "Motorola 68k (VASM/Devpac)"
-
-#. i18n: tag language attribute name
-#: syntax/data/asm6502.xml:3
-msgctxt "Language"
-msgid "Asm6502"
-msgstr "Asm6502"
-
-#. i18n: tag language attribute name
-#: syntax/data/asn1.xml:16
-msgctxt "Language"
-msgid "ASN.1"
-msgstr "ASN.1"
-
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#: syntax/data/asn1.xml:16 syntax/data/asp.xml:3 syntax/data/bibtex.xml:9
-#: syntax/data/ccss.xml:4 syntax/data/coldfusion.xml:3
-#: syntax/data/context.xml:3 syntax/data/css.xml:18
-#: syntax/data/djangotemplate.xml:7 syntax/data/doxygenlua.xml:30
-#: syntax/data/dtd.xml:6 syntax/data/gettext.xml:26 syntax/data/glosstex.xml:3
-#: syntax/data/haml.xml:3 syntax/data/html.xml:7 syntax/data/javadoc.xml:3
-#: syntax/data/jira.xml:13 syntax/data/json.xml:15 syntax/data/jsp.xml:3
-#: syntax/data/latex.xml:3 syntax/data/less.xml:3 syntax/data/mab.xml:3
-#: syntax/data/mako.xml:7 syntax/data/mandoc.xml:3 syntax/data/markdown.xml:38
-#: syntax/data/mediawiki.xml:9 syntax/data/metafont.xml:9
-#: syntax/data/pango.xml:3 syntax/data/postscript.xml:3 syntax/data/ppd.xml:12
-#: syntax/data/relaxngcompact.xml:3 syntax/data/rest.xml:9
-#: syntax/data/restructuredtext.xml:3 syntax/data/rhtml.xml:47
-#: syntax/data/roff.xml:10 syntax/data/scss.xml:23 syntax/data/sgml.xml:3
-#: syntax/data/sisu.xml:3 syntax/data/texinfo.xml:3 syntax/data/textile.xml:18
-#: syntax/data/txt2tags.xml:6 syntax/data/vcard.xml:5 syntax/data/vrml.xml:3
-#: syntax/data/wml.xml:57 syntax/data/xml.xml:9 syntax/data/xmldebug.xml:3
-#: syntax/data/xslt.xml:55 syntax/data/xul.xml:7 syntax/data/yaml.xml:4
-msgctxt "Language Section"
-msgid "Markup"
-msgstr "Markup"
-
-#. i18n: tag language attribute name
-#: syntax/data/asp.xml:3
-msgctxt "Language"
-msgid "ASP"
-msgstr "ASP"
-
-#. i18n: tag language attribute name
-#: syntax/data/asterisk.xml:19
-msgctxt "Language"
-msgid "Asterisk"
-msgstr "Asterisk"
-
-#. i18n: tag language attribute name
-#: syntax/data/awk.xml:3
-msgctxt "Language"
-msgid "AWK"
-msgstr "AWK"
-
-#. i18n: tag language attribute name
-#: syntax/data/bash.xml:11
-msgctxt "Language"
-msgid "Bash"
-msgstr "Bash"
-
-#. i18n: tag language attribute name
-#: syntax/data/bibtex.xml:9
-msgctxt "Language"
-msgid "BibTeX"
-msgstr "BibTeX"
-
-#. i18n: tag language attribute name
-#: syntax/data/bmethod.xml:3
-msgctxt "Language"
-msgid "B-Method"
-msgstr "B-Method"
-
-#. i18n: tag language attribute name
-#: syntax/data/boo.xml:5
-msgctxt "Language"
-msgid "Boo"
-msgstr "Boo"
-
-#. i18n: tag language attribute name
-#: syntax/data/c.xml:3
-msgctxt "Language"
-msgid "C"
-msgstr "C"
-
-#. i18n: tag language attribute name
-#: syntax/data/ccss.xml:4
-msgctxt "Language"
-msgid "CleanCSS"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/cg.xml:23
-msgctxt "Language"
-msgid "Cg"
-msgstr "Cg"
-
-#. i18n: tag language attribute name
-#: syntax/data/cgis.xml:3
-msgctxt "Language"
-msgid "CGiS"
-msgstr "CGiS"
-
-#. i18n: tag language attribute name
-#: syntax/data/changelog.xml:3
-msgctxt "Language"
-msgid "ChangeLog"
-msgstr "ChangeLog"
-
-#. i18n: tag language attribute name
-#: syntax/data/cisco.xml:3
-msgctxt "Language"
-msgid "Cisco"
-msgstr "Cisco"
-
-#. i18n: tag language attribute name
-#: syntax/data/clipper.xml:3
-msgctxt "Language"
-msgid "Clipper"
-msgstr "Clipper"
-
-#. i18n: tag language attribute name
-#: syntax/data/clojure.xml:25
-msgctxt "Language"
-msgid "Clojure"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/cmake.xml:29
-msgctxt "Language"
-msgid "CMake"
-msgstr "CMake"
-
-#. i18n: tag language attribute name
-#: syntax/data/coffee.xml:4
-#, fuzzy
-#| msgid "Scripts"
-msgctxt "Language"
-msgid "CoffeeScript"
-msgstr "Skripte"
-
-#. i18n: tag language attribute name
-#: syntax/data/coldfusion.xml:3
-msgctxt "Language"
-msgid "ColdFusion"
-msgstr "ColdFusion"
-
-#. i18n: tag language attribute name
-#: syntax/data/commonlisp.xml:26
-msgctxt "Language"
-msgid "Common Lisp"
-msgstr "Common Lisp"
-
-#. i18n: tag language attribute name
-#: syntax/data/component-pascal.xml:13
-msgctxt "Language"
-msgid "Component-Pascal"
-msgstr "Component-Pascal"
-
-#. i18n: tag language attribute name
-#: syntax/data/context.xml:3
-msgctxt "Language"
-msgid "ConTeXt"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/cpp.xml:3
-msgctxt "Language"
-msgid "C++"
-msgstr "C++"
-
-#. i18n: tag language attribute name
-#: syntax/data/crk.xml:2
-#, fuzzy
-#| msgctxt "Language"
-#| msgid "CMake"
-msgctxt "Language"
-msgid "Crack"
-msgstr "CMake"
-
-#. i18n: tag language attribute name
-#: syntax/data/cs.xml:2
-msgctxt "Language"
-msgid "C#"
-msgstr "C#"
-
-#. i18n: tag language attribute name
-#: syntax/data/css.xml:18
-msgctxt "Language"
-msgid "CSS"
-msgstr "CSS"
-
-#. i18n: tag language attribute name
-#: syntax/data/cubescript.xml:10
-#, fuzzy
-#| msgid "Scripts"
-msgctxt "Language"
-msgid "CubeScript"
-msgstr "Skripte"
-
-#. i18n: tag language attribute name
-#: syntax/data/cue.xml:3
-msgctxt "Language"
-msgid "CUE Sheet"
-msgstr "CUE Sheet"
-
-#. i18n: tag language attribute name
-#: syntax/data/curry.xml:33
-msgctxt "Language"
-msgid "Curry"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/d.xml:104
-msgctxt "Language"
-msgid "D"
-msgstr "D"
-
-#. i18n: tag language attribute name
-#: syntax/data/debianchangelog.xml:3
-msgctxt "Language"
-msgid "Debian Changelog"
-msgstr "Debian Changelog"
-
-#. i18n: tag language attribute name
-#: syntax/data/debiancontrol.xml:3
-msgctxt "Language"
-msgid "Debian Control"
-msgstr "Debian Control"
-
-#. i18n: tag language attribute name
-#: syntax/data/desktop.xml:3
-msgctxt "Language"
-msgid ".desktop"
-msgstr ".desktop"
-
-#. i18n: tag language attribute name
-#: syntax/data/diff.xml:18
-msgctxt "Language"
-msgid "Diff"
-msgstr "Diff"
-
-#. i18n: tag language attribute name
-#: syntax/data/djangotemplate.xml:7
-msgctxt "Language"
-msgid "Django HTML Template"
-msgstr "Django HTML predložak"
-
-#. i18n: tag language attribute name
-#: syntax/data/dosbat.xml:11
-msgctxt "Language"
-msgid "MS-DOS Batch"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/dot.xml:4
-msgctxt "Language"
-msgid "dot"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/doxygen.xml:31
-msgctxt "Language"
-msgid "Doxygen"
-msgstr "Doxygen"
-
-#. i18n: tag language attribute name
-#: syntax/data/doxygenlua.xml:30
-msgctxt "Language"
-msgid "DoxygenLua"
-msgstr "DoxygenLua"
-
-#. i18n: tag language attribute name
-#: syntax/data/dtd.xml:6
-msgctxt "Language"
-msgid "DTD"
-msgstr "DTD"
-
-#. i18n: tag language attribute name
-#: syntax/data/e.xml:3
-msgctxt "Language"
-msgid "E Language"
-msgstr "E jezik"
-
-#. i18n: tag language attribute name
-#: syntax/data/eiffel.xml:13
-msgctxt "Language"
-msgid "Eiffel"
-msgstr "Eiffel"
-
-#. i18n: tag language attribute name
-#: syntax/data/email.xml:6
-msgctxt "Language"
-msgid "Email"
-msgstr "E-pošta"
-
-#. i18n: tag language attribute name
-#: syntax/data/erlang.xml:39
-msgctxt "Language"
-msgid "Erlang"
-msgstr "Erlang"
-
-#. i18n: tag language attribute name
-#: syntax/data/euphoria.xml:32
-msgctxt "Language"
-msgid "Euphoria"
-msgstr "Euphoria"
-
-#. i18n: tag language attribute name
-#: syntax/data/fasm.xml:16
-#, fuzzy
-#| msgctxt "Language"
-#| msgid "Intel x86 (NASM)"
-msgctxt "Language"
-msgid "Intel x86 (FASM)"
-msgstr "Intel x86 (NASM)"
-
-#. i18n: tag language attribute name
-#: syntax/data/ferite.xml:3
-msgctxt "Language"
-msgid "ferite"
-msgstr "ferite"
-
-#. i18n: tag language attribute name
-#: syntax/data/fgl-4gl.xml:3
-msgctxt "Language"
-msgid "4GL"
-msgstr "4GL"
-
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#. i18n: tag language attribute section
-#: syntax/data/fgl-4gl.xml:3 syntax/data/fgl-per.xml:3 syntax/data/ldif.xml:3
-#: syntax/data/progress.xml:3 syntax/data/sql-mysql.xml:8
-#: syntax/data/sql-postgresql.xml:4 syntax/data/sql.xml:6
-msgctxt "Language Section"
-msgid "Database"
-msgstr "Baza podataka"
-
-#. i18n: tag language attribute name
-#: syntax/data/fgl-per.xml:3
-msgctxt "Language"
-msgid "4GL-PER"
-msgstr "4GL-PER"
-
-#. i18n: tag language attribute name
-#: syntax/data/fortran.xml:3
-msgctxt "Language"
-msgid "Fortran"
-msgstr "Fortran"
-
-#. i18n: tag language attribute name
-#: syntax/data/freebasic.xml:3
-msgctxt "Language"
-msgid "FreeBASIC"
-msgstr "FreeBASIC"
-
-#. i18n: tag language attribute name
-#: syntax/data/fsharp.xml:12
-msgctxt "Language"
-msgid "FSharp"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/fstab.xml:4
-msgctxt "Language"
-msgid "fstab"
-msgstr "fstab"
-
-#. i18n: tag language attribute name
-#: syntax/data/gap.xml:17
-msgctxt "Language"
-msgid "GAP"
-msgstr "GAP"
-
-#. i18n: tag language attribute name
-#: syntax/data/gdb.xml:10
-#, fuzzy
-#| msgid "Backspace"
-msgctxt "Language"
-msgid "GDB Backtrace"
-msgstr "Backspace"
-
-#. i18n: tag language attribute name
-#: syntax/data/gdl.xml:3
-msgctxt "Language"
-msgid "GDL"
-msgstr "GDL"
-
-#. i18n: tag language attribute name
-#: syntax/data/gettext.xml:26
-msgctxt "Language"
-msgid "GNU Gettext"
-msgstr "GNU Gettext"
-
-#. i18n: tag language attribute name
-#: syntax/data/git-rebase.xml:3
-msgctxt "Language"
-msgid "Git Rebase"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/glosstex.xml:3
-msgctxt "Language"
-msgid "GlossTex"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/glsl.xml:3
-msgctxt "Language"
-msgid "GLSL"
-msgstr "GLSL"
-
-#. i18n: tag language attribute name
-#: syntax/data/gnuassembler.xml:46
-msgctxt "Language"
-msgid "GNU Assembler"
-msgstr "GNU Assembler"
-
-#. i18n: tag language attribute name
-#: syntax/data/gnuplot.xml:3
-msgctxt "Language"
-msgid "Gnuplot"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/go.xml:29
-#, fuzzy
-#| msgid "Go"
-msgctxt "Language"
-msgid "Go"
-msgstr "Kreni"
-
-#. i18n: tag language attribute name
-#: syntax/data/grammar.xml:6
-#, fuzzy
-#| msgctxt "Language"
-#| msgid "KDev-PG Grammar"
-msgctxt "Language"
-msgid "KDev-PG[-Qt] Grammar"
-msgstr "KDev-PG gramatika"
-
-#. i18n: tag language attribute name
-#: syntax/data/haml.xml:3
-msgctxt "Language"
-msgid "Haml"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/haskell.xml:3
-msgctxt "Language"
-msgid "Haskell"
-msgstr "Haskell"
-
-#. i18n: tag language attribute name
-#: syntax/data/haxe.xml:15
-msgctxt "Language"
-msgid "Haxe"
-msgstr "Haxe"
-
-#. i18n: tag language attribute name
-#: syntax/data/html.xml:7
-msgctxt "Language"
-msgid "HTML"
-msgstr "HTML"
-
-#. i18n: tag language attribute name
-#: syntax/data/idconsole.xml:3
-msgctxt "Language"
-msgid "Quake Script"
-msgstr "Quake Script"
-
-#. i18n: tag language attribute name
-#: syntax/data/idl.xml:3
-msgctxt "Language"
-msgid "IDL"
-msgstr "IDL"
-
-#. i18n: tag language attribute name
-#: syntax/data/ilerpg.xml:48
-msgctxt "Language"
-msgid "ILERPG"
-msgstr "ILERPG"
-
-#. i18n: tag language attribute name
-#: syntax/data/inform.xml:5
-msgctxt "Language"
-msgid "Inform"
-msgstr "Inform"
-
-#. i18n: tag language attribute name
-#: syntax/data/ini.xml:3
-msgctxt "Language"
-msgid "INI Files"
-msgstr "INI datoteke"
-
-#. i18n: tag language attribute name
-#: syntax/data/jam.xml:24
-msgctxt "Language"
-msgid "Jam"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/java.xml:3
-msgctxt "Language"
-msgid "Java"
-msgstr "Java"
-
-#. i18n: tag language attribute name
-#: syntax/data/javadoc.xml:3
-msgctxt "Language"
-msgid "Javadoc"
-msgstr "Javadoc"
-
-#. i18n: tag language attribute name
-#: syntax/data/javascript.xml:6
-msgctxt "Language"
-msgid "JavaScript"
-msgstr "JavaScript"
-
-#. i18n: tag language attribute name
-#: syntax/data/jira.xml:13
-msgctxt "Language"
-msgid "Jira"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/json.xml:15
-msgctxt "Language"
-msgid "JSON"
-msgstr "JSON"
-
-#. i18n: tag language attribute name
-#: syntax/data/jsp.xml:3
-msgctxt "Language"
-msgid "JSP"
-msgstr "JSP"
-
-#. i18n: tag language attribute name
-#: syntax/data/julia.xml:32
-msgctxt "Language"
-msgid "Julia"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/k.xml:3
-msgctxt "Language"
-msgid "k"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/kbasic.xml:3
-msgctxt "Language"
-msgid "KBasic"
-msgstr "KBasic"
-
-#. i18n: tag language attribute name
-#: syntax/data/latex.xml:3
-msgctxt "Language"
-msgid "LaTeX"
-msgstr "LaTeX"
-
-#. i18n: tag language attribute name
-#: syntax/data/ld.xml:4
-#, fuzzy
-#| msgctxt "Language"
-#| msgid "Quake Script"
-msgctxt "Language"
-msgid "GNU Linker Script"
-msgstr "Quake Script"
-
-#. i18n: tag language attribute name
-#: syntax/data/ldif.xml:3
-msgctxt "Language"
-msgid "LDIF"
-msgstr "LDIF"
-
-#. i18n: tag language attribute name
-#: syntax/data/less.xml:3
-msgctxt "Language"
-msgid "LESSCSS"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/lex.xml:23
-msgctxt "Language"
-msgid "Lex/Flex"
-msgstr "Lex/Flex"
-
-#. i18n: tag language attribute name
-#: syntax/data/lilypond.xml:43
-msgctxt "Language"
-msgid "LilyPond"
-msgstr "LilyPond"
-
-#. i18n: tag language attribute name
-#: syntax/data/literate-curry.xml:3
-#, fuzzy
-#| msgctxt "Language"
-#| msgid "Literate Haskell"
-msgctxt "Language"
-msgid "Literate Curry"
-msgstr "Literate Haskell"
-
-#. i18n: tag language attribute name
-#: syntax/data/literate-haskell.xml:3
-msgctxt "Language"
-msgid "Literate Haskell"
-msgstr "Literate Haskell"
-
-#. i18n: tag language attribute name
-#: syntax/data/logtalk.xml:4
-msgctxt "Language"
-msgid "Logtalk"
-msgstr "Logtalk"
-
-#. i18n: tag language attribute name
-#: syntax/data/lpc.xml:19
-msgctxt "Language"
-msgid "LPC"
-msgstr "LPC"
-
-#. i18n: tag language attribute name
-#: syntax/data/lsl.xml:14
-msgctxt "Language"
-msgid "LSL"
-msgstr "LSL"
-
-#. i18n: tag language attribute name
-#: syntax/data/lua.xml:38
-msgctxt "Language"
-msgid "Lua"
-msgstr "Lua"
-
-#. i18n: tag language attribute name
-#: syntax/data/m3u.xml:17
-msgctxt "Language"
-msgid "M3U"
-msgstr "M3U"
-
-#. i18n: tag language attribute name
-#: syntax/data/m4.xml:41
-msgctxt "Language"
-msgid "GNU M4"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/mab.xml:3
-msgctxt "Language"
-msgid "MAB-DB"
-msgstr "MAB-DB"
-
-#. i18n: tag language attribute name
-#: syntax/data/makefile.xml:8
-msgctxt "Language"
-msgid "Makefile"
-msgstr "Makefile"
-
-#. i18n: tag language attribute name
-#: syntax/data/mako.xml:7
-msgctxt "Language"
-msgid "Mako"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/mandoc.xml:3
-msgctxt "Language"
-msgid "Troff Mandoc"
-msgstr "Troff Mandoc"
-
-#. i18n: tag language attribute name
-#: syntax/data/markdown.xml:38
-msgctxt "Language"
-msgid "Markdown"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/mason.xml:3
-msgctxt "Language"
-msgid "Mason"
-msgstr "Mason"
-
-#. i18n: tag language attribute name
-#: syntax/data/matlab.xml:60
-msgctxt "Language"
-msgid "Matlab"
-msgstr "Matlab"
-
-#. i18n: tag language attribute name
-#: syntax/data/maxima.xml:24
-msgctxt "Language"
-msgid "Maxima"
-msgstr "Maxima"
-
-#. i18n: tag language attribute name
-#: syntax/data/mediawiki.xml:9
-msgctxt "Language"
-msgid "MediaWiki"
-msgstr "MediaWiki"
-
-#. i18n: tag language attribute name
-#: syntax/data/mel.xml:23
-#, fuzzy
-#| msgctxt "Language"
-#| msgid "SML"
-msgctxt "Language"
-msgid "MEL"
-msgstr "SML"
-
-#. i18n: tag language attribute name
-#: syntax/data/mergetagtext.xml:28
-msgctxt "Language"
-msgid "mergetag text"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/metafont.xml:9
-msgctxt "Language"
-msgid "Metapost/Metafont"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/mips.xml:3
-msgctxt "Language"
-msgid "MIPS Assembler"
-msgstr "MIPS Assembler"
-
-#. i18n: tag language attribute name
-#: syntax/data/modelica.xml:19
-msgctxt "Language"
-msgid "Modelica"
-msgstr "Modelica"
-
-#. i18n: tag language attribute name
-#: syntax/data/modelines.xml:12
-#, fuzzy
-#| msgctxt "Language"
-#| msgid "Modelica"
-msgctxt "Language"
-msgid "Modelines"
-msgstr "Modelica"
-
-#. i18n: tag language attribute name
-#: syntax/data/modula-2.xml:3
-msgctxt "Language"
-msgid "Modula-2"
-msgstr "Modula-2"
-
-#. i18n: tag language attribute name
-#: syntax/data/monobasic.xml:13
-msgctxt "Language"
-msgid "MonoBasic"
-msgstr "MonoBasic"
-
-#. i18n: tag language attribute name
-#: syntax/data/mup.xml:3
-msgctxt "Language"
-msgid "Music Publisher"
-msgstr "Music Publisher"
-
-#. i18n: tag language attribute name
-#: syntax/data/nagios.xml:3
-msgctxt "Language"
-msgid "Nagios"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/nasm.xml:43
-msgctxt "Language"
-msgid "Intel x86 (NASM)"
-msgstr "Intel x86 (NASM)"
-
-#. i18n: tag language attribute name
-#: syntax/data/nemerle.xml:4
-msgctxt "Language"
-msgid "Nemerle"
-msgstr "Nemerle"
-
-#. i18n: tag language attribute name
-#: syntax/data/nesc.xml:3
-msgctxt "Language"
-msgid "nesC"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/noweb.xml:3
-msgctxt "Language"
-msgid "noweb"
-msgstr "noweb"
-
-#. i18n: tag language attribute name
-#: syntax/data/objectivec.xml:3
-msgctxt "Language"
-msgid "Objective-C"
-msgstr "Objective-C"
-
-#. i18n: tag language attribute name
-#: syntax/data/objectivecpp.xml:3
-msgctxt "Language"
-msgid "Objective-C++"
-msgstr "Objective-C++"
-
-#. i18n: tag language attribute name
-#: syntax/data/ocaml.xml:12
-msgctxt "Language"
-msgid "Objective Caml"
-msgstr "Objective Caml"
-
-#. i18n: tag language attribute name
-#: syntax/data/octave.xml:18
-msgctxt "Language"
-msgid "Octave"
-msgstr "Octave"
-
-#. i18n: tag language attribute name
-#: syntax/data/oors.xml:3
-msgctxt "Language"
-msgid "OORS"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/opal.xml:3
-msgctxt "Language"
-msgid "OPAL"
-msgstr "OPAL"
-
-#. i18n: tag language attribute name
-#: syntax/data/opencl.xml:3
-msgctxt "Language"
-msgid "OpenCL"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/pango.xml:3
-msgctxt "Language"
-msgid "Pango"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/pascal.xml:3
-msgctxt "Language"
-msgid "Pascal"
-msgstr "Pascal"
-
-#. i18n: tag language attribute name
-#: syntax/data/perl.xml:42
-msgctxt "Language"
-msgid "Perl"
-msgstr "Perl"
-
-#. i18n: tag language attribute name
-#: syntax/data/php.xml:67
-msgctxt "Language"
-msgid "PHP/PHP"
-msgstr "PHP/PHP"
-
-#. i18n: tag language attribute name
-#: syntax/data/picsrc.xml:11
-msgctxt "Language"
-msgid "PicAsm"
-msgstr "PicAsm"
-
-#. i18n: tag language attribute name
-#: syntax/data/pig.xml:4
-msgctxt "Language"
-msgid "Pig"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/pike.xml:4
-msgctxt "Language"
-msgid "Pike"
-msgstr "Pike"
-
-#. i18n: tag language attribute name
-#: syntax/data/postscript.xml:3
-msgctxt "Language"
-msgid "PostScript"
-msgstr "PostScript"
-
-#. i18n: tag language attribute name
-#: syntax/data/povray.xml:8
-msgctxt "Language"
-msgid "POV-Ray"
-msgstr "POV-Ray"
-
-#. i18n: tag language attribute name
-#: syntax/data/ppd.xml:12
-msgctxt "Language"
-msgid "PostScript Printer Description"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/progress.xml:3
-msgctxt "Language"
-msgid "progress"
-msgstr "napredak"
-
-#. i18n: tag language attribute name
-#: syntax/data/protobuf.xml:3
-msgctxt "Language"
-msgid "Protobuf"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/purebasic.xml:3
-msgctxt "Language"
-msgid "PureBasic"
-msgstr "PureBasic"
-
-#. i18n: tag language attribute name
-#: syntax/data/python.xml:16
-msgctxt "Language"
-msgid "Python"
-msgstr "Python"
-
-#. i18n: tag language attribute name
-#: syntax/data/q.xml:3
-msgctxt "Language"
-msgid "q"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/qmake.xml:3
-#, fuzzy
-#| msgctxt "Language"
-#| msgid "CMake"
-msgctxt "Language"
-msgid "QMake"
-msgstr "CMake"
-
-#. i18n: tag language attribute name
-#: syntax/data/qml.xml:4
-#, fuzzy
-#| msgctxt "Language"
-#| msgid "SML"
-msgctxt "Language"
-msgid "QML"
-msgstr "SML"
-
-#. i18n: tag language attribute name
-#: syntax/data/r.xml:11
-msgctxt "Language"
-msgid "R Script"
-msgstr "R Script"
-
-#. i18n: tag language attribute name
-#: syntax/data/rapidq.xml:3
-msgctxt "Language"
-msgid "RapidQ"
-msgstr "RapidQ"
-
-#. i18n: tag language attribute name
-#: syntax/data/relaxngcompact.xml:3
-msgctxt "Language"
-msgid "RelaxNG-Compact"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/rest.xml:9
-msgctxt "Language"
-msgid "reStructuredText"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/restructuredtext.xml:3
-msgctxt "Language"
-msgid "Restructured Text"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/rexx.xml:3
-msgctxt "Language"
-msgid "REXX"
-msgstr "REXX"
-
-#. i18n: tag language attribute name
-#: syntax/data/rhtml.xml:47
-msgctxt "Language"
-msgid "Ruby/Rails/RHTML"
-msgstr "Ruby/Rails/RHTML"
-
-#. i18n: tag language attribute name
-#: syntax/data/rib.xml:8
-msgctxt "Language"
-msgid "RenderMan RIB"
-msgstr "RenderMan RIB"
-
-#. i18n: tag language attribute name
-#: syntax/data/roff.xml:10
-msgctxt "Language"
-msgid "Roff"
-msgstr "Roff"
-
-#. i18n: tag language attribute name
-#: syntax/data/rpmspec.xml:11
-msgctxt "Language"
-msgid "RPM Spec"
-msgstr "RPM Spec"
-
-#. i18n: tag language attribute name
-#: syntax/data/rsiidl.xml:3
-msgctxt "Language"
-msgid "RSI IDL"
-msgstr "RSI IDL"
-
-#. i18n: tag language attribute name
-#: syntax/data/ruby.xml:33
-msgctxt "Language"
-msgid "Ruby"
-msgstr "Ruby"
-
-#. i18n: tag language attribute name
-#: syntax/data/sather.xml:3
-msgctxt "Language"
-msgid "Sather"
-msgstr "Sather"
-
-#. i18n: tag language attribute name
-#: syntax/data/scala.xml:3
-msgctxt "Language"
-msgid "Scala"
-msgstr "Scala"
-
-#. i18n: tag language attribute name
-#: syntax/data/scheme.xml:43
-msgctxt "Language"
-msgid "Scheme"
-msgstr "Scheme"
-
-#. i18n: tag language attribute name
-#: syntax/data/sci.xml:3
-msgctxt "Language"
-msgid "scilab"
-msgstr "scilab"
-
-#. i18n: tag language attribute name
-#: syntax/data/scss.xml:23
-msgctxt "Language"
-msgid "SCSS"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/sed.xml:3
-msgctxt "Language"
-msgid "sed"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/sgml.xml:3
-msgctxt "Language"
-msgid "SGML"
-msgstr "SGML"
-
-#. i18n: tag language attribute name
-#: syntax/data/sieve.xml:4
-msgctxt "Language"
-msgid "Sieve"
-msgstr "Sieve"
-
-#. i18n: tag language attribute name
-#: syntax/data/sisu.xml:3
-msgctxt "Language"
-msgid "SiSU"
-msgstr "SiSU"
-
-#. i18n: tag language attribute name
-#: syntax/data/sml.xml:3
-msgctxt "Language"
-msgid "SML"
-msgstr "SML"
-
-#. i18n: tag language attribute name
-#: syntax/data/spice.xml:4
-msgctxt "Language"
-msgid "Spice"
-msgstr "Spice"
-
-#. i18n: tag language attribute name
-#: syntax/data/sql-mysql.xml:8
-msgctxt "Language"
-msgid "SQL (MySQL)"
-msgstr "SQL (MySQL)"
-
-#. i18n: tag language attribute name
-#: syntax/data/sql-postgresql.xml:4
-msgctxt "Language"
-msgid "SQL (PostgreSQL)"
-msgstr "SQL (PostgreSQL)"
-
-#. i18n: tag language attribute name
-#: syntax/data/sql.xml:6
-msgctxt "Language"
-msgid "SQL"
-msgstr "SQL"
-
-#. i18n: tag language attribute name
-#: syntax/data/stata.xml:3
-msgctxt "Language"
-msgid "Stata"
-msgstr "Stata"
-
-#. i18n: tag language attribute name
-#: syntax/data/systemc.xml:10
-msgctxt "Language"
-msgid "SystemC"
-msgstr "SystemC"
-
-#. i18n: tag language attribute name
-#: syntax/data/systemverilog.xml:42
-#, fuzzy
-#| msgctxt "Language"
-#| msgid "Verilog"
-msgctxt "Language"
-msgid "SystemVerilog"
-msgstr "Verilog"
-
-#. i18n: tag language attribute name
-#: syntax/data/tads3.xml:5
-msgctxt "Language"
-msgid "TADS 3"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/tcl.xml:31
-msgctxt "Language"
-msgid "Tcl/Tk"
-msgstr "Tcl/Tk"
-
-#. i18n: tag language attribute name
-#: syntax/data/tcsh.xml:11
-msgctxt "Language"
-msgid "Tcsh"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/texinfo.xml:3
-msgctxt "Language"
-msgid "Texinfo"
-msgstr "Texinfo"
-
-#. i18n: tag language attribute name
-#: syntax/data/textile.xml:18
-msgctxt "Language"
-msgid "Textile"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/tibasic.xml:3
-msgctxt "Language"
-msgid "TI Basic"
-msgstr "TI Basic"
-
-#. i18n: tag language attribute name
-#: syntax/data/txt2tags.xml:6
-msgctxt "Language"
-msgid "txt2tags"
-msgstr "txt2tags"
-
-#. i18n: tag language attribute name
-#: syntax/data/uscript.xml:3
-msgctxt "Language"
-msgid "UnrealScript"
-msgstr "UnrealScript"
-
-#. i18n: tag language attribute name
-#: syntax/data/vala.xml:25
-msgctxt "Language"
-msgid "Vala"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/valgrind-suppression.xml:3
-msgctxt "Language"
-msgid "Valgrind Suppression"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/varnish.xml:3
-#, fuzzy
-msgctxt "Language"
-msgid "Varnish Configuration Language"
-msgstr "Izvorni kod"
-
-#. i18n: tag language attribute name
-#: syntax/data/varnishtest.xml:3
-msgctxt "Language"
-msgid "Varnish Test Case language"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/vcard.xml:5
-msgctxt "Language"
-msgid "vCard, vCalendar, iCalendar"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/velocity.xml:3
-msgctxt "Language"
-msgid "Velocity"
-msgstr "Velocity"
-
-#. i18n: tag language attribute name
-#: syntax/data/vera.xml:42
-msgctxt "Language"
-msgid "Vera"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/verilog.xml:3
-msgctxt "Language"
-msgid "Verilog"
-msgstr "Verilog"
-
-#. i18n: tag language attribute name
-#: syntax/data/vhdl.xml:14
-msgctxt "Language"
-msgid "VHDL"
-msgstr "VHDL"
-
-#. i18n: tag language attribute name
-#: syntax/data/vrml.xml:3
-msgctxt "Language"
-msgid "VRML"
-msgstr "VRML"
-
-#. i18n: tag language attribute name
-#: syntax/data/winehq.xml:3
-msgctxt "Language"
-msgid "WINE Config"
-msgstr "WINE postavke"
-
-#. i18n: tag language attribute name
-#: syntax/data/wml.xml:57
-msgctxt "Language"
-msgid "Wesnoth Markup Language"
-msgstr ""
-
-#. i18n: tag language attribute name
-#: syntax/data/xharbour.xml:3
-msgctxt "Language"
-msgid "xHarbour"
-msgstr "xHarbour"
-
-#. i18n: tag language attribute name
-#: syntax/data/xml.xml:9
-msgctxt "Language"
-msgid "XML"
-msgstr "XML"
-
-#. i18n: tag language attribute name
-#: syntax/data/xmldebug.xml:3
-msgctxt "Language"
-msgid "XML (Debug)"
-msgstr "XML (Debug)"
-
-#. i18n: tag language attribute name
-#: syntax/data/xorg.xml:3
-msgctxt "Language"
-msgid "x.org Configuration"
-msgstr "x.org konfiguracija"
-
-#. i18n: tag language attribute name
-#: syntax/data/xslt.xml:55
-msgctxt "Language"
-msgid "xslt"
-msgstr "xslt"
-
-#. i18n: tag language attribute name
-#: syntax/data/xul.xml:7
-msgctxt "Language"
-msgid "XUL"
-msgstr "XUL"
-
-#. i18n: tag language attribute name
-#: syntax/data/yacas.xml:3
-msgctxt "Language"
-msgid "yacas"
-msgstr "yacas"
-
-#. i18n: tag language attribute name
-#: syntax/data/yacc.xml:28
-msgctxt "Language"
-msgid "Yacc/Bison"
-msgstr "Yacc/Bison"
-
-#. i18n: tag language attribute name
-#: syntax/data/yaml.xml:4
-msgctxt "Language"
-msgid "YAML"
-msgstr "YAML"
-
-#. i18n: tag language attribute name
-#: syntax/data/zonnon.xml:3
-msgctxt "Language"
-msgid "Zonnon"
-msgstr "Zonnon"
-
-#. i18n: tag language attribute name
-#: syntax/data/zsh.xml:11
-msgctxt "Language"
-msgid "Zsh"
-msgstr ""
-
-#: syntax/katehighlight.cpp:74
-msgctxt "Syntax highlighting"
-msgid "None"
-msgstr "Ništa"
-
-#: syntax/katehighlight.cpp:835
-msgid "Normal Text"
-msgstr "Normalni tekst"
-
-#: syntax/katehighlight.cpp:1004
-#, fuzzy, kde-format
-#| msgid ""
-#| "%1 : Deprecated syntax. Attribute (%2) not addressed by symbolic "
-#| "name "
-msgid ""
-"%1 : Deprecated syntax. Attribute (%2) not addressed by symbolic "
-"name "
-msgstr ""
-"%1 : Zastarjela sintaksa. Simboličko ime ne navodi na atribut (%2) "
-
-#: syntax/katehighlight.cpp:1511
-#, fuzzy, kde-format
-#| msgid "%1 : Deprecated syntax. Context %2 has no symbolic name "
-msgid "%1 : Deprecated syntax. Context %2 has no symbolic name "
-msgstr "%1 : Zastarjela sintaksa. Sadržaj %2 nema simboličko ime "
-
-#: syntax/katehighlight.cpp:1594
-#, kde-format
-msgid ""
-"%1 :Deprecated syntax. Context %2 not addressed by a symbolic name"
-msgstr "%1 : Zastarjela sintaksa. Sadržaj %2 nema simboličko ime"
-
-#: syntax/katehighlight.cpp:1738
-msgid ""
-"There were warning(s) and/or error(s) while parsing the syntax highlighting "
-"configuration."
-msgstr ""
-"Došlo je do upozorenja i/ili grešaka prilikom parsiranja konfirugracije "
-"bojanja sintakse. "
-
-#: syntax/katehighlight.cpp:1740
-msgid "Kate Syntax Highlighting Parser"
-msgstr "Kate parser bojanja sintakse"
-
-#: syntax/katehighlight.cpp:1906
-msgid ""
-"Since there has been an error parsing the highlighting description, this "
-"highlighting will be disabled"
-msgstr ""
-"Pošto je došlo do greške pri parsiranju opisa bojanja sintakse koda, "
-"ovobojanje će biti isključeno. "
-
-#: syntax/katehighlight.cpp:2133
-#, kde-format
-msgid ""
-"%1 : Specified multiline comment region (%2) could not be resolved "
-msgstr ""
-
-#: syntax/katesyntaxdocument.cpp:80
-#, fuzzy, kde-format
-#| msgid ""
-#| "The error %4 has been detected in the file %1 at %2/%3 "
-msgid ""
-"The error %4 has been detected in the file %1 at %2/%3 "
-msgstr "Greška %4 je detektirana u datoteci %1 na %2/%3 "
-
-#: syntax/katesyntaxdocument.cpp:86
-#, kde-format
-msgid "Unable to open %1"
-msgstr "Ne mogu otvoriti %1"
-
-#: syntax/katesyntaxdocument.cpp:464
-msgid "Errors!"
-msgstr "Greške!"
-
-#: syntax/katesyntaxdocument.cpp:469
-#, kde-format
-msgid "Error: %1"
-msgstr "Greška: %1"
-
-#: syntax/katesyntaxmanager.cpp:147
-msgctxt "@item:intable Text context"
-msgid "Normal"
-msgstr "Normalno"
-
-#: syntax/katesyntaxmanager.cpp:148
-msgctxt "@item:intable Text context"
-msgid "Keyword"
-msgstr "Ključna riječ"
-
-#: syntax/katesyntaxmanager.cpp:149
-msgctxt "@item:intable Text context"
-msgid "Data Type"
-msgstr "Tip podatka"
-
-#: syntax/katesyntaxmanager.cpp:150
-#, fuzzy
-#| msgid "Decimal/Value"
-msgctxt "@item:intable Text context"
-msgid "Decimal/Value"
-msgstr "Decimalni/Vrijednost"
-
-#: syntax/katesyntaxmanager.cpp:151
-#, fuzzy
-#| msgid "Base-N Integer"
-msgctxt "@item:intable Text context"
-msgid "Base-N Integer"
-msgstr "Base-N prirodni broj"
-
-#: syntax/katesyntaxmanager.cpp:152
-msgctxt "@item:intable Text context"
-msgid "Floating Point"
-msgstr "Pomični zarez"
-
-#: syntax/katesyntaxmanager.cpp:153
-msgctxt "@item:intable Text context"
-msgid "Character"
-msgstr "Znak"
-
-#: syntax/katesyntaxmanager.cpp:154
-msgctxt "@item:intable Text context"
-msgid "String"
-msgstr "Znakovni niz"
-
-#: syntax/katesyntaxmanager.cpp:155
-msgctxt "@item:intable Text context"
-msgid "Comment"
-msgstr "Komentar"
-
-#: syntax/katesyntaxmanager.cpp:156
-#, fuzzy
-#| msgid "Others"
-msgctxt "@item:intable Text context"
-msgid "Others"
-msgstr "Drugi"
-
-#: syntax/katesyntaxmanager.cpp:157
-msgctxt "@item:intable Text context"
-msgid "Alert"
-msgstr "Upozorenje"
-
-#: syntax/katesyntaxmanager.cpp:158
-msgctxt "@item:intable Text context"
-msgid "Function"
-msgstr "Funkcija"
-
-#: syntax/katesyntaxmanager.cpp:160
-#, fuzzy
-#| msgid "Region Marker"
-msgctxt "@item:intable Text context"
-msgid "Region Marker"
-msgstr "Obilježivač oblasti"
-
-#: syntax/katesyntaxmanager.cpp:162
-msgctxt "@item:intable Text context"
-msgid "Error"
-msgstr "Greška"
-
-#: utils/kateautoindent.cpp:86
-msgctxt "Autoindent mode"
-msgid "None"
-msgstr "Ništa"
-
-#: utils/kateautoindent.cpp:90
-msgctxt "Autoindent mode"
-msgid "Normal"
-msgstr "Normalno"
-
-#: utils/katebookmarks.cpp:61
-msgid "Set &Bookmark"
-msgstr "Postavi &oznaku"
-
-#: utils/katebookmarks.cpp:65
-msgid "If a line has no bookmark then add one, otherwise remove it."
-msgstr "Ako redak nema oznaku tad ju dodaje. U protivnom je uklanja."
-
-#: utils/katebookmarks.cpp:68
-msgid "Clear &All Bookmarks"
-msgstr "Očisti sve ozn&ake"
-
-#: utils/katebookmarks.cpp:70
-msgid "Remove all bookmarks of the current document."
-msgstr "Uklanje sve oznake u trenutnom dokumentu."
-
-#: utils/katebookmarks.cpp:73 utils/katebookmarks.cpp:244
-msgid "Next Bookmark"
-msgstr "Sljedeća oznaka"
-
-#: utils/katebookmarks.cpp:77
-msgid "Go to the next bookmark."
-msgstr "Kreće na slijedeću oznaku."
-
-#: utils/katebookmarks.cpp:80 utils/katebookmarks.cpp:245
-msgid "Previous Bookmark"
-msgstr "Prethodna oznaka"
-
-#: utils/katebookmarks.cpp:84
-msgid "Go to the previous bookmark."
-msgstr "Povratak na prethodnu oznaku."
-
-#: utils/katebookmarks.cpp:87
-msgid "&Bookmarks"
-msgstr "&Oznake"
-
-#: utils/katebookmarks.cpp:205
-#, kde-format
-msgid "&Next: %1 - \"%2\""
-msgstr "&Slijedeći: %1 – \"%2\""
-
-#: utils/katebookmarks.cpp:212
-#, kde-format
-msgid "&Previous: %1 - \"%2\""
-msgstr "&Prethodni: %1 – \"%2\""
-
-#: utils/katecmds.cpp:92
-msgid " indent
Indents the selected lines or the current line
"
-msgstr ""
-
-#: utils/katecmds.cpp:96
-msgid "unindent
Unindents the selected lines or current line.
"
-msgstr ""
-
-#: utils/katecmds.cpp:100
-msgid ""
-"cleanindent
Cleans up the indentation of the selected lines or "
-"current line according to the indentation settings in the document.
"
-msgstr ""
-
-#: utils/katecmds.cpp:104
-msgid ""
-"comment
Inserts comment markers to make the selection or selected "
-"lines or current line a comment according to the text format as defined by "
-"the syntax highlight definition for the document.
"
-msgstr ""
-
-#: utils/katecmds.cpp:108
-msgid ""
-"uncomment
Removes comment markers from the selection or selected "
-"lines or current line according to the text format as defined by the syntax "
-"highlight definition for the document.
"
-msgstr ""
-
-#: utils/katecmds.cpp:112
-msgid ""
-"goto line number
This command navigates to the specified "
-"line number.
"
-msgstr ""
-
-#: utils/katecmds.cpp:116
-msgid ""
-"set-indent-pasted-text enable
If enabled, indentation of "
-"text pasted from the clipboard is adjusted using the current indenter."
-"p>
Possible true values: 1 on true possible false values: 0 off false"
-"p>"
-msgstr ""
-
-#: utils/katecmds.cpp:122
-#, fuzzy
-#| msgid "Delete the current file type."
-msgid "Deletes the current line."
-msgstr "Izbriši trenutni tip datoteke."
-
-#: utils/katecmds.cpp:125
-msgid ""
-"
set-tab-width width
Sets the tab width to the number "
-"width
"
-msgstr ""
-
-#: utils/katecmds.cpp:129
-msgid ""
-"set-replace-tab enable
If enabled, tabs are replaced with "
-"spaces as you type.
Possible true values: 1 on true possible false "
-"values: 0 off false
"
-msgstr ""
-
-#: utils/katecmds.cpp:135
-msgid ""
-"set-show-tabs enable
If enabled, TAB characters and trailing "
-"whitespace will be visualized by a small dot.
Possible true values: 1 "
-"on true possible false values: 0 off false
"
-msgstr ""
-
-#: utils/katecmds.cpp:141
-msgid ""
-"set-remove-trailing-spaces mode
Removes the trailing spaces "
-"in the document depending on the mode .
Possible values:"
-"
none : never remove trailing spaces.modified : "
-"remove trailing spaces only of modified lines.all : remove "
-"trailing spaces in the entire document. "
-msgstr ""
-
-#: utils/katecmds.cpp:151
-msgid ""
-"set-indent-width width
Sets the indentation width to the "
-"number width . Used only if you are indenting with spaces.
"
-msgstr ""
-
-#: utils/katecmds.cpp:155
-msgid ""
-"set-indent-mode mode
The mode parameter is a value as seen "
-"in the Tools - Indentation menu
"
-msgstr ""
-
-#: utils/katecmds.cpp:159
-msgid ""
-"set-auto-indent enable
Enable or disable autoindentation."
-"p>
possible true values: 1 on true possible false values: 0 off false"
-"p>"
-msgstr ""
-
-#: utils/katecmds.cpp:165
-msgid ""
-"
set-line-numbers enable
Sets the visibility of the line "
-"numbers pane.
possible true values: 1 on true possible false "
-"values: 0 off false
"
-msgstr ""
-
-#: utils/katecmds.cpp:171
-msgid ""
-"set-folding-markers enable
Sets the visibility of the "
-"folding markers pane.
possible true values: 1 on true possible "
-"false values: 0 off false
"
-msgstr ""
-
-#: utils/katecmds.cpp:177
-msgid ""
-"set-icon-border enable
Sets the visibility of the icon "
-"border.
possible true values: 1 on true possible false values: 0 "
-"off false
"
-msgstr ""
-
-#: utils/katecmds.cpp:183
-msgid ""
-"set-word-wrap enable
Enables dynamic word wrap according to "
-"enable
possible true values: 1 on true possible false "
-"values: 0 off false
"
-msgstr ""
-
-#: utils/katecmds.cpp:189
-msgid ""
-"set-word-wrap-column width
Sets the line width for hard "
-"wrapping to width . This is used if you are having your text wrapped "
-"automatically.
"
-msgstr ""
-
-#: utils/katecmds.cpp:193
-msgid ""
-"set-replace-tabs-save enable
When enabled, tabs will be "
-"replaced with whitespace whenever the document is saved.
possible "
-"true values: 1 on true possible false values: 0 off false
"
-msgstr ""
-
-#: utils/katecmds.cpp:199
-msgid ""
-"set-highlight highlight
Sets the syntax highlighting system "
-"for the document. The argument must be a valid highlight name, as seen in "
-"the Tools → Highlighting menu. This command provides an autocompletion list "
-"for its argument.
"
-msgstr ""
-
-#: utils/katecmds.cpp:203
-msgid "set-mode mode
Sets the mode as seen in Tools - Mode
"
-msgstr ""
-
-#: utils/katecmds.cpp:207
-msgid ""
-"set-show-indent enable
If enabled, indentation will be "
-"visualized by a vertical dotted line.
possible true values: 1 on "
-"true possible false values: 0 off false
"
-msgstr ""
-
-#: utils/katecmds.cpp:213
-#, fuzzy
-msgid "Open the Print dialog to print the current document.
"
-msgstr "Ispišite trenutni dokument"
-
-#: utils/katecmds.cpp:335 utils/katecmds.cpp:364
-#, kde-format
-msgid "Missing argument. Usage: %1 "
-msgstr "Nedostaje parametar. Uporaba: %1 "
-
-#: utils/katecmds.cpp:348
-#, kde-format
-msgid "No such highlighting '%1'"
-msgstr "Nema takvog isticanja '%1'"
-
-#: utils/katecmds.cpp:354
-#, kde-format
-msgid "No such mode '%1'"
-msgstr "Nema takvog načina '%1'"
-
-#: utils/katecmds.cpp:369
-#, kde-format
-msgid "Failed to convert argument '%1' to integer."
-msgstr "Neuspješno pretvaranje parametra '%1' u cjelobrojnu vrijednost."
-
-#: utils/katecmds.cpp:374 utils/katecmds.cpp:379
-msgid "Width must be at least 1."
-msgstr "Širina mora biti najmanje 1."
-
-#: utils/katecmds.cpp:384
-msgid "Column must be at least 1."
-msgstr "Stupaca mora biti bar 1."
-
-#: utils/katecmds.cpp:420
-#, kde-format
-msgid "Usage: %1 on|off|1|0|true|false"
-msgstr "Uporaba: %1 on|off|1|0|true|false"
-
-#: utils/katecmds.cpp:447
-#, kde-format
-msgid "Bad argument '%1'. Usage: %2 on|off|1|0|true|false"
-msgstr "Krivi parametar '%1'. Uporaba: %2 on|off|1|0|true|false"
-
-#: utils/katecmds.cpp:452
-msgid ""
-"Usage: set-remove-trailing-spaces 0|-|none or 1|+|mod|modified or 2|*|all"
-msgstr ""
-
-#: utils/katecmds.cpp:466 utils/katecmds.cpp:668
-#, kde-format
-msgid "Unknown command '%1'"
-msgstr "Nepoznata komanda '%1'"
-
-#: utils/katecmds.cpp:560
-#, fuzzy, kde-format
-#| msgid "Missing argument(s). Usage: %1 []"
-msgid "Missing argument. Usage: %1 "
-msgstr "Nedostaje argument(i). Koristiti: %1 []"
-
-#: utils/katecmds.cpp:567
-#, kde-format
-msgid "No mapping found for \"%1\""
-msgstr "Mapiranje za \"%1\" nije nađeno"
-
-#: utils/katecmds.cpp:570
-#, kde-format
-msgid "\"%1\" is mapped to \"%2\""
-msgstr "\"%1\" je pridruženo \"%2\""
-
-#: utils/katecmds.cpp:576
-#, kde-format
-msgid "Missing argument(s). Usage: %1 []"
-msgstr "Nedostaje argument(i). Koristiti: %1 []"
-
-#: utils/katecmds.cpp:644 utils/katecmds.cpp:661
-#, fuzzy
-#| msgid "Arguments"
-msgid "Wrong arguments"
-msgstr "Argumenti"
-
-#: utils/katecmds.cpp:815
-#, fuzzy
-#| msgid "Document to open"
-msgid "Document written to disk"
-msgstr "Dokument za otvoriti"
-
-#: utils/katecmds.cpp:826
-msgid ""
-"w/wa — write document(s) to disk
Usage: w[a]"
-"b>
Writes the current document(s) to disk. It can be called in "
-"two ways: w — writes the current document to disk "
-"wa — writes all document to disk.
If no file name is "
-"associated with the document, a file dialog will be shown.
"
-msgstr ""
-
-#: utils/katecmds.cpp:1067
-#, fuzzy, kde-format
-#| msgid "Text to replace with"
-msgid "replace with %1?"
-msgstr "Zamijeni tekst sa"
-
-#: utils/katecmds.cpp:1073
-#, kde-format
-msgctxt "%2 is the translation of the next message"
-msgid "1 replacement done on %2"
-msgid_plural "%1 replacements done on %2"
-msgstr[0] "%1 zamjena je učinjena na %2"
-msgstr[1] "%1 zamjene su učinjene na %2"
-msgstr[2] "%1 zamjena je učinjeno na %2"
-
-#: utils/katecmds.cpp:1075
-#, kde-format
-msgctxt "substituted into the previous message"
-msgid "1 line"
-msgid_plural "%1 lines"
-msgstr[0] "%1 redak"
-msgstr[1] "%1 retka"
-msgstr[2] "%1 redaka"
-
-#: utils/katecmds.cpp:1104
-msgid ""
-" char identifier
This command allows you to insert literal "
-"characters by their numerical identifier, in decimal, octal or hexadecimal "
-"form.
Examples:
char 234 char 0x1234 "
-"li> "
-msgstr ""
-
-#: utils/katecmds.cpp:1166
-msgid ""
-"date or date format
Inserts a date/time string as defined by "
-"the specified format, or the format yyyy-MM-dd hh:mm:ss if none is specified."
-"
Possible format specifiers are:
d The day as "
-"number without a leading zero (1-31). dd The day as "
-"number with a leading zero (01-31). ddd The "
-"abbreviated localized day name (e.g. 'Mon'..'Sun'). dddd"
-"td> The long localized day name (e.g. 'Monday'..'Sunday'). "
-"tr>M The month as number without a leading zero (1-12)."
-"td> MM The month as number with a leading zero (01-12)."
-"td> MMM The abbreviated localized month name (e.g. "
-"'Jan'..'Dec'). yy The year as two digit number "
-"(00-99). yyyy The year as four digit number "
-"(1752-8000). h The hour without a leading zero "
-"(0..23 or 1..12 if AM/PM display). hh The hour with "
-"a leading zero (00..23 or 01..12 if AM/PM display). m"
-"td> The minute without a leading zero (0..59). mm"
-"td> The minute with a leading zero (00..59). s"
-"td> The second without a leading zero (0..59). ss"
-"td> The second with a leading zero (00..59). z"
-"td> The milliseconds without leading zeroes (0..999). "
-"tr>zzz The milliseconds with leading zeroes (000..999)."
-"td> AP Use AM/PM display. AP will be replaced by either "
-"\"AM\" or \"PM\". ap Use am/pm display. ap will be "
-"replaced by either \"am\" or \"pm\".
"
-msgstr ""
-
-#: utils/kateglobal.cpp:72
-msgid "Kate Part"
-msgstr "Kate Dio"
-
-#: utils/kateglobal.cpp:73
-msgid "Embeddable editor component"
-msgstr "Ugradiva komponenta za uređivanje"
-
-#: utils/kateglobal.cpp:74
-#, fuzzy
-#| msgid "(c) 2000-2009 The Kate Authors"
-msgid "(c) 2000-2014 The Kate Authors"
-msgstr "© 2000–2009 Autori Katea"
-
-#: utils/kateglobal.cpp:98
-msgid "Christoph Cullmann"
-msgstr "Christoph Cullmann"
-
-#: utils/kateglobal.cpp:98
-msgid "Maintainer"
-msgstr "Koordinator"
-
-#: utils/kateglobal.cpp:99
-msgid "Dominik Haumann"
-msgstr "Dominik Haumann"
-
-#: utils/kateglobal.cpp:99 utils/kateglobal.cpp:100 utils/kateglobal.cpp:101
-#: utils/kateglobal.cpp:104 utils/kateglobal.cpp:107 utils/kateglobal.cpp:112
-msgid "Core Developer"
-msgstr "Glavni dio napisao"
-
-#: utils/kateglobal.cpp:100
-msgid "Milian Wolff"
-msgstr ""
-
-#: utils/kateglobal.cpp:101
-msgid "Joseph Wenninger"
-msgstr "Joseph Wenninger"
-
-#: utils/kateglobal.cpp:102
-msgid "Erlend Hamberg"
-msgstr "Erlend Hamberg"
-
-#: utils/kateglobal.cpp:103
-msgid "Bernhard Beschow"
-msgstr "Bernhard Beschow"
-
-#: utils/kateglobal.cpp:103 utils/kateglobal.cpp:119
-msgid "Developer"
-msgstr "Razvijatelji"
-
-#: utils/kateglobal.cpp:104
-msgid "Anders Lund"
-msgstr "Anders Lund"
-
-#: utils/kateglobal.cpp:105
-msgid "Michel Ludwig"
-msgstr "Michel Ludwig"
-
-#: utils/kateglobal.cpp:105
-#, fuzzy
-#| msgid "On-The-Fly Spellcheck"
-msgid "On-the-fly spell checking"
-msgstr "Provjera pravopisa u toku pisanja"
-
-#: utils/kateglobal.cpp:106
-msgid "Pascal Létourneau"
-msgstr ""
-
-#: utils/kateglobal.cpp:106
-msgid "Large scale bug fixing"
-msgstr ""
-
-#: utils/kateglobal.cpp:107
-msgid "Hamish Rodda"
-msgstr "Hamish Rodda"
-
-#: utils/kateglobal.cpp:108
-msgid "Waldo Bastian"
-msgstr "Waldo Bastian"
-
-#: utils/kateglobal.cpp:108
-msgid "The cool buffersystem"
-msgstr "Hladnokrvni 'sustavspremnika'"
-
-#: utils/kateglobal.cpp:109
-msgid "Charles Samuels"
-msgstr "Charles Samuels"
-
-#: utils/kateglobal.cpp:109
-msgid "The Editing Commands"
-msgstr "Naredbe za uređivanje"
-
-#: utils/kateglobal.cpp:110
-msgid "Matt Newell"
-msgstr "Matt Newell"
-
-#: utils/kateglobal.cpp:110
-msgid "Testing, ..."
-msgstr "Ispitivanje,…"
-
-#: utils/kateglobal.cpp:111
-msgid "Michael Bartl"
-msgstr "Michael Bartl"
-
-#: utils/kateglobal.cpp:111
-msgid "Former Core Developer"
-msgstr "Bivši ključni developer"
-
-#: utils/kateglobal.cpp:112
-msgid "Michael McCallum"
-msgstr "Michael McCallum"
-
-#: utils/kateglobal.cpp:113
-msgid "Michael Koch"
-msgstr "Michael Koch"
-
-#: utils/kateglobal.cpp:113
-msgid "KWrite port to KParts"
-msgstr "KWrite prebacio u KParts"
-
-#: utils/kateglobal.cpp:114
-msgid "Christian Gebauer"
-msgstr "Christian Gebauer"
-
-#: utils/kateglobal.cpp:115
-msgid "Simon Hausmann"
-msgstr "Simon Hausmann"
-
-#: utils/kateglobal.cpp:116
-msgid "Glen Parker"
-msgstr "Glen Parker"
-
-#: utils/kateglobal.cpp:116
-msgid "KWrite Undo History, Kspell integration"
-msgstr "KWrite vraćanje izmjena, integracija KSpell-a"
-
-#: utils/kateglobal.cpp:117
-msgid "Scott Manson"
-msgstr "Scott Manson"
-
-#: utils/kateglobal.cpp:117
-msgid "KWrite XML Syntax highlighting support"
-msgstr "KWrite podrška za označivanje XML sintakse"
-
-#: utils/kateglobal.cpp:118
-msgid "John Firebaugh"
-msgstr "John Firebaugh"
-
-#: utils/kateglobal.cpp:118
-msgid "Patches and more"
-msgstr "Zakrpe i ostalo"
-
-#: utils/kateglobal.cpp:119
-msgid "Andreas Kling"
-msgstr "Andreas Kling"
-
-#: utils/kateglobal.cpp:120
-msgid "Mirko Stocker"
-msgstr "Mirko Stocker"
-
-#: utils/kateglobal.cpp:120
-msgid "Various bugfixes"
-msgstr "Razni "
-
-#: utils/kateglobal.cpp:121
-msgid "Matthew Woehlke"
-msgstr "Matthew Woehlke"
-
-#: utils/kateglobal.cpp:121
-msgid "Selection, KColorScheme integration"
-msgstr "Odabir, KColorScheme integracija"
-
-#: utils/kateglobal.cpp:122
-msgid "Sebastian Pipping"
-msgstr "Sebastian Pipping"
-
-#: utils/kateglobal.cpp:122
-msgid "Search bar back- and front-end"
-msgstr ""
-
-#: utils/kateglobal.cpp:123
-#, fuzzy
-#| msgid "Jochen Wilhemly"
-msgid "Jochen Wilhelmy"
-msgstr "Jochen Wilhemly"
-
-#: utils/kateglobal.cpp:123
-#, fuzzy
-#| msgid "KWrite Author"
-msgid "Original KWrite Author"
-msgstr "KWrite autor"
-
-#: utils/kateglobal.cpp:124
-msgid "Gerald Senarclens de Grancy"
-msgstr ""
-
-#: utils/kateglobal.cpp:124
-#, fuzzy
-#| msgctxt "Language"
-#| msgid "Quake Script"
-msgid "QA and Scripting"
-msgstr "Quake Script"
-
-#: utils/kateglobal.cpp:126
-msgid "Matteo Merli"
-msgstr "Matteo Merli"
-
-#: utils/kateglobal.cpp:126
-msgid "Highlighting for RPM Spec-Files, Perl, Diff and more"
-msgstr "Označavanje za RPM spec-datoteke, Perl, Diff i drugo"
-
-#: utils/kateglobal.cpp:127
-msgid "Rocky Scaletta"
-msgstr "Rocky Scaletta"
-
-#: utils/kateglobal.cpp:127
-msgid "Highlighting for VHDL"
-msgstr "Osvjetljavanje za VHDL"
-
-#: utils/kateglobal.cpp:128
-msgid "Yury Lebedev"
-msgstr "Yury Lebedev"
-
-#: utils/kateglobal.cpp:128
-msgid "Highlighting for SQL"
-msgstr "Osvjetljavanje SQL"
-
-#: utils/kateglobal.cpp:129
-msgid "Chris Ross"
-msgstr "Chris Ross"
-
-#: utils/kateglobal.cpp:129
-msgid "Highlighting for Ferite"
-msgstr "Osvjetljavanje Ferite"
-
-#: utils/kateglobal.cpp:130
-msgid "Nick Roux"
-msgstr "Nick Roux"
-
-#: utils/kateglobal.cpp:130
-msgid "Highlighting for ILERPG"
-msgstr "Osvjetljavanje ILERPG"
-
-#: utils/kateglobal.cpp:131
-msgid "Carsten Niehaus"
-msgstr "Carsten Niehaus"
-
-#: utils/kateglobal.cpp:131
-msgid "Highlighting for LaTeX"
-msgstr "Osvjetljavanje LaTeX"
-
-#: utils/kateglobal.cpp:132
-msgid "Per Wigren"
-msgstr "Per Wigren"
-
-#: utils/kateglobal.cpp:132
-msgid "Highlighting for Makefiles, Python"
-msgstr "Osvjetljavanje makefile datoteka, Python"
-
-#: utils/kateglobal.cpp:133
-msgid "Jan Fritz"
-msgstr "Jan Fritz"
-
-#: utils/kateglobal.cpp:133
-msgid "Highlighting for Python"
-msgstr "Osvjetljavanje Python"
-
-#: utils/kateglobal.cpp:134
-msgid "Daniel Naber"
-msgstr "Daniel Naber"
-
-#: utils/kateglobal.cpp:135
-msgid "Roland Pabel"
-msgstr "Roland Pabel"
-
-#: utils/kateglobal.cpp:135
-msgid "Highlighting for Scheme"
-msgstr "Osvjetljavanje Scheme"
-
-#: utils/kateglobal.cpp:136
-msgid "Cristi Dumitrescu"
-msgstr "Cristi Dumitrescu"
-
-#: utils/kateglobal.cpp:136
-msgid "PHP Keyword/Datatype list"
-msgstr "Popis PHP kjučnih_riječi/vrste_podataka"
-
-#: utils/kateglobal.cpp:137
-msgid "Carsten Pfeiffer"
-msgstr "Carsten Pfeiffer"
-
-#: utils/kateglobal.cpp:137
-msgid "Very nice help"
-msgstr "Vrlo lijepa pomoć"
-
-#: utils/kateglobal.cpp:138
-msgid "Bruno Massa"
-msgstr "Bruno Massa"
-
-#: utils/kateglobal.cpp:138
-msgid "Highlighting for Lua"
-msgstr "Osvjetljavanje za Luau"
-
-#: utils/kateglobal.cpp:140
-msgid "All people who have contributed and I have forgotten to mention"
-msgstr "Svi ljudi koji su doprinjeli a ja sam ih zaboravio spomenuti"
-
-#: utils/kateglobal.cpp:142
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr ""
-"Anđelko Iharoš, Andrija Piličić, Dario Lah, Darko Bednjanec, Denis Lackovic, "
-"Diana Ćorluka, Hrvoje Spoljar, Kresimir Kalafatic, Robert Pezer, Robert "
-"Sedak, Vedran Rodic, Vedran Vyroubal"
-
-#: utils/kateglobal.cpp:142
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr ""
-"lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, "
-"lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, "
-"lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, "
-"lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr"
-
-#: utils/kateglobal.cpp:294
-msgid "Configure"
-msgstr "Podesi"
-
-#: utils/kateglobal.cpp:368 utils/kateglobal.cpp:390
-msgid "Appearance"
-msgstr "Izgled"
-
-#: utils/kateglobal.cpp:371
-msgid "Fonts & Colors"
-msgstr "Pisma i boje"
-
-#: utils/kateglobal.cpp:377
-msgid "Open/Save"
-msgstr "Otvori / Spremi"
-
-#: utils/kateglobal.cpp:393
-msgid "Font & Color Schemas"
-msgstr "Palete pisama i boja"
-
-#: utils/kateglobal.cpp:396
-msgid "Editing Options"
-msgstr "Podešavanje izmjena"
-
-#: utils/kateglobal.cpp:399
-msgid "File Opening & Saving"
-msgstr "Otvaranje i spremanje datoteke"
-
-#: utils/templateinterface.cpp:62
-msgid ""
-"The template needs information about you, which is stored in your address "
-"book.\n"
-"However, the required plugin could not be loaded.\n"
-"\n"
-"Please install the KDEPIM/Kontact package for your system."
-msgstr ""
-
-#: variableeditor/katehelpbutton.cpp:32
-msgid "Kate Handbook."
-msgstr ""
-
-#: variableeditor/variableeditor.cpp:189
-#, fuzzy
-#| msgid "Struct"
-msgid "true"
-msgstr "Struktura"
-
-#: variableeditor/variableeditor.cpp:190
-msgid "false"
-msgstr ""
-
-#: variableeditor/variableeditor.cpp:326
-msgctxt "value for variable remove-trailing-spaces"
-msgid "none"
-msgstr ""
-
-#: variableeditor/variableeditor.cpp:327
-msgctxt "value for variable remove-trailing-spaces"
-msgid "modified"
-msgstr ""
-
-#: variableeditor/variableeditor.cpp:328
-msgctxt "value for variale remove-trailing-spaces"
-msgid "all"
-msgstr ""
-
-#: variableeditor/variablelineedit.cpp:60
-msgid "Show list of valid variables."
-msgstr ""
-
-#: variableeditor/variablelineedit.cpp:137
-#, fuzzy
-#| msgid "The number of spaces to indent with."
-msgctxt "short translation please"
-msgid "Set the number of autocenter lines."
-msgstr "Broj razmaka za uvlačenje."
-
-#: variableeditor/variablelineedit.cpp:142
-msgctxt "short translation please"
-msgid "Auto insert asterisk in doxygen comments."
-msgstr ""
-
-#: variableeditor/variablelineedit.cpp:147
-#, fuzzy
-#| msgid "S&elected Background Color..."
-msgctxt "short translation please"
-msgid "Set the document background color."
-msgstr "Odabrana boja pozadine…"
-
-#: variableeditor/variablelineedit.cpp:152
-#, fuzzy
-#| msgid "&Backspace key indents"
-msgctxt "short translation please"
-msgid "Pressing backspace in leading whitespace unindents."
-msgstr "&Backspace tipka uvlači"
-
-#: variableeditor/variablelineedit.cpp:160
-#, fuzzy
-#| msgid "Bl&ock Selection Mode"
-msgctxt "short translation please"
-msgid "Enable block selection mode."
-msgstr "Uključi/isključi režim bl&okovskog označavanja"
-
-#: variableeditor/variablelineedit.cpp:165
-msgctxt "short translation please"
-msgid "Enable the byte order marker when saving unicode files."
-msgstr ""
-
-#: variableeditor/variablelineedit.cpp:170
-msgctxt "short translation please"
-msgid "Set the color for the bracket highlight."
-msgstr ""
-
-#: variableeditor/variablelineedit.cpp:175
-#, fuzzy
-#| msgid "Sets the background color of the editing area.
"
-msgctxt "short translation please"
-msgid "Set the background color for the current line."
-msgstr "Podešava boju pozadine područja uređivanja teksta.
"
-
-#: variableeditor/variablelineedit.cpp:181
-#, fuzzy
-#| msgid "Change the dictionary that is used for spell checking."
-msgctxt "short translation please"
-msgid "Set the default dictionary used for spell checking."
-msgstr "Promijeni riječnik koji se koristi za provjeru pravopisa."
-
-#: variableeditor/variablelineedit.cpp:186
-#, fuzzy
-#| msgid "Enable static &word wrap"
-msgctxt "short translation please"
-msgid "Enable dynamic word wrap of long lines."
-msgstr "Uključi statičko &prelamanje teksta"
-
-#: variableeditor/variablelineedit.cpp:191
-#, fuzzy
-#| msgid "Select to End of Line"
-msgctxt "short translation please"
-msgid "Sets the end of line mode."
-msgstr "Označi do kraja retka"
-
-#: variableeditor/variablelineedit.cpp:196
-msgctxt "short translation please"
-msgid "Enable folding markers in the editor border."
-msgstr ""
-
-#: variableeditor/variablelineedit.cpp:202
-#, fuzzy
-#| msgid "Select the entire text of the current document."
-msgctxt "short translation please"
-msgid "Set the point size of the document font."
-msgstr "Označava cijeli tekst trenutnog dokumenta."
-
-#: variableeditor/variablelineedit.cpp:207
-#, fuzzy
-#| msgid "Select the entire text of the current document."
-msgctxt "short translation please"
-msgid "Set the font of the document."
-msgstr "Označava cijeli tekst trenutnog dokumenta."
-
-#: variableeditor/variablelineedit.cpp:222
-#, fuzzy
-#| msgid "Kate Syntax Highlighting Parser"
-msgctxt "short translation please"
-msgid "Set the syntax highlighting."
-msgstr "Kate parser bojanja sintakse"
-
-#: variableeditor/variablelineedit.cpp:227
-msgctxt "short translation please"
-msgid "Set the icon bar color."
-msgstr ""
-
-#: variableeditor/variablelineedit.cpp:232
-msgctxt "short translation please"
-msgid "Enable the icon border in the editor view."
-msgstr ""
-
-#: variableeditor/variablelineedit.cpp:237
-#, fuzzy
-#| msgid "Show i&ndentation lines"
-msgctxt "short translation please"
-msgid "Set the auto indentation style."
-msgstr "Prikaži &uvučene retke"
-
-#: variableeditor/variablelineedit.cpp:242
-#, fuzzy
-#| msgid "Adjust indentation of code pasted from the clipboard"
-msgctxt "short translation please"
-msgid "Adjust indentation of text pasted from the clipboard."
-msgstr "Prilagodi uvlačenje odlomaka koda zalijepljenog iz odlagališta"
-
-#: variableeditor/variablelineedit.cpp:248
-msgctxt "short translation please"
-msgid "Set the indentation depth for each indent level."
-msgstr ""
-
-#: variableeditor/variablelineedit.cpp:253
-msgctxt "short translation please"
-msgid "Allow odd indentation level (no multiple of indent width)."
-msgstr ""
-
-#: variableeditor/variablelineedit.cpp:258
-#, fuzzy
-#| msgid "Show &line numbers"
-msgctxt "short translation please"
-msgid "Show line numbers."
-msgstr "Pokaži brojeve &linija"
-
-#: variableeditor/variablelineedit.cpp:263
-msgctxt "short translation please"
-msgid "Insert newline at end of file on save."
-msgstr ""
-
-#: variableeditor/variablelineedit.cpp:268
-msgctxt "short translation please"
-msgid "Enable overwrite mode in the document."
-msgstr ""
-
-#: variableeditor/variablelineedit.cpp:273
-msgctxt "short translation please"
-msgid "Enable persistent text selection."
-msgstr ""
-
-#: variableeditor/variablelineedit.cpp:278
-msgctxt "short translation please"
-msgid "Replace tabs with spaces when saving the document."
-msgstr ""
-
-#: variableeditor/variablelineedit.cpp:283
-#, fuzzy
-msgctxt "short translation please"
-msgid "Replace tabs with spaces."
-msgstr "Zamjeni tekst"
-
-#: variableeditor/variablelineedit.cpp:288
-#, fuzzy
-#| msgid "Remove &trailing spaces while editing"
-msgctxt "short translation please"
-msgid "Remove trailing spaces when saving the document."
-msgstr "Ukloni &praznine na kraju retka prilikom uređivanja"
-
-#: variableeditor/variablelineedit.cpp:297
-#, fuzzy
-#| msgid "Font & Color Schemas"
-msgctxt "short translation please"
-msgid "Set the color scheme."
-msgstr "Palete pisama i boja"
-
-#: variableeditor/variablelineedit.cpp:302
-msgctxt "short translation please"
-msgid "Set the text selection color."
-msgstr ""
-
-#: variableeditor/variablelineedit.cpp:307
-#, fuzzy
-#| msgid "Highlighting Rules"
-msgctxt "short translation please"
-msgid "Visualize tabs and trailing spaces."
-msgstr "Osvjetljavanje"
-
-#: variableeditor/variablelineedit.cpp:312
-#, fuzzy
-msgctxt "short translation please"
-msgid "Enable smart home navigation."
-msgstr "Iskači s popisom nadopunjavanja"
-
-#: variableeditor/variablelineedit.cpp:317
-#, fuzzy
-#| msgid "&Tab key indents"
-msgctxt "short translation please"
-msgid "Pressing TAB key indents."
-msgstr "&Tab tipka uvlači"
-
-#: variableeditor/variablelineedit.cpp:323
-msgctxt "short translation please"
-msgid "Set the tab display width."
-msgstr ""
-
-#: variableeditor/variablelineedit.cpp:329
-#, fuzzy
-#| msgid ""
-#| "Sets the number of undo/redo steps to record. More steps uses more memory."
-msgctxt "short translation please"
-msgid "Set the number of undo steps to remember (0 equals infinity)."
-msgstr ""
-"Podešavanje broja koraka koji će se pamtiti da bi se mogli vratiti/ponoviti. "
-"Više koraka traži više mjesta u vašem računalu.."
-
-#: variableeditor/variablelineedit.cpp:335
-msgctxt "short translation please"
-msgid "Set the word wrap column."
-msgstr ""
-
-#: variableeditor/variablelineedit.cpp:340
-#, fuzzy
-#| msgid "S&elected Background Color..."
-msgctxt "short translation please"
-msgid "Set the word wrap marker color."
-msgstr "Odabrana boja pozadine…"
-
-#: variableeditor/variablelineedit.cpp:345
-msgctxt "short translation please"
-msgid "Enable word wrap while typing text."
-msgstr ""
-
-#: view/katestatusbar.cpp:82
-msgid "Current cursor position. Doubleclick to go to specific line."
-msgstr ""
-
-#: view/katestatusbar.cpp:92
-msgid "Insert mode and VI input mode indicator"
-msgstr ""
-
-#: view/katestatusbar.cpp:97
-#, kde-format
-msgid "Soft Tabs: %1"
-msgstr ""
-
-#: view/katestatusbar.cpp:98
-#, kde-format
-msgid "Soft Tabs: %1 (%2)"
-msgstr ""
-
-#: view/katestatusbar.cpp:99
-#, kde-format
-msgid "Tab Size: %1"
-msgstr ""
-
-#: view/katestatusbar.cpp:100
-#, kde-format
-msgid "Indent/Tab: %1/%2"
-msgstr ""
-
-#: view/katestatusbar.cpp:108
-msgid "Show Tabs As"
-msgstr ""
-
-#: view/katestatusbar.cpp:114
-#, fuzzy
-#| msgid "Indentation width:"
-msgid "Indentation Width"
-msgstr "Širina uvlačenja:"
-
-#: view/katestatusbar.cpp:123
-msgid "Mixed Tabs (Spaces + Tabs)"
-msgstr ""
-
-#: view/katestatusbar.cpp:127
-msgid "Hard Tabs (Tabs)"
-msgstr ""
-
-#: view/katestatusbar.cpp:131
-msgid "Soft Tabs (Spaces)"
-msgstr ""
-
-#: view/katestatusbar.cpp:168
-#, fuzzy
-#| msgid "E&ncoding"
-msgid "Encoding"
-msgstr "&Kodiranje:"
-
-#: view/katestatusbar.cpp:179
-#, fuzzy
-#| msgid "Kate Syntax Highlighting Parser"
-msgid "Syntax highlighting"
-msgstr "Kate parser bojanja sintakse"
-
-#: view/katestatusbar.cpp:256
-#, kde-format
-msgid "[BLOCK] %1"
-msgstr ""
-
-#: view/katestatusbar.cpp:266
-#, fuzzy, kde-format
-#| msgid " Line: %1 Col: %2 "
-msgid "Line %1, Column %2"
-msgstr " Redak: %1 Kolona: %2 "
-
-#: view/katestatusbar.cpp:289
-msgid "Meaning of current icon: Document was modified since it was loaded"
-msgstr ""
-
-#: view/katestatusbar.cpp:294
-#, fuzzy
-msgid ""
-"Meaning of current icon: Document was modified or deleted by another program"
-msgstr ""
-"Datoteka %1 je izmjenjena (obrisana) na disku od strane drugog programa!\n"
-"\n"
-
-#: view/katestatusbar.cpp:305
-msgid "Meaning of current icon: Document was not modified since it was loaded"
-msgstr ""
-
-#: view/katestatusbar.cpp:355
-#, fuzzy
-msgid "Other..."
-msgstr "Ostalo"
-
-#: view/katestatusbar.cpp:375
-#, fuzzy
-msgid "Other"
-msgstr "Ostalo"
-
-#: view/katestatusbar.cpp:377
-#, fuzzy, kde-format
-msgid "Other (%1)"
-msgid_plural "Other (%1)"
-msgstr[0] "Ostalo"
-msgstr[1] "Ostalo"
-msgstr[2] "Ostalo"
-
-#: view/katestatusbar.cpp:387
-#, fuzzy
-#| msgid "Tab wi&dth:"
-msgid "Tab width"
-msgstr "Širina ta&bulatora:"
-
-#: view/katestatusbar.cpp:387 view/katestatusbar.cpp:398
-msgid "[1-16]"
-msgstr ""
-
-#: view/katestatusbar.cpp:398
-#, fuzzy
-#| msgid "Indentation width:"
-msgid "Indentation width"
-msgstr "Širina uvlačenja:"
-
-#: view/kateview.cpp:330
-msgid "Cut the selected text and move it to the clipboard"
-msgstr "Izreži izabarani tekst i premjesti ga u odlagalište"
-
-#: view/kateview.cpp:333
-msgid "Paste previously copied or cut clipboard contents"
-msgstr "Umetni kopirani ili izrezeani sadržaj odlagališta"
-
-#: view/kateview.cpp:336
-msgid ""
-"Use this command to copy the currently selected text to the system clipboard."
-msgstr ""
-"Upotrjebite ovu naredbu za kopiranje označenog teksta u sustavsko "
-"odlagalište. "
-
-#: view/kateview.cpp:338
-msgid "Clipboard &History"
-msgstr ""
-
-#: view/kateview.cpp:343
-msgid "Save the current document"
-msgstr "Spremi trenutni dokument"
-
-#: view/kateview.cpp:346
-msgid "Revert the most recent editing actions"
-msgstr "Vrati zadnje operacije editiranja. "
-
-#: view/kateview.cpp:349
-msgid "Revert the most recent undo operation"
-msgstr "Vrati zadnju radnju poništavanja. "
-
-#: view/kateview.cpp:352
-#, fuzzy
-#| msgid "Scripts"
-msgid "&Scripts"
-msgstr "Skripte"
-
-#: view/kateview.cpp:356
-msgid "Apply &Word Wrap"
-msgstr "Promijeni &omatanje teksta"
-
-#: view/kateview.cpp:357
-msgid ""
-"Use this command to wrap all lines of the current document which are longer "
-"than the width of the current view, to fit into this view. This "
-"is a static word wrap, meaning it is not updated when the view is resized."
-msgstr ""
-"Koristite ovu naredbu za prelamanje svih linija trenutnog dokumenta koje su "
-"dulje od širine trenutnog prikaza, kako bi stale u prikaz. "
-"Ovo je statično prelamanje teksta, što znači da neće biti ažurirano pri "
-"promjeni veličine prozora."
-
-#: view/kateview.cpp:363
-msgid "&Clean Indentation"
-msgstr "Poništi &sva uvlačenja"
-
-#: view/kateview.cpp:364
-msgid ""
-"Use this to clean the indentation of a selected block of text (only tabs/"
-"only spaces). You can configure whether tabs should be honored "
-"and used or replaced with spaces, in the configuration dialog."
-msgstr ""
-"Koristite ovo za uklanjanje uvlačenja odabranog bloka teksta (samo "
-"tabulacije/samo razmaci) U dijalogu s postavkama možete "
-"podesiti hoće li se tabulacije poštovati i koristiti ili će biti zamijenjene "
-"s razmacima."
-
-#: view/kateview.cpp:369
-msgid "&Align"
-msgstr "&Poravnaj"
-
-#: view/kateview.cpp:370
-msgid ""
-"Use this to align the current line or block of text to its proper indent "
-"level."
-msgstr ""
-"Koristite ovo za poravnavanje trenutne linije ili bloka teksta na njegovu "
-"pravu razinu uvlačenja."
-
-#: view/kateview.cpp:374
-msgid "C&omment"
-msgstr "K&omentar"
-
-#: view/kateview.cpp:376
-msgid ""
-"This command comments out the current line or a selected block of text. The characters for single/multiple line comments are defined within "
-"the language's highlighting."
-msgstr ""
-"Ova naredba skomentira trenutnu liniju ili odabrani blok teksta. Znakovi za označavanje jednorednih/višerednih komentara su definirani u "
-"naglašavanju jezika."
-
-#: view/kateview.cpp:381
-msgid "Unco&mment"
-msgstr "U&kloni komentar"
-
-#: view/kateview.cpp:383
-msgid ""
-"This command removes comments from the current line or a selected block of "
-"text. The characters for single/multiple line comments are "
-"defined within the language's highlighting."
-msgstr ""
-"Ova naredba uklanja komentare iz trenutne linije ili odabranog bloka teksta."
-" Znakovi za označavanje jednorednih/višerednih komentara su "
-"definirani u naglašavanju jezika."
-
-#: view/kateview.cpp:388
-#, fuzzy
-#| msgctxt "@item:intable Text context"
-#| msgid "Comment"
-msgid "Toggle Comment"
-msgstr "Komentar"
-
-#: view/kateview.cpp:391
-msgid "&Read Only Mode"
-msgstr "&Režim „samo za čitanje“"
-
-#: view/kateview.cpp:392
-msgid "Lock/unlock the document for writing"
-msgstr "Zaključaj/odključaj dokument za pisanje"
-
-#: view/kateview.cpp:398
-msgid "Uppercase"
-msgstr "Velika slova"
-
-#: view/kateview.cpp:400
-msgid ""
-"Convert the selection to uppercase, or the character to the right of the "
-"cursor if no text is selected."
-msgstr ""
-"Pretvara označeni tekst u velika slova, ili znak desno od kursora ako tekst "
-"nije selektiran."
-
-#: view/kateview.cpp:405
-msgid "Lowercase"
-msgstr "Mala slova"
-
-#: view/kateview.cpp:407
-msgid ""
-"Convert the selection to lowercase, or the character to the right of the "
-"cursor if no text is selected."
-msgstr ""
-"Pretvara označeni tekst u mala slova, ili znak desno od kursora ako tekst "
-"nije selektiran. "
-
-#: view/kateview.cpp:412
-msgid "Capitalize"
-msgstr "Pretvori u velika slova"
-
-#: view/kateview.cpp:414
-msgid ""
-"Capitalize the selection, or the word under the cursor if no text is "
-"selected."
-msgstr ""
-"Kapitalizira označeni tekst (prva slova riječi pretvara u velika), ili riječ "
-"pod kursorom ako nema odabranog teksta."
-
-#: view/kateview.cpp:419
-msgid "Join Lines"
-msgstr "Spoji retke"
-
-#: view/kateview.cpp:424
-msgid "Invoke Code Completion"
-msgstr "Prizovi dovršavanje koda"
-
-#: view/kateview.cpp:425
-msgid ""
-"Manually invoke command completion, usually by using a shortcut bound to "
-"this action."
-msgstr "Ručno pozovi naredbu dovršavanja, najčešće pomoću prečice."
-
-#: view/kateview.cpp:437
-msgid "Print the current document."
-msgstr "Ispišite trenutni dokument"
-
-#: view/kateview.cpp:440
-#, fuzzy
-#| msgid "Print the current document."
-msgid "Show print preview of current document"
-msgstr "Ispišite trenutni dokument"
-
-#: view/kateview.cpp:444
-msgid "Reloa&d"
-msgstr "Ponovno &učitaj"
-
-#: view/kateview.cpp:446
-msgid "Reload the current document from disk."
-msgstr "Ponovo učitava trenutni dokument sa diska."
-
-#: view/kateview.cpp:450
-msgid "Save the current document to disk, with a name of your choice."
-msgstr "Spremi trenutni dokument na disk, sa imenom po vašem izboru."
-
-#: view/kateview.cpp:454
-#, fuzzy
-#| msgid "&Save File As..."
-msgid "Save &Copy As..."
-msgstr "Spremi datoteku &kao…"
-
-#: view/kateview.cpp:455
-#, fuzzy
-#| msgid "Reload the current document from disk."
-msgid "Save a copy of the current document to disk."
-msgstr "Ponovo učitava trenutni dokument sa diska."
-
-#: view/kateview.cpp:459
-msgid ""
-"This command opens a dialog and lets you choose a line that you want the "
-"cursor to move to."
-msgstr ""
-"Ova naredba otvara dialog i omogućava vam da odaberete liniju na koju želite "
-"da se pomakne kursor."
-
-#: view/kateview.cpp:462
-msgid "&Configure Editor..."
-msgstr "&Postavke uređivača…"
-
-#: view/kateview.cpp:463
-msgid "Configure various aspects of this editor."
-msgstr "Podešava razne aspekte ovog editora."
-
-#: view/kateview.cpp:466
-msgid "&Mode"
-msgstr "&Način"
-
-#: view/kateview.cpp:468
-msgid ""
-"Here you can choose which mode should be used for the current document. This "
-"will influence the highlighting and folding being used, for example."
-msgstr ""
-"Ovdje možete odabrati koji način će biti korišten za trenutni dokument. To "
-"će utjecati na primjer na naglašavanje i slaganje teksta."
-
-#: view/kateview.cpp:471
-msgid "&Highlighting"
-msgstr "&Osvjetljavanje"
-
-#: view/kateview.cpp:473
-msgid "Here you can choose how the current document should be highlighted."
-msgstr ""
-"Ovdje možete odabrati način na koji bi trenutni dokument trebao biti obojen."
-
-#: view/kateview.cpp:476
-msgid "&Schema"
-msgstr "&Shema"
-
-#: view/kateview.cpp:481
-msgid "&Indentation"
-msgstr "&Uvlačenje"
-
-#: view/kateview.cpp:485
-msgid "Select the entire text of the current document."
-msgstr "Označava cijeli tekst trenutnog dokumenta."
-
-#: view/kateview.cpp:488
-msgid ""
-"If you have selected something within the current document, this will no "
-"longer be selected."
-msgstr ""
-"Ako ste odabrali nešto iz trenutnog dokumenta, ovo više neće biti odabrano."
-
-#: view/kateview.cpp:492
-msgid "Enlarge Font"
-msgstr "Povećaj Pismo"
-
-#: view/kateview.cpp:494
-msgid "This increases the display font size."
-msgstr "Povećavanje veličine fonta."
-
-#: view/kateview.cpp:499
-msgid "Shrink Font"
-msgstr "Smanji pismo"
-
-#: view/kateview.cpp:501
-msgid "This decreases the display font size."
-msgstr "Smanjivanje veličine fonta."
-
-#: view/kateview.cpp:504
-msgid "Bl&ock Selection Mode"
-msgstr "Uključi/isključi režim bl&okovskog označavanja"
-
-#: view/kateview.cpp:507
-msgid ""
-"This command allows switching between the normal (line based) selection mode "
-"and the block selection mode."
-msgstr ""
-"Ova komanda omogućuje prebacivanje između normalnog (baziranog na linijama)"
-"načina odabira i odabira blokova teksta."
-
-#: view/kateview.cpp:510
-msgid "Overwr&ite Mode"
-msgstr "Rež&im prepisivanja"
-
-#: view/kateview.cpp:513
-msgid ""
-"Choose whether you want the text you type to be inserted or to overwrite "
-"existing text."
-msgstr ""
-"Odaberite želite li da tekst koji tipkate bude umetnut ili da se prepisuje "
-"postojeći tekst. "
-
-#: view/kateview.cpp:523
-msgid "Dynamic Word Wrap Indicators"
-msgstr "Dinamički indikatori omatanja riječi"
-
-#: view/kateview.cpp:525
-msgid "Choose when the Dynamic Word Wrap Indicators should be displayed"
-msgstr "Odaberite kad se dinamički indikatori omatanja riječi trebaju pokazati"
-
-#: view/kateview.cpp:529
-msgid "&Off"
-msgstr "&Isključi"
-
-#: view/kateview.cpp:530
-msgid "Follow &Line Numbers"
-msgstr "&Prati brojeve redaka"
-
-#: view/kateview.cpp:531
-msgid "&Always On"
-msgstr "&Uvijek uključen"
-
-#: view/kateview.cpp:535
-msgid "Show Folding &Markers"
-msgstr "Pokaži oznake preklapanja"
-
-#: view/kateview.cpp:538
-msgid ""
-"You can choose if the codefolding marks should be shown, if codefolding is "
-"possible."
-msgstr ""
-"Možete odabrati jesu li oznake preklapanja pokazane, ako je preklapanje "
-"moguće."
-
-#: view/kateview.cpp:541
-msgid "Show &Icon Border"
-msgstr "Pokaži okvir &ikona"
-
-#: view/kateview.cpp:544
-msgid ""
-"Show/hide the icon border. The icon border shows bookmark "
-"symbols, for instance."
-msgstr ""
-"Prikaži/sakrij rub ikone. Rub ikone primjerice prikazuje "
-"simbole oznaka (bookmarks)."
-
-#: view/kateview.cpp:547
-msgid "Show &Line Numbers"
-msgstr "Prikaži brojeve &redaka"
-
-#: view/kateview.cpp:550
-msgid "Show/hide the line numbers on the left hand side of the view."
-msgstr "Pokaži/sakrij brojeve linija na lijevoj strani pogleda."
-
-#: view/kateview.cpp:553
-msgid "Show Scroll&bar Marks"
-msgstr "Prikaži oznake klizača"
-
-#: view/kateview.cpp:555
-msgid ""
-"Show/hide the marks on the vertical scrollbar. The marks show "
-"bookmarks, for instance."
-msgstr ""
-"Prikaži/sakrij oznake na okomitom klizaču. Te oznake npr. "
-"prikazuju korisničke oznake (bookmarks)."
-
-#: view/kateview.cpp:558
-#, fuzzy
-#| msgid "Show Scroll&bar Marks"
-msgid "Show Scrollbar Mini-Map"
-msgstr "Prikaži oznake klizača"
-
-#: view/kateview.cpp:560
-#, fuzzy
-#| msgid ""
-#| "Show/hide the marks on the vertical scrollbar. The marks show "
-#| "bookmarks, for instance."
-msgid ""
-"Show/hide the mini-map on the vertical scrollbar. The mini-map "
-"shows an overview of the whole document."
-msgstr ""
-"Prikaži/sakrij oznake na okomitom klizaču. Te oznake npr. "
-"prikazuju korisničke oznake (bookmarks)."
-
-#: view/kateview.cpp:569
-msgid "Show Static &Word Wrap Marker"
-msgstr "Prikazuj marker &statičkog prijeloma "
-
-#: view/kateview.cpp:572
-msgid ""
-"Show/hide the Word Wrap Marker, a vertical line drawn at the word wrap "
-"column as defined in the editing properties"
-msgstr ""
-"Pokaži/sakrij marker za omatanje riječi, vertikalna redak nacrtan na stupcu "
-"omatanja riječi kako je definirano u svojstivma uređivanja "
-
-#: view/kateview.cpp:576
-msgid "Show Non-Printable Spaces"
-msgstr ""
-
-#: view/kateview.cpp:578
-msgid "Show/hide bounding box around non-printable spaces"
-msgstr ""
-
-#: view/kateview.cpp:582
-msgid "Switch to Command Line"
-msgstr "Prebaci se na komandnu liniju"
-
-#: view/kateview.cpp:584
-msgid "Show/hide the command line on the bottom of the view."
-msgstr "Pokaži/sakrij naredbenu liniju na dnu prikaza."
-
-#: view/kateview.cpp:587
-msgid "&VI Input Mode"
-msgstr "&VI način unosa"
-
-#: view/kateview.cpp:590
-msgid "Activate/deactivate VI input mode"
-msgstr "Aktiviraj/deaktiviraj VI način unošenja"
-
-#: view/kateview.cpp:593
-msgid "&End of Line"
-msgstr "&Idi na kraj retka"
-
-#: view/kateview.cpp:595
-msgid "Choose which line endings should be used, when you save the document"
-msgstr ""
-"Odaberite koje završetke redaka koristiti prilikom spremanja dokumenta "
-
-#: view/kateview.cpp:597
-#, fuzzy
-#| msgid "UNIX"
-msgctxt "@item:inmenu End of Line"
-msgid "&UNIX"
-msgstr "UNIX"
-
-#: view/kateview.cpp:598
-#, fuzzy
-msgctxt "@item:inmenu End of Line"
-msgid "&Windows/DOS"
-msgstr "Dos/Windows"
-
-#: view/kateview.cpp:599
-#, fuzzy
-#| msgid "Macintosh"
-msgctxt "@item:inmenu End of Line"
-msgid "&Macintosh"
-msgstr "Macintosh"
-
-#: view/kateview.cpp:604
-msgid "Add &Byte Order Mark (BOM)"
-msgstr "Dodaj &oznake za redosljed bitova (BOM)"
-
-#: view/kateview.cpp:607
-msgid ""
-"Enable/disable adding of byte order markers for UTF-8/UTF-16 encoded files "
-"while saving"
-msgstr ""
-"Omogući/onemogući dodavanje oznaka za redosljed bitova (BOM) prilikom "
-"spremanja datoteka kodiranih u UTF-8/UTF-16."
-
-#: view/kateview.cpp:610
-msgid "E&ncoding"
-msgstr "&Kodiranje:"
-
-#: view/kateview.cpp:614
-msgid "Look up the first occurrence of a piece of text or regular expression."
-msgstr "Tražite prvo pojavljivanje dijela teksta ili regularnog izraza."
-
-#: view/kateview.cpp:618
-msgid "Find Selected"
-msgstr "Traži Odabrano"
-
-#: view/kateview.cpp:620
-msgid "Finds next occurrence of selected text."
-msgstr "Pronađi sljedeći slučaj označenog teksta."
-
-#: view/kateview.cpp:624
-msgid "Find Selected Backwards"
-msgstr "Traži odabrano unatrag"
-
-#: view/kateview.cpp:626
-msgid "Finds previous occurrence of selected text."
-msgstr "Tražite prethodno pojavljivanje zadanog teksta."
-
-#: view/kateview.cpp:630
-msgid "Look up the next occurrence of the search phrase."
-msgstr "Tražite slijedeće pojavljivanje zadane fraze."
-
-#: view/kateview.cpp:634
-msgid "Look up the previous occurrence of the search phrase."
-msgstr "Tražite prethodno pojavljivanje zadane fraze."
-
-#: view/kateview.cpp:638
-msgid ""
-"Look up a piece of text or regular expression and replace the result with "
-"some given text."
-msgstr ""
-"Tražite dio teksta ili regularni izraz te zamjeni rezultat s zadanim tekstom."
-
-#: view/kateview.cpp:641
-msgid "Automatic Spell Checking"
-msgstr "Automatska provjera pravopisa"
-
-#: view/kateview.cpp:642
-msgid "Enable/disable automatic spell checking"
-msgstr "Omogući/onemogući automatsku provjeru pravopisa"
-
-#: view/kateview.cpp:648
-msgid "Change Dictionary..."
-msgstr "Promijeni rječnik…"
-
-#: view/kateview.cpp:649
-msgid "Change the dictionary that is used for spell checking."
-msgstr "Promijeni riječnik koji se koristi za provjeru pravopisa."
-
-#: view/kateview.cpp:653
-msgid "Clear Dictionary Ranges"
-msgstr "Ukloni Dijelove Rječnika"
-
-#: view/kateview.cpp:655
-msgid ""
-"Remove all the separate dictionary ranges that were set for spell checking."
-msgstr ""
-"Ukloni sve odvojene dijelove rječnika koji su postavljeni za provjeru "
-"pravopisa."
-
-#: view/kateview.cpp:661
-msgid "Copy as &HTML"
-msgstr "Kopiraj kao &HTML"
-
-#: view/kateview.cpp:662
-#, fuzzy
-msgid ""
-"Use this command to copy the currently selected text as HTML to the system "
-"clipboard."
-msgstr ""
-"Upotrjebite ovu naredbu za kopiranje označenog teksta u sustavsko "
-"odlagalište. "
-
-#: view/kateview.cpp:665
-#, fuzzy
-msgid "E&xport as HTML..."
-msgstr "Izvezi datoteku kao "
-
-#: view/kateview.cpp:666
-#, fuzzy
-msgid ""
-"This command allows you to export the current document with all highlighting "
-"information into a HTML document."
-msgstr ""
-"Ova naredba omogućuje izvoz trenutnog dokumenta i informacija bojanja "
-"sintakse u dokument sa oznakama, npr. HTML."
-
-#: view/kateview.cpp:707
-msgid "Move Word Left"
-msgstr "Pomakni za riječ lijevo"
-
-#: view/kateview.cpp:713
-msgid "Select Character Left"
-msgstr "Označi znak lijevo"
-
-#: view/kateview.cpp:719
-msgid "Select Word Left"
-msgstr "Označi riječ lijevo"
-
-#: view/kateview.cpp:725
-msgid "Move Word Right"
-msgstr "Pomakni za riječ desno"
-
-#: view/kateview.cpp:731
-msgid "Select Character Right"
-msgstr "Izaberite znak desno"
-
-#: view/kateview.cpp:737
-msgid "Select Word Right"
-msgstr "Označi riječ desno"
-
-#: view/kateview.cpp:743
-msgid "Move to Beginning of Line"
-msgstr "Pomakni sve do početka retka"
-
-#: view/kateview.cpp:749
-msgid "Move to Beginning of Document"
-msgstr "Pomakni na početak dokumenta"
-
-#: view/kateview.cpp:755
-msgid "Select to Beginning of Line"
-msgstr "Odaberi sve do početka retka"
-
-#: view/kateview.cpp:761
-msgid "Select to Beginning of Document"
-msgstr "Označi do početka dokumenta"
-
-#: view/kateview.cpp:767
-msgid "Move to End of Line"
-msgstr "Pomakni na kraj retka"
-
-#: view/kateview.cpp:773
-msgid "Move to End of Document"
-msgstr "Pomakni na kraj dokumenta"
-
-#: view/kateview.cpp:779
-msgid "Select to End of Line"
-msgstr "Označi do kraja retka"
-
-#: view/kateview.cpp:785
-msgid "Select to End of Document"
-msgstr "Izaberite kraj dokumenta"
-
-#: view/kateview.cpp:791
-msgid "Select to Previous Line"
-msgstr "Izaberite prethodnu liniju"
-
-#: view/kateview.cpp:797
-msgid "Scroll Line Up"
-msgstr "Pomakni za liniju gure"
-
-#: view/kateview.cpp:803
-msgid "Move to Next Line"
-msgstr "Pomakni se do sljedećeg retka"
-
-#: view/kateview.cpp:809
-msgid "Move to Previous Line"
-msgstr "Pomakni se na prethodnu liniju"
-
-#: view/kateview.cpp:815
-msgid "Move Cursor Right"
-msgstr "Pomakni kursor udesno"
-
-#: view/kateview.cpp:821
-msgid "Move Cursor Left"
-msgstr "Pomakni kursor ulijevo"
-
-#: view/kateview.cpp:827
-msgid "Select to Next Line"
-msgstr "Označi do sljedećeg retka"
-
-#: view/kateview.cpp:833
-msgid "Scroll Line Down"
-msgstr "Pomakni za liniju dolje"
-
-#: view/kateview.cpp:839
-msgid "Scroll Page Up"
-msgstr "Pomakni stranicu gore"
-
-#: view/kateview.cpp:845
-msgid "Select Page Up"
-msgstr "Označi stranicu gore"
-
-#: view/kateview.cpp:851
-msgid "Move to Top of View"
-msgstr "Pomaknite na vrh prikaza"
-
-#: view/kateview.cpp:857
-msgid "Select to Top of View"
-msgstr "Označi do vrha prikaza"
-
-#: view/kateview.cpp:863
-msgid "Scroll Page Down"
-msgstr "Pomakni stranicu dolje"
-
-#: view/kateview.cpp:869
-msgid "Select Page Down"
-msgstr "Izaberite Stranica dolje"
-
-#: view/kateview.cpp:875
-msgid "Move to Bottom of View"
-msgstr "Pomaknite na dno prikaza"
-
-#: view/kateview.cpp:881
-msgid "Select to Bottom of View"
-msgstr "Označi do dna prikaza"
-
-#: view/kateview.cpp:887
-msgid "Move to Matching Bracket"
-msgstr "Pomakni do pripadajuće zagrade"
-
-#: view/kateview.cpp:893
-msgid "Select to Matching Bracket"
-msgstr "Označi do pripadajuće zagrade"
-
-#: view/kateview.cpp:901
-msgid "Transpose Characters"
-msgstr "Zamjeni znakove"
-
-#: view/kateview.cpp:907
-msgid "Delete Line"
-msgstr "Izbriši redak"
-
-#: view/kateview.cpp:913
-msgid "Delete Word Left"
-msgstr "Izbriši riječ lijevo"
-
-#: view/kateview.cpp:919
-msgid "Delete Word Right"
-msgstr "Izbriši riječ desno"
-
-#: view/kateview.cpp:925
-msgid "Delete Next Character"
-msgstr "Izbriši sljedeći znak"
-
-#: view/kateview.cpp:931
-msgid "Backspace"
-msgstr "Backspace"
-
-#: view/kateview.cpp:940
-#, fuzzy
-msgid "Insert Tab"
-msgstr "&Uvlačenje"
-
-#: view/kateview.cpp:945
-msgid "Insert Smart Newline"
-msgstr "Ubaci Pametnu Novu Liniju"
-
-#: view/kateview.cpp:946
-msgid ""
-"Insert newline including leading characters of the current line which are "
-"not letters or numbers."
-msgstr ""
-"Ubaci novi redak koji uključuje uvodne znakove trenutnog retka, a koji nisu "
-"slova ili brojevi."
-
-#: view/kateview.cpp:956
-msgid "&Indent"
-msgstr "&Uvlačenje"
-
-#: view/kateview.cpp:957
-msgid ""
-"Use this to indent a selected block of text. You can configure "
-"whether tabs should be honored and used or replaced with spaces, in the "
-"configuration dialog."
-msgstr ""
-"Koristite ovo za uvlačenje odabranog bloka teksta (samo tabulacije/samo "
-"razmaci) U dijalogu s postavkama možete podesiti hoće li se "
-"tabulacije poštovati i koristiti ili će biti zamijenjene s razmacima."
-
-#: view/kateview.cpp:964
-msgid "&Unindent"
-msgstr "I&zvuci"
-
-#: view/kateview.cpp:965
-msgid "Use this to unindent a selected block of text."
-msgstr "Koristite ovo da deindentirate označeni blok teksta."
-
-#: view/kateview.cpp:985
-#, fuzzy
-#| msgid "Collapse Toplevel"
-msgid "Fold Toplevel Nodes"
-msgstr "Sklopi vrh"
-
-#: view/kateview.cpp:1003
-#, fuzzy
-#| msgid "Current line:"
-msgid "Fold Current Node"
-msgstr "Trenutni redak: "
-
-#: view/kateview.cpp:1007
-msgid "Unfold Current Node"
-msgstr ""
-
-#: view/kateview.cpp:1112
-msgid "OVERWRITE"
-msgstr ""
-
-#: view/kateview.cpp:1112
-msgid "INSERT"
-msgstr ""
-
-#: view/kateview.cpp:1125
-#, fuzzy
-#| msgid "E&ncoding"
-msgid "recording"
-msgstr "&Kodiranje:"
-
-#: view/kateview.cpp:1147
-#, kde-format
-msgid "(R/O) %1"
-msgstr ""
-
-#: view/kateviewhelpers.cpp:197 view/kateviewhelpers.cpp:244
-#: view/kateviewhelpers.cpp:699
-#, kde-format
-msgctxt "from line - to line"
-msgid "%1 — %2 "
-msgstr ""
-
-#: view/kateviewhelpers.cpp:873
-msgid "Available Commands"
-msgstr "Dostupne Naredbe"
-
-#: view/kateviewhelpers.cpp:875
-msgid ""
-"For help on individual commands, do 'help <command>'
"
-"p>"
-msgstr ""
-"
Za pomoć pri određenoj naredbi, napravite 'pomoć <naredba>'"
-"code>
"
-
-#: view/kateviewhelpers.cpp:883
-#, kde-format
-msgid "No help for '%1'"
-msgstr "Nema uputa za '%1'"
-
-#: view/kateviewhelpers.cpp:886
-#, kde-format
-msgid "No such command %1 "
-msgstr "Nema takve naredbe: \"%1\""
-
-#: view/kateviewhelpers.cpp:892
-msgid ""
-"This is the Katepart command line . Syntax: command "
-"[ arguments ]
For a list of available commands, enter "
-"help list
For help for individual commands, enter "
-"help <command>
"
-msgstr ""
-"Ovo je Katepart komandni redak . Sintaksa: naredba "
-"[ argumenti ]
Za ispis dostupnih naredi, upišite "
-"help list
Za pomoć pri određenim naredbama, "
-"upišitehelp <naredba>
"
-
-#: view/kateviewhelpers.cpp:981 vimode/kateviemulatedcommandbar.cpp:1125
-#, kde-format
-msgid "Error: No range allowed for command \"%1\"."
-msgstr "Greška: nedopušten opseg za naredbu \"%1\"."
-
-#: view/kateviewhelpers.cpp:996 vimode/kateviemulatedcommandbar.cpp:1133
-msgid "Success: "
-msgstr "Uspjeh:"
-
-#: view/kateviewhelpers.cpp:1010 vimode/kateviemulatedcommandbar.cpp:1142
-#, kde-format
-msgid "Command \"%1\" failed."
-msgstr "Komanda \"%1\" neuspjela."
-
-#: view/kateviewhelpers.cpp:1014 vimode/kateviemulatedcommandbar.cpp:1146
-#, kde-format
-msgid "No such command: \"%1\""
-msgstr "Nema takve naredbe: \"%1\""
-
-#: view/kateviewhelpers.cpp:2000 view/kateviewhelpers.cpp:2001
-#, kde-format
-msgid "Mark Type %1"
-msgstr "Označi tip %1"
-
-#: view/kateviewhelpers.cpp:2023
-msgid "Set Default Mark Type"
-msgstr "Postavi uobičajeni tip markera"
-
-#: view/kateviewhelpers.cpp:2085
-msgid "Disable Annotation Bar"
-msgstr "Onemogući traku s napomenama"
-
-#: vimode/kateviinputmodemanager.cpp:759
-#, fuzzy, kde-format
-#| msgid "Mark not set: %1"
-msgid "Mark set: %1"
-msgstr "Oznaka nije postavljena: %1"
-
-#: vimode/kateviinputmodemanager.cpp:801
-#, fuzzy
-#| msgid "Go to the next bookmark."
-msgid "There are no more chars for the next bookmark."
-msgstr "Kreće na slijedeću oznaku."
-
-#: vimode/kateviinputmodemanager.cpp:869
-msgid "VI: INSERT MODE"
-msgstr "VI: NAČIN UNOSA"
-
-#: vimode/kateviinputmodemanager.cpp:872
-msgid "VI: NORMAL MODE"
-msgstr "VI: NORMALNI NAČIN"
-
-#: vimode/kateviinputmodemanager.cpp:875
-msgid "VI: VISUAL"
-msgstr "VI: VIDLJIVO"
-
-#: vimode/kateviinputmodemanager.cpp:878
-msgid "VI: VISUAL BLOCK"
-msgstr "VI: VIDLJIVI BLOK"
-
-#: vimode/kateviinputmodemanager.cpp:881
-msgid "VI: VISUAL LINE"
-msgstr "VI: VIDLJIV REDAK"
-
-#: vimode/kateviinputmodemanager.cpp:884
-msgid "VI: REPLACE"
-msgstr "VI: ZAMIJENI"
-
-#: vimode/kateviinsertmode.cpp:268 vimode/katevimodebase.cpp:946
-#: vimode/katevinormalmode.cpp:3741
-#, kde-format
-msgid "Nothing in register %1"
-msgstr "Ništa nema u zapisniku %1"
-
-#: vimode/katevinormalmode.cpp:1620
-#, kde-format
-msgid "'%1' %2, Hex %3, Octal %4"
-msgstr "'%1' %2, Heksa %3, Okta %4"
-
-#: vimode/katevinormalmode.cpp:2455
-#, kde-format
-msgid "Mark not set: %1"
-msgstr "Oznaka nije postavljena: %1"
-
-#, fuzzy
-#~| msgid " character"
-#~| msgid_plural " characters"
-#~ msgctxt "Wrap words at"
-#~ msgid " character"
-#~ msgid_plural " characters"
-#~ msgstr[0] " znak"
-#~ msgstr[1] "znaka"
-#~ msgstr[2] "znakova"
-
-#~ msgid "Cursor && Selection"
-#~ msgstr "Pokazivač && odabiranje"
-
-#~ msgid "Editor Plugins"
-#~ msgstr "Priključci uređivača"
-
-#~ msgid "Plugins"
-#~ msgstr "Umetci"
-
-#~ msgid "&Ignore"
-#~ msgstr "&Ignoriraj"
-
-#~ msgid "Overwrite"
-#~ msgstr "Prepisati"
-
-#~ msgid "The file %1 is a binary, saving it will result in a corrupt file."
-#~ msgstr ""
-#~ "Datoteka %1 je biranog tipa, njezino će spremanje uzrokovati pokvarenu "
-#~ "datoteku."
-
-#, fuzzy
-#~| msgid "Execution"
-#~ msgid "Execute"
-#~ msgstr "Provedba"
-
-#~ msgid "Sorry, but Kate is not able to replace newlines, yet"
-#~ msgstr "Žao mi je, ali Kate još nije u mogućnosti zamijeniti nove redove"
-
-#~ msgid "Extensions"
-#~ msgstr "Nastavak"
-
-#~ msgid "Extensions Manager"
-#~ msgstr "Upravitelj nastavaka"
-
-#~ msgid "Template Background"
-#~ msgstr "Pozadina predloška"
-
-#, fuzzy
-#~| msgid "Normal &Color..."
-#~ msgid "Export HlColors..."
-#~ msgstr "Normaln&e boje"
-
-#, fuzzy
-#~| msgid "&Stop"
-#~ msgid "Stop"
-#~ msgstr "&Zaustavi"
-
-#, fuzzy
-#~| msgid "Remove &trailing spaces while editing"
-#~ msgctxt "short translation please"
-#~ msgid "Remove trailing spaces when editing a line."
-#~ msgstr "Ukloni &praznine na kraju retka prilikom uređivanja"
-
-#, fuzzy
-#~| msgid "Show/hide the command line on the bottom of the view."
-#~ msgid "Show/hide the JavaScript Console on the bottom of the view."
-#~ msgstr "Pokaži/sakrij naredbenu liniju na dnu prikaza."
-
-#, fuzzy
-#~| msgid "Expand Toplevel"
-#~ msgid "Unfold Toplevel Nodes"
-#~ msgstr "Rasklopi vrh"
-
-#~ msgid "R/O"
-#~ msgstr "R/O"
-
-#~ msgid "OVR"
-#~ msgstr "OVR"
-
-#~ msgid "INS"
-#~ msgstr "INS"
-
-#, fuzzy
-#~| msgid "Move Word Left"
-#~ msgid "Move Left"
-#~ msgstr "Pomakni za riječ lijevo"
-
-#, fuzzy
-#~| msgid "Move Word Right"
-#~ msgid "Move Right"
-#~ msgstr "Pomakni za riječ desno"
-
-#, fuzzy
-#~| msgid "Scroll Line Up"
-#~ msgid "Move Up"
-#~ msgstr "Pomakni za liniju gure"
-
-#, fuzzy
-#~| msgid "Scroll Line Down"
-#~ msgid "Move Down"
-#~ msgstr "Pomakni za liniju dolje"
-
-#~ msgid "Show &folding markers (if available)"
-#~ msgstr "Pokaži markere preklapanja (ako je dostupno)"
-
-#~ msgid ""
-#~ "When on, moving the insertion cursor using the Left and "
-#~ "Right keys will go on to previous/next line at beginning/end of "
-#~ "the line, similar to most editors.
When off, the insertion cursor "
-#~ "cannot be moved left of the line start, but it can be moved off the line "
-#~ "end, which can be very handy for programmers.
"
-#~ msgstr ""
-#~ "Kad je uključeno, korištenjem tipaka Lijevo i Desno , "
-#~ "pokazivač za umetanje pomicat će se u prethodni/sljedeći redak na početku/"
-#~ "kraju retka, slično kao kod većine uređivača.
Kad je isključeno, "
-#~ "pokazivač za umetanje neće se pomaknuti na lijevo početnog retka, već će "
-#~ "biti prebačen na kraj retka, što može dobro doći programerima.
"
-
-#, fuzzy
-#~| msgid "Wrap c&ursor"
-#~ msgid "Wrap c&ursor"
-#~ msgstr "Omotaj &kursor"
-
-#~ msgid ""
-#~ "Selections will be overwritten by typed text and will be lost on cursor "
-#~ "movement."
-#~ msgstr ""
-#~ "Odabiri će biti prebrisani kucanjem teksta i biće izgubljeni prilikom "
-#~ "pomicanja pokazivača."
-
-#~ msgid "&Normal"
-#~ msgstr "&Normalno"
-
-#~ msgid "Selections will stay even after cursor movement and typing."
-#~ msgstr "Odabiri će ostati čak i poslije pomicanja pokazivača i utipkavanja."
-
-#, fuzzy
-#~| msgid ""
-#~| "If this is enabled, the editor will remove any trailing whitespace on "
-#~| "lines when they are left by the insertion cursor."
-#~ msgid ""
-#~ "If this is enabled, the editor will remove any trailing whitespace on "
-#~ "lines that are changed through editing."
-#~ msgstr ""
-#~ "Ako je ovo omogućeno, uređivač će zamijeniti sve posljednje praznine u "
-#~ "redovima gdje ih je ostavio pokazivač za umetanje"
-
-#~ msgid "Remove &trailing spaces while editing"
-#~ msgstr "Ukloni &praznine na kraju retka prilikom uređivanja"
-
-#~ msgid ""
-#~ "When the user types a left bracket ([,(, or {) KateView automatically "
-#~ "enters the right bracket (}, ), or ]) to the right of the cursor."
-#~ msgstr ""
-#~ "Kada korisnik upiše lijevu zagradu ([,(, ili {) KatePrikaz će sam dodati "
-#~ "desnu zagradu (}, ), ili ]), odmah desno od kursora."
-
-#~ msgid "Auto &brackets"
-#~ msgstr "&Automatske zagrade"
-
-#, fuzzy
-#~ msgid ""
-#~ "The editor will automatically eliminate extra spaces at the ends of lines "
-#~ "of text while loading/saving the file. This change is only visible after "
-#~ "a save if you reload the file."
-#~ msgstr ""
-#~ "KatePogled će automatski meknuti razmake koji su višak na krajevima "
-#~ "redova teksta."
-
-#~ msgid "Normal text:"
-#~ msgstr "Normalni tekst:"
-
-#~ msgid "Additional Elements"
-#~ msgstr "Dodatni elementi"
-
-#~ msgid "Left border background:"
-#~ msgstr "Pozadina lijevog ruba:"
-
-#~ msgid ""
-#~ "Changing this mode affects only newly opened / created documents. In "
-#~ "KWrite a restart is recommended."
-#~ msgstr ""
-#~ "Promjena ovog načina se očituje u samo novo otvorenim/stvorenim "
-#~ "dokumentima. U KWrite-u je preporučeno ponovno pokretanje istog."
-
-#~ msgid "Enable power user mode (KDE 3 mode)"
-#~ msgstr "Omogući administratorski način (KDE 3 način)"
-
-#~ msgid "Hide the Vi mode status bar"
-#~ msgstr "Sakrij statusnu traku Vi načina"
-
-#~ msgctxt "Language"
-#~ msgid "Prolog"
-#~ msgstr "Prolog"
-
-#~ msgid "Collapse One Local Level"
-#~ msgstr "Sklopi jednu razinu"
-
-#~ msgid "Expand One Local Level"
-#~ msgstr "Rasklopi jednu razinu"
-
-#, fuzzy
-#~| msgid "Collapse Toplevel"
-#~ msgid "Collapse Level 1"
-#~ msgstr "Sklopi vrh"
-
-#, fuzzy
-#~| msgid "Collapse Toplevel"
-#~ msgid "Collapse Level 2"
-#~ msgstr "Sklopi vrh"
-
-#, fuzzy
-#~| msgid "Collapse Toplevel"
-#~ msgid "Collapse Level 3"
-#~ msgstr "Sklopi vrh"
-
-#, fuzzy
-#~| msgid "Collapse Toplevel"
-#~ msgid "Collapse Level 4"
-#~ msgstr "Sklopi vrh"
-
-#, fuzzy
-#~| msgid "Collapse Toplevel"
-#~ msgid "Collapse Level 5"
-#~ msgstr "Sklopi vrh"
-
-#, fuzzy
-#~| msgid "Collapse Toplevel"
-#~ msgid "Collapse Level 6"
-#~ msgstr "Sklopi vrh"
-
-#, fuzzy
-#~| msgid "Collapse Toplevel"
-#~ msgid "Collapse Level 7"
-#~ msgstr "Sklopi vrh"
-
-#, fuzzy
-#~| msgid "Collapse Toplevel"
-#~ msgid "Collapse Level 8"
-#~ msgstr "Sklopi vrh"
-
-#, fuzzy
-#~| msgid "Collapse Toplevel"
-#~ msgid "Collapse Level 9"
-#~ msgstr "Sklopi vrh"
-
-#, fuzzy
-#~| msgid "Expand Toplevel"
-#~ msgid "Expand Level 1"
-#~ msgstr "Rasklopi vrh"
-
-#, fuzzy
-#~| msgid "Expand Toplevel"
-#~ msgid "Expand Level 2"
-#~ msgstr "Rasklopi vrh"
-
-#, fuzzy
-#~| msgid "Expand Toplevel"
-#~ msgid "Expand Level 3"
-#~ msgstr "Rasklopi vrh"
-
-#, fuzzy
-#~| msgid "Expand Toplevel"
-#~ msgid "Expand Level 4"
-#~ msgstr "Rasklopi vrh"
-
-#, fuzzy
-#~| msgid "Expand Toplevel"
-#~ msgid "Expand Level 5"
-#~ msgstr "Rasklopi vrh"
-
-#, fuzzy
-#~| msgid "Expand Toplevel"
-#~ msgid "Expand Level 6"
-#~ msgstr "Rasklopi vrh"
-
-#, fuzzy
-#~| msgid "Expand Toplevel"
-#~ msgid "Expand Level 7"
-#~ msgstr "Rasklopi vrh"
-
-#, fuzzy
-#~| msgid "Expand Toplevel"
-#~ msgid "Expand Level 8"
-#~ msgstr "Rasklopi vrh"
-
-#, fuzzy
-#~| msgid "Expand Toplevel"
-#~ msgid "Expand Level 9"
-#~ msgstr "Rasklopi vrh"
-
-#, fuzzy
-#~| msgid "Classes"
-#~ msgid "&Collapse"
-#~ msgstr "Razredi"
-
-#~ msgid "Scripts"
-#~ msgstr "Skripte"
-
-#, fuzzy
-#~ msgid "&Auto completion enabled"
-#~ msgstr "Automatski skočni prozor za dovršavanje."
-
-#, fuzzy
-#~| msgid "&Format:"
-#~ msgid "Form"
-#~ msgstr "&Oblik:"
-
-#~ msgid ""
-#~ "A KDE text-editor component could not be found;\n"
-#~ "please check your KDE installation."
-#~ msgstr ""
-#~ "KDE-ova komponenta za uređivanje teksta nije nađena;\n"
-#~ "molim vas da provjerite vašu instalaciju KDE-a."
-
-#, fuzzy
-#~ msgid "Use this to close the current document"
-#~ msgstr "Ispišite trenutni dokument"
-
-#, fuzzy
-#~ msgid "Use this command to create a new document"
-#~ msgstr ""
-#~ "Pritisnite ovaj gumb za stvaranje novog entiteta automatske bilješke"
-
-#~ msgid ""
-#~ "This lists files which you have opened recently, and allows you to easily "
-#~ "open them again."
-#~ msgstr ""
-#~ "Ovaj popis prikazuje nedavno otvorene datoteke te vam omogućuje njihovo "
-#~ "jednostavno ponovno otvaranje."
-
-#~ msgid "&New Window"
-#~ msgstr "&Novi prozor"
-
-#~ msgid "Create another view containing the current document"
-#~ msgstr "Stvori drugi prikaz koji sadrži trenutni dokument"
-
-#~ msgid "Choose Editor..."
-#~ msgstr "Odaberite uređivač…"
-
-#~ msgid "Override the system-wide setting for the default editing component"
-#~ msgstr "Premoštavanje sistemskih postavki za zadanu uređivačku komponentu"
-
-#, fuzzy
-#~ msgid "Close the current document view"
-#~ msgstr "Spremi trenutni dokument"
-
-#~ msgid "Sho&w Path"
-#~ msgstr "Pokaži putanju"
-
-#~ msgid "&About Editor Component"
-#~ msgstr "O komponenti za uređiv&anje"
-
-#~ msgid " INS "
-#~ msgstr " INS "
-
-#~ msgid " LINE "
-#~ msgstr " REDAK "
-
-#~ msgid "Open File"
-#~ msgstr "Otvori datoteku"
-
-#~ msgid ""
-#~ "The given file could not be read, check if it exists or if it is readable "
-#~ "for the current user."
-#~ msgstr ""
-#~ "Dana se datoteka ne može pročitati. Provjerite da li postoji ili da li je "
-#~ "čitljiva trenutnom korisniku."
-
-#~ msgid " BLOCK "
-#~ msgstr " BLOK "
-
-#, fuzzy
-#~ msgid "Read the contents of stdin"
-#~ msgstr "Ponovo učitava trenutni dokument sa diska."
-
-#~ msgid "KWrite"
-#~ msgstr "KWrite"
-
-#~ msgid "KWrite - Text Editor"
-#~ msgstr "KWrite – Uređivač teksta"
-
-#~ msgid "(c) 2000-2005 The Kate Authors"
-#~ msgstr "© 2000–2005 Kate autori"
-
-#, fuzzy
-#~ msgid ""
-#~ "The file '%1' could not be opened: it is not a normal file, it is a "
-#~ "folder."
-#~ msgstr ""
-#~ "Datoteka %1 nije mogla biti u potpunosti učitana, zato jer nema dovoljno "
-#~ "privremenog prostora na disku!"
-
-#~ msgid "Choose Editor Component"
-#~ msgstr "Izaberi komponentu za uređivanje"
-
-#~ msgid "&Help"
-#~ msgstr "Pomoć"
-
-#~ msgid "Keep output files even on success"
-#~ msgstr "Zadrži izlazne datoteke čak i prilikom uspjeha"
-
-#~ msgid "Show the window while running tests"
-#~ msgstr "Prikaži prozor prilikom testiranja"
-
-#~ msgid "Put output in instead of /output"
-#~ msgstr "Postavi izlaz u umjesto u /izlaz"
-
-#~ msgid "Run each test case in a separate process."
-#~ msgstr "Izvršavaj svaki pojedini probni slučaj u odvojenom procesu."
-
-#~ msgid "TestRegression"
-#~ msgstr "TestRegression"
-
-#~ msgid "Regression tester for kate"
-#~ msgstr "Isprobavač regresija za kate"
-
-#~ msgid "Error: "
-#~ msgstr "Greška:"
-
-#~ msgid ""
-#~ "If this is enabled, the editor will calculate the number of spaces up to "
-#~ "the next tab position as defined by the tab width, and insert that number "
-#~ "of spaces instead of a TAB character."
-#~ msgstr ""
-#~ "Ako je ovo uključeno, uređivač će izračunati koliki je broj razmaka "
-#~ "sadržan u tabulatoru koji je definiran tabulatorskom širinom te će zatim "
-#~ "dobiveni broj razmaka umetnuti umjesto znaka TAB."
-
-#, fuzzy
-#~ msgid "&Insert spaces instead of tabulators"
-#~ msgstr "Koristi ra&zmake za uvlačenje umjesto taba"
-
-#, fuzzy
-#~| msgid "&View Difference"
-#~ msgid "View Differences"
-#~ msgstr "&Prikaži razliku"
-
-#~ msgctxt "Encodings menu"
-#~ msgid "Disabled"
-#~ msgstr "Onemogućeno"
-
-#~ msgctxt "Encodings menu"
-#~ msgid "Autodetect"
-#~ msgstr "Samodetekcija"
-
-#~ msgid "Broken UTF-8 File Opened"
-#~ msgstr "Otvorena je pokidana UTF-8 datoteka"
-
-#~ msgid "Universal"
-#~ msgstr "Univerzalno"
-
-#~ msgid "&Word Wrap Document"
-#~ msgstr "&Dokument s prijelomom teksta"
-
-#~ msgid "&Options"
-#~ msgstr "&Opcije"
-
-#~ msgid "From &cursor"
-#~ msgstr "Od &pokazivača"
-
-#, fuzzy
-#~ msgid "Hi&ghlight all"
-#~ msgstr "Osvjetljavanje"
-
-#~ msgid "Add &BOM"
-#~ msgstr "Dodaj &BOM"
-
-#~ msgid "(c) 2000-2008 The Kate Authors"
-#~ msgstr "© 2000–2008 Autori programa Kate"
-
-#, fuzzy
-#~ msgid "Unable to read file: '%1'"
-#~ msgstr "Ne mogu otvoriti %1"
-
-#~ msgid "Success"
-#~ msgstr "Uspjeh"
-
-#, fuzzy
-#~ msgid "Move Character Right"
-#~ msgstr "Izaberite znak desno"
-
-#, fuzzy
-#~ msgid "Move Character Left"
-#~ msgstr "Označi znak lijevo"
-
-#~ msgid "&Overwrite"
-#~ msgstr "Pr&epiši"
-
-#, fuzzy
-#~ msgid "Plain text\t\t(Alt+1)"
-#~ msgstr "Nađi"
-
-#, fuzzy
-#~ msgid "Regular expression\t(Alt+4)"
-#~ msgstr "Valjan (izraz)"
-
-#, fuzzy
-#~ msgid "Case Sensitive"
-#~ msgstr "Razlikuj velika i mala slova"
-
-#~ msgid "&Dynamic word wrap"
-#~ msgstr "&Dinamičko omatanje riječi"
-
-#, fuzzy
-#~ msgid "(c) 2000-2007 The Kate Authors"
-#~ msgstr "(c) 2000-2004 Autori programa Kate"
-
-#, fuzzy
-#~ msgid "Line must be at least 1"
-#~ msgstr "Širina mora biti najmanje 1."
-
-#, fuzzy
-#~ msgid "Highlight all matches"
-#~ msgstr "Osvjetljavanje"
-
-#, fuzzy
-#~| msgid "Wrap c&ursor"
-#~ msgid "From cursor"
-#~ msgstr "Omotaj &kursor"
-
-#, fuzzy
-#~ msgid "Selection only "
-#~ msgstr "Samo označeno"
-
-#~ msgid "Shortcuts"
-#~ msgstr "Kratice"
-
-#~ msgid "Shortcuts Configuration"
-#~ msgstr "Postavke tipkovnice"
-
-#, fuzzy
-#~ msgid "Insert: %1"
-#~ msgstr "Linija: %1"
-
-#, fuzzy
-#~ msgid ""
-#~ "The spelling program could not be started. Please make sure you have set "
-#~ "the correct spelling program and that it is properly configured and in "
-#~ "your PATH."
-#~ msgstr ""
-#~ "ISpell nije mogao biti pokrenut. Molim osigurajte da je ISpell "
-#~ "ispravnokonfiguriran i u vašoj PATH varijabli."
-
-#, fuzzy
-#~ msgid "The spelling program seems to have crashed."
-#~ msgstr "Izgleda da se ISpell srušio."
-
-#, fuzzy
-#~ msgid "Could not access view."
-#~ msgstr "Ne mogu otvoriti pogled"
-
-#, fuzzy
-#~ msgid "Could not access lookup object."
-#~ msgstr "Ne mogu otvoriti pogled"
-
-#, fuzzy
-#~ msgid "Setup"
-#~ msgstr "&Zaustavi"
-
-#, fuzzy
-#~| msgid "Maximum undo steps:"
-#~ msgid "&Maximum undo steps:"
-#~ msgstr "Najveći broj koraka vraćanja:"
-
-#, fuzzy
-#~ msgid " Static"
-#~ msgstr "Sather"
-
-#~ msgid "Print syntax &guide"
-#~ msgstr "Ispiši &upute sintakse"
-
-#~ msgid "Print &selected text only"
-#~ msgstr "Ispiši &samo odabrani tekst"
-
-#~ msgid "Print %1"
-#~ msgstr "Ispiši %1"
-
-#~ msgid "Nowhere"
-#~ msgstr "Nigdje"
-
-#~ msgid "Selection Only"
-#~ msgstr "Samo označeno"
-
-#~ msgid "Selection, then Current Word"
-#~ msgstr "Označeni tekst, onda trenutna riječ"
-
-#~ msgid "Current Word Only"
-#~ msgstr "Samo trenutna riječ"
-
-#~ msgid "Current Word, then Selection"
-#~ msgstr "Trenutna riječ, onda označeni tekst"
-
-#~ msgid "Smart search t&ext from:"
-#~ msgstr "Pametno traženje teksta iz:"
-
-#, fuzzy
-#~ msgid "NORM"
-#~ msgstr " NORM "
-
-#~ msgid " NORM "
-#~ msgstr " NORM "
-
-#, fuzzy
-#~| msgid "Wrap c&ursor"
-#~ msgid "&From cursor"
-#~ msgstr "Omotaj &kursor"
-
-#, fuzzy
-#~ msgid "&Highlight all"
-#~ msgstr "Osvjetljavanje"
-
-#, fuzzy
-#~ msgid "Pop Up Completion List"
-#~ msgstr "Iskači s popisom nadopunjavanja"
-
-#, fuzzy
-#~ msgid "Automatically &show completion list"
-#~ msgstr "Automatski skočni prozor za dovršavanje."
-
-#, fuzzy
-#~ msgctxt ""
-#~ "This is the second part of two strings that will comprise the sentence "
-#~ "'Show completions when a word is at least N characters'"
-#~ msgid "characters long."
-#~ msgstr "Znak"
-
-#~ msgid "Insert File..."
-#~ msgstr "Umetni datoteku..."
-
-#~ msgid "Choose File to Insert"
-#~ msgstr "Odaberite datoteku za umetanje"
-
-#~ msgid ""
-#~ "Failed to load file:\n"
-#~ "\n"
-#~ msgstr ""
-#~ "Greška pri učitavanju datoteke:\n"
-#~ "\n"
-
-#~ msgid "Insert File Error"
-#~ msgstr "Greška pri umetanju datoteke"
-
-#~ msgid ""
-#~ "The file %1 does not exist or is not readable, "
-#~ "aborting."
-#~ msgstr ""
-#~ "
Datoteka %1 ne postoji ili nije čitljiva, odustajem."
-
-#~ msgid "
Unable to open file %1 , aborting."
-#~ msgstr "
Nemoguće otvoriti datoteku %1 , odustajem."
-
-#~ msgid "
File %1 had no contents."
-#~ msgstr "
Datoteka %1 nema sadržaja."
-
-#~ msgid "Data Tools"
-#~ msgstr "Podatkovni alati"
-
-#~ msgid "(not available)"
-#~ msgstr "(nije dostupno)"
-
-#~ msgid ""
-#~ "Data tools are only available when text is selected, or when the right "
-#~ "mouse button is clicked over a word. If no data tools are offered even "
-#~ "when text is selected, you need to install them. Some data tools are part "
-#~ "of the KOffice package."
-#~ msgstr ""
-#~ "Podatkovni alati su dostupni samo kad je tekst selektiran, ili kada se "
-#~ "pritisne desna tipka miša iznad riječi. Ako podatkovni alti nisu ponuđeni "
-#~ "niti kad je tekst označen, trebate ih instalirati.Neki podatkovni alati "
-#~ "su dio KOffice paketa."
-
-#~ msgid "AutoBookmarks"
-#~ msgstr "Automatske bilješke"
-
-#~ msgid "Configure AutoBookmarks"
-#~ msgstr "Postavi Automatske bilješka"
-
-#, fuzzy
-#~ msgid "Edit Entry"
-#~ msgstr "Uređivanje zapisa"
-
-#~ msgid "&Pattern:"
-#~ msgstr "&Umetni uzorak..."
-
-#~ msgid "
A regular expression. Matching lines will be bookmarked.
"
-#~ msgstr "Regularni izraz. Podudarajuće linije će biti zabilježene.
"
-
-#, fuzzy
-#~ msgid "&File mask:"
-#~ msgstr "Datotečna maska:"
-
-#~ msgid ""
-#~ "Click this button to display a checkable list of mimetypes available "
-#~ "on your system. When used, the file masks entry above will be filled in "
-#~ "with the corresponding masks.
"
-#~ msgstr ""
-#~ "Kliknite na ovaj gumb za prikaz označivog popisa mime tipova dostupnih "
-#~ "na vašem sustavu. Kada se koristi, unos za masku će se popuniti sa "
-#~ "odgovarajućom maskom.
"
-
-#~ msgid ""
-#~ "Select the MimeTypes for this pattern.\n"
-#~ "Please note that this will automatically edit the associated file "
-#~ "extensions as well."
-#~ msgstr ""
-#~ "Izaberite Mime tipove koje želite osvjetliti koristeći pravila. \n"
-#~ "Molim uočite da će to automatski urediti i pridružene nastavke imena "
-#~ "datoteka. "
-
-#~ msgid "&Patterns"
-#~ msgstr "&Uzorci"
-
-#~ msgid "Pattern"
-#~ msgstr "Uzorak"
-
-#~ msgid "Mime Types"
-#~ msgstr "Mime tipovi"
-
-#~ msgid "Press this button to create a new autobookmark entity."
-#~ msgstr ""
-#~ "Pritisnite ovaj gumb za stvaranje novog entiteta automatske bilješke"
-
-#~ msgid "Press this button to delete the currently selected entity."
-#~ msgstr "Pritisni ovaj gumb kako bi obrisao označeni sadržaj."
-
-#~ msgid "&Edit..."
-#~ msgstr "&Uredi..."
-
-#~ msgid "Press this button to edit the currently selected entity."
-#~ msgstr "Pritisni ovaj gumb kako bi uredio trenutno označeno"
-
-#, fuzzy
-#~ msgid "Word Completion Plugin"
-#~ msgstr "Iskači s popisom nadopunjavanja"
-
-#, fuzzy
-#~ msgid "Configure..."
-#~ msgstr "Podesi %1"
-
-#, fuzzy
-#~ msgid "Cursor & Selection Behavior"
-#~ msgstr "Odabir ponašanja"
-
-#, fuzzy
-#~| msgid "Filetype Specific Settings"
-#~ msgid "Mode Specific Settings"
-#~ msgstr "Posebne postavke za vrstu datoteke"
-
-#, fuzzy
-#~ msgid "Script Manager"
-#~ msgstr "Rukovoditelj umetaka"
-
-#~ msgid "Filetypes"
-#~ msgstr "Vrste datoteka"
-
-#~ msgid ""
-#~ "Select the MimeTypes you want highlighted using the '%1' syntax highlight "
-#~ "rules.\n"
-#~ "Please note that this will automatically edit the associated file "
-#~ "extensions as well."
-#~ msgstr ""
-#~ "Izaberite Mime tipove koje želite osvjetliti koristeći '%1' pravila. \n"
-#~ "Molim uočite da će to automatski urediti i pridružene nastavke imena "
-#~ "datoteka. "
-
-#, fuzzy
-#~ msgid "Clear &Bookmark"
-#~ msgstr "Obriši oznake"
-
-#, fuzzy
-#~ msgid "Hide Folding &Markers"
-#~ msgstr "Pokaži oznake preklapanja"
-
-#, fuzzy
-#~ msgid "Hide &Icon Border"
-#~ msgstr "Pokaži okvir &ikona"
-
-#, fuzzy
-#~ msgid "Hide &Line Numbers"
-#~ msgstr "Pokaži brojač &redaka"
-
-#, fuzzy
-#~ msgid "Hide Scroll&bar Marks"
-#~ msgstr "Pokaži oznake preklapanja"
-
-#, fuzzy
-#~ msgid "Hide Static &Word Wrap Marker"
-#~ msgstr "Prikazuj marker &statičkog prijeloma "
-
-#, fuzzy
-#~ msgid "Search string '%1' not found."
-#~ msgstr "Traženi niz '%1'nije pronađen!"
-
-#~ msgid "End of document reached."
-#~ msgstr "Došli smo do kraja dokumenta."
-
-#~ msgid "Beginning of document reached."
-#~ msgstr "Došao sam do početka dokumenta."
-
-#~ msgid "End of selection reached."
-#~ msgstr "Došao sam do kraja označenog."
-
-#~ msgid "Beginning of selection reached."
-#~ msgstr "Došao sam do početka označenog."
-
-#~ msgid "Continue from the beginning?"
-#~ msgstr "Da krenem od početka?"
-
-#, fuzzy
-#~ msgid "Re&place && Close"
-#~ msgstr "Zamjeni tekst"
-
-#~ msgid ""
-#~ "This file could not be loaded correctly due to lack of temporary disk "
-#~ "space. Saving it could cause data loss.\n"
-#~ "\n"
-#~ "Do you really want to save it?"
-#~ msgstr ""
-#~ "Ova datoteka nije mogla biti ispravno učitan zbog nedostatka privremenog "
-#~ "prostora na disku. Njezino spremanje može prouzrokovati gubitak "
-#~ "podataka.\n"
-#~ "\n"
-#~ "Da li ju zaista želite snimiti?"
-
-#~ msgid "N&ame:"
-#~ msgstr "Im&e:"
-
-#~ msgid "Automatic Indentation"
-#~ msgstr "Automatsko uvlačenje"
-
-#~ msgid "Use &spaces instead of tabs to indent"
-#~ msgstr "Koristi ra&zmake za uvlačenje umjesto taba"
-
-#~ msgid "Keep indent &profile"
-#~ msgstr "Sačuvaj &način uvlačenja"
-
-#~ msgid "Keys to Use"
-#~ msgstr "Tipke za korištenje"
-
-#~ msgid "Tab Key Mode if Nothing Selected"
-#~ msgstr "Mod Tab tipaka ukoliko ništa nije odabrano"
-
-#~ msgid "Insert indent &characters"
-#~ msgstr "Ubaci zna&kove za uvlačenje"
-
-#~ msgid "I&nsert tab character"
-#~ msgstr "U&baci znak za tabulator"
-
-#~ msgid "Check this if you want to indent with spaces rather than tabs."
-#~ msgstr ""
-#~ "Označite ovdje ako želite uvlačenje sa razmacima radije nego sa "
-#~ "tabulatorom. Tabulatore ću pretvoriti u Širinu tabulatora kao "
-#~ "što je Potvrdite ovo ako želite uvlačiti sa razmacima radije nego s "
-#~ "tabovima."
-
-#~ msgid ""
-#~ "Indentations of more than the selected number of spaces will not be "
-#~ "shortened."
-#~ msgstr "Uvlačenja sa više razmaka od odabranih neće biti smanjena."
-
-#~ msgid ""
-#~ "This allows the Tab key to be used to increase the indentation "
-#~ "level."
-#~ msgstr ""
-#~ "Ovo dozvoljava da se Tab tipka koristi za povećavanje nivoa "
-#~ "uvlačenja."
-
-#~ msgid ""
-#~ "This allows the Backspace key to be used to decrease the "
-#~ "indentation level."
-#~ msgstr ""
-#~ "Ovo dozvoljava da se Backspace tipka koristi za smanjivanje nivoa "
-#~ "uvlačenja."
-
-#, fuzzy
-#~ msgid "Configure Indenter"
-#~ msgstr "&Postavke uređivača..."
-
-#, fuzzy
-#~ msgid "&Show tabulators"
-#~ msgstr "&Prikaži tabove"
-
-#~ msgid "Collapse toplevel folding nodes"
-#~ msgstr "Preklopi kod na početnom nivou"
-
-#~ msgid "Configure %1"
-#~ msgstr "Podesi %1"
-
-#~ msgid "Author:"
-#~ msgstr "Autor:"
-
-#~ msgid "License:"
-#~ msgstr "Licenca:"
-
-#~ msgid "Do&wnload..."
-#~ msgstr "&Preuzimanje podataka"
-
-#~ msgid ""
-#~ "Choose a Syntax Highlight mode from this list to view its "
-#~ "properties below."
-#~ msgstr ""
-#~ "Izaberite Mod bojanja sintakse iz ovog popisa kako biste "
-#~ "vidjeli njegove postavke ispod."
-
-#~ msgid ""
-#~ "The list of file extensions used to determine which files to highlight "
-#~ "using the current syntax highlight mode."
-#~ msgstr ""
-#~ "Popis ekstenzija datoteka pomoću kojih se određuje koje datoteke "
-#~ "osvjeliti korištenjem trenutno izabranog stila osvjetljavanja."
-
-#~ msgid ""
-#~ "Click this button to download new or updated syntax highlight "
-#~ "descriptions from the Kate website."
-#~ msgstr ""
-#~ "Kliknite ovaj gumb da biste preuzeli nove ili unaprijeđene opise načina "
-#~ "osvjetljavanja s web stranice programa Kate."
-
-#~ msgid "Go to Line"
-#~ msgstr "Idi na redak"
-
-#~ msgid "Show the code folding region tree"
-#~ msgstr "Prikaži code folding region stablo"
-
-#~ msgid " Col: %1"
-#~ msgstr "Kol: %1"
-
-#, fuzzy
-#~ msgid "Overwrite the file"
-#~ msgstr "Prepiši datoteku?"
-
-#~ msgid "Python Style"
-#~ msgstr "Python stil"
-
-#, fuzzy
-#~ msgid "S&S C Style"
-#~ msgstr "C stil"
-
-#~ msgid "Mode must be at least 0."
-#~ msgstr "Režim mora biti bar 0."
-
-#~ msgid "Search Incrementally"
-#~ msgstr "Potraži po redu"
-
-#~ msgid "Search Incrementally Backwards"
-#~ msgstr "Potraži po redu unatrag"
-
-#~ msgid "I-Search:"
-#~ msgstr "I-traženje:"
-
-#~ msgid "From Beginning"
-#~ msgstr "Od početka"
-
-#, fuzzy
-#~ msgctxt "Incremental Search"
-#~ msgid "I-Search:"
-#~ msgstr ""
-#~ "_: Inkrementalno traženje\n"
-#~ "I-Traženje:"
-
-#~ msgctxt "Incremental Search found no match"
-#~ msgid "Failing I-Search:"
-#~ msgstr ""
-#~ " _: Inkrementalno traženje-ništa nije pronašlo\n"
-#~ "Neuspjelo I-traženje:"
-
-#, fuzzy
-#~ msgctxt "Incremental Search in the reverse direction"
-#~ msgid "I-Search Backward:"
-#~ msgstr ""
-#~ "_: Inkrementalno traženje in the obratnom smjeru\n"
-#~ "I-Traženje unatrag:"
-
-#~ msgid "Failing I-Search Backward:"
-#~ msgstr "Neuspjelo I-traženje unatrag:"
-
-#, fuzzy
-#~ msgctxt "Incremental Search has passed the end of the document"
-#~ msgid "Wrapped I-Search:"
-#~ msgstr ""
-#~ "_: Inkremental traženje je prošlo kraj dokumenta\n"
-#~ "Omotano I-Traženje:"
-
-#~ msgid "Failing Wrapped I-Search:"
-#~ msgstr "Neuspjelo kružno I-traženje:"
-
-#~ msgid "Wrapped I-Search Backward:"
-#~ msgstr "Kružno I-traženje unatrag:"
-
-#~ msgid "Failing Wrapped I-Search Backward:"
-#~ msgstr "Neuspjelo kružno I-traženje unatrag:"
-
-#, fuzzy
-#~ msgctxt ""
-#~ "Incremental Search has passed both the end of the document and the "
-#~ "original starting position"
-#~ msgid "Overwrapped I-Search:"
-#~ msgstr ""
-#~ "_: Inkremental traženje je prošlo i kraj dokumenta i originalnu startnu "
-#~ "poziciju\n"
-#~ "Opet omotano I-traženje:"
-
-#~ msgid "Failing Overwrapped I-Search:"
-#~ msgstr "Neuspjelo I-traženje sa prekapanjem:"
-
-#~ msgid "Overwrapped I-Search Backwards:"
-#~ msgstr "I-traženje sa prekapanjem unatrag:"
-
-#~ msgid "Failing Overwrapped I-Search Backward:"
-#~ msgstr "Neuspjelo I-traženje sa prekapanjem unatrag:"
-
-#~ msgid "Error: unknown i-search state!"
-#~ msgstr "Greška: nepoznato i-traženje stanje!"
-
-#~ msgid "Previous Incremental Search Match"
-#~ msgstr "Prethodni"
diff -Nru kde-l10n-hr-4.12.97/messages/frameworks/kwalletd.po kde-l10n-hr-4.13.0/messages/frameworks/kwalletd.po
--- kde-l10n-hr-4.12.97/messages/frameworks/kwalletd.po 2014-01-25 21:41:22.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/frameworks/kwalletd.po 1970-01-01 00:00:00.000000000 +0000
@@ -1,665 +0,0 @@
-# Translation of kwalletd to Croatian
-#
-# DoDo , 2009.
-# Marko Dimjasevic , 2009, 2010, 2011.
-# Andrej Dundovic , 2009.
-msgid ""
-msgstr ""
-"Project-Id-Version: kwalletd\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2014-01-25 01:23+0000\n"
-"PO-Revision-Date: 2011-03-12 18:33+0100\n"
-"Last-Translator: Marko Dimjasevic \n"
-"Language-Team: Croatian \n"
-"Language: hr\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Generator: Lokalize 1.2\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n"
-"%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"X-Environment: kde\n"
-"X-Accelerator-Marker: &\n"
-"X-Text-Markup: kde4\n"
-
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr "Nenad Mikša, Andrej Dundović"
-
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr "DoDoEntertainment@gmail.com, adundovi@gmail.com"
-
-#: backend/backendpersisthandler.cpp:498
-#, kde-format
-msgid ""
-"Error when attempting to initialize OpenPGP while attempting to save the "
-"wallet %1 . Error code is %2 . Please fix your system "
-"configuration, then try again! "
-msgstr ""
-
-#: backend/backendpersisthandler.cpp:506
-#, kde-format
-msgid ""
-"Error when attempting to initialize OpenPGP while attempting to save the "
-"wallet %1 . Please fix your system configuration, then try again! "
-msgstr ""
-
-#: backend/backendpersisthandler.cpp:557
-#, kde-format
-msgid ""
-"Encryption error while attempting to save the wallet %1 . Error "
-"code is %2 (%3) . Please fix your system configuration, then try again!"
-" "
-msgstr ""
-
-#: backend/backendpersisthandler.cpp:569
-#, kde-format
-msgid ""
-"File handling error while attempting to save the wallet %1 . Error "
-"was %2 . Please fix your system configuration, then try again! "
-msgstr ""
-
-#: backend/backendpersisthandler.cpp:582
-#, kde-format
-msgid ""
-"Error when attempting to initialize OpenPGP while attempting to open the "
-"wallet %1 . Error code is %2 . Please fix your system "
-"configuration, then try again! "
-msgstr ""
-
-#: backend/backendpersisthandler.cpp:600
-#, kde-format
-msgid ""
-"Error when attempting to initialize OpenPGP while attempting to open the "
-"wallet %1 . Please fix your system configuration, then try again! "
-msgstr ""
-
-#: backend/backendpersisthandler.cpp:610
-msgid "Retry"
-msgstr ""
-
-#: backend/backendpersisthandler.cpp:612
-#, kde-format
-msgid ""
-"Error when attempting to decrypt the wallet %1 using GPG. If "
-"you're using a SmartCard, please ensure it's inserted then try again."
-" GPG error was %2 "
-msgstr ""
-
-#: backend/backendpersisthandler.cpp:613
-msgid "kwalletd GPG backend"
-msgstr ""
-
-#: backend/backendpersisthandler.cpp:657
-#, kde-format
-msgid ""
-"Error when attempting to open the wallet %1 . The wallet was "
-"encrypted using the GPG Key ID %2 but this key was not found on your "
-"system. "
-msgstr ""
-
-#: backend/kwalletbackend.cc:224
-msgid "Already open."
-msgstr "Već otvoreno."
-
-#: backend/kwalletbackend.cc:226
-msgid "Error opening file."
-msgstr "Greška pri otvaranju datoteke."
-
-#: backend/kwalletbackend.cc:228
-msgid "Not a wallet file."
-msgstr "Nije datoteka novčanika."
-
-#: backend/kwalletbackend.cc:230
-msgid "Unsupported file format revision."
-msgstr "Nepodržana verzija formata datoteka."
-
-#: backend/kwalletbackend.cc:232
-msgid "Unknown encryption scheme."
-msgstr "Nepoznata enkripcijska shema."
-
-#: backend/kwalletbackend.cc:234
-msgid "Corrupt file?"
-msgstr "Pokvarena datoteka?"
-
-#: backend/kwalletbackend.cc:236
-msgid "Error validating wallet integrity. Possibly corrupted."
-msgstr "Greška pri provjeri integriteta novčanika. Moguće je da je pokvaren."
-
-#: backend/kwalletbackend.cc:240
-msgid "Read error - possibly incorrect password."
-msgstr "Greška pri čitanju – moguće kriva zaporka."
-
-#: backend/kwalletbackend.cc:242
-msgid "Decryption error."
-msgstr "Greška dekripcije."
-
-#: backend/kwalletbackend.cc:366
-#, kde-format
-msgid ""
-"Failed to sync wallet %1 to disk. Error codes are:\n"
-"RC %2 \n"
-"SF %2 . Please file a BUG report using this information to bugs.kde.org"
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QPushButton, _allowOnce)
-#: kbetterthankdialogbase.ui:50
-msgid "Allow &Once"
-msgstr "Dozvoli &Jednom"
-
-#. i18n: ectx: property (text), widget (QPushButton, _allowAlways)
-#: kbetterthankdialogbase.ui:60
-msgid "Allow &Always"
-msgstr "Dozvoli &Uvijek"
-
-#. i18n: ectx: property (text), widget (QPushButton, _deny)
-#: kbetterthankdialogbase.ui:67
-msgid "&Deny"
-msgstr "&Zabrani"
-
-#. i18n: ectx: property (text), widget (QPushButton, _denyForever)
-#: kbetterthankdialogbase.ui:74
-msgid "Deny &Forever"
-msgstr "Za&brani zauvijek"
-
-#: knewwalletdialog.cpp:64
-#, fuzzy, kde-format
-#| msgid ""
-#| "KDE has requested to open the wallet. This is used to store sensitive "
-#| "data in a secure fashion. Please enter a password to use with this wallet "
-#| "or click cancel to deny the application's request."
-msgid ""
-"KDE has requested to create a new wallet named '%1 '. This is used "
-"to store sensitive data in a secure fashion. Please choose the new wallet's "
-"type below or click cancel to deny the application's request. "
-msgstr ""
-"KDE zahtijeva otvaranje novčanika. To je potrebno za spremanje osjetljivih "
-"podataka na siguran način. Molim unesite zaporku za korištenje tog novčanika "
-"ili kliknite na 'Odustani' da biste odbili zahtjev aplikacije."
-
-#: knewwalletdialog.cpp:66
-#, fuzzy, kde-format
-#| msgid ""
-#| "The application '%1 ' has requested to open the KDE wallet. "
-#| "This is used to store sensitive data in a secure fashion. Please enter a "
-#| "password to use with this wallet or click cancel to deny the "
-#| "application's request. "
-msgid ""
-"The application '%1 ' has requested to create a new wallet named "
-"'%2 '. This is used to store sensitive data in a secure fashion. "
-"Please choose the new wallet's type below or click cancel to deny the "
-"application's request. "
-msgstr ""
-"Aplikacija '%1 ' zahtijeva otvaranje KDE-ovog novčanika. To je "
-"potrebno za spremanje osjetljivih podataka na siguran način. Molim unesite "
-"zaporku za korištenje tog novčanika ili kliknite na 'Odustani' da biste "
-"odbili zahtjev aplikacije. "
-
-#: knewwalletdialog.cpp:127 knewwalletdialog.cpp:133 kwalletwizard.cpp:161
-#: kwalletwizard.cpp:165
-msgid ""
-"The QGpgME library failed to initialize for the OpenPGP protocol. Please "
-"check your system's configuration then try again."
-msgstr ""
-
-#: knewwalletdialog.cpp:153
-msgid ""
-"Seems that your system has no keys suitable for encryption. Please set-up at "
-"least an encryption key, then try again."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QLabel, label)
-#: knewwalletdialoggpg.ui:17
-msgid "Please select the signing key from the list below:"
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QTableWidget, listCertificates)
-#: knewwalletdialoggpg.ui:52
-msgid "Name"
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QTableWidget, listCertificates)
-#: knewwalletdialoggpg.ui:57
-msgid "E-Mail"
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QTableWidget, listCertificates)
-#: knewwalletdialoggpg.ui:62
-msgid "Key-ID"
-msgstr ""
-
-#. i18n: ectx: property (comment), widget (KTitleWidget, ktitlewidget)
-#: knewwalletdialogintro.ui:17 kwalletwizardpageintro.ui:17
-msgid "The KDE Wallet System"
-msgstr "Sustav lisnice KDE-a"
-
-#. i18n: ectx: property (text), widget (QLabel, labelIntro)
-#: knewwalletdialogintro.ui:30
-#, fuzzy, no-c-format, kde-format
-#| msgid ""
-#| "The application '%1 ' has requested to open the KDE wallet. "
-#| "This is used to store sensitive data in a secure fashion. Please enter a "
-#| "password to use with this wallet or click cancel to deny the "
-#| "application's request. "
-msgid ""
-" The application '%1"
-"span>' has requested to open the KDE wallet. This is used to store sensitive "
-"data in a secure fashion. Please choose the new wallet's type below or click "
-"cancel to deny the application's request.
"
-msgstr ""
-"Aplikacija '%1 ' zahtijeva otvaranje KDE-ovog novčanika. To je "
-"potrebno za spremanje osjetljivih podataka na siguran način. Molim unesite "
-"zaporku za korištenje tog novčanika ili kliknite na 'Odustani' da biste "
-"odbili zahtjev aplikacije. "
-
-#. i18n: ectx: property (text), widget (QRadioButton, _radioBlowfish)
-#. i18n: ectx: property (text), widget (QRadioButton, radioBlowfish)
-#: knewwalletdialogintro.ui:66 kwalletwizardpagepasswordgpg.ui:68
-msgid "Classic, blowfish encrypted file"
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QRadioButton, _radioGpg)
-#. i18n: ectx: property (text), widget (QRadioButton, radioGpg)
-#: knewwalletdialogintro.ui:73 kwalletwizardpagepasswordgpg.ui:55
-msgid "Use GPG encryption, for better protection"
-msgstr ""
-
-#: kwalletd.cpp:427 kwalletd.cpp:541 kwalletd.cpp:631 kwalletd.cpp:731
-#: kwalletd.cpp:834 kwalletd.cpp:853 kwalletd.cpp:862 kwalletd.cpp:867
-#: kwalletd.cpp:1384 main.cpp:47 main.cpp:53 main.cpp:55
-msgid "KDE Wallet Service"
-msgstr "KDE-ova usluga novčanika"
-
-#: kwalletd.cpp:534
-#, kde-format
-msgid ""
-"KDE has requested to open the wallet '%1 '. Please enter the "
-"password for this wallet below. "
-msgstr ""
-"KDE zahtijeva otvaranje novčanika '%1 '. Molim unesite zaporku za "
-"taj novčanik. "
-
-#: kwalletd.cpp:536
-#, kde-format
-msgid ""
-"The application '%1 ' has requested to open the wallet '%2"
-"b>'. Please enter the password for this wallet below. "
-msgstr ""
-"Aplikacija '%1 ' zahtijeva otvaranje novčanika '%2 '. Molim "
-"unesite zaporku za taj novčanik. "
-
-#: kwalletd.cpp:551
-msgctxt "Text of a button to ignore the open-wallet notification"
-msgid "Ignore"
-msgstr "Zanemari"
-
-#: kwalletd.cpp:553
-#, kde-format
-msgid "KDE has requested to open a wallet (%1)."
-msgstr "KDE zahtijeva otvaranje novčanika (%1)."
-
-#: kwalletd.cpp:556
-msgctxt ""
-"Text of a button for switching to the (unnamed) application requesting a "
-"password"
-msgid "Switch there"
-msgstr "Prebaci tamo"
-
-#: kwalletd.cpp:558
-#, kde-format
-msgid "%1 has requested to open a wallet (%2)."
-msgstr "%1 zahtijeva otvaranje novčanika (%2)."
-
-#: kwalletd.cpp:561
-#, kde-format
-msgctxt ""
-"Text of a button for switching to the application requesting a password"
-msgid "Switch to %1"
-msgstr "Prebaci na %1"
-
-#: kwalletd.cpp:576 kwalletd.cpp:641
-#, kde-format
-msgid ""
-"Error opening the wallet '%1 '. Please try again. (Error code "
-"%2: %3) "
-msgstr ""
-"Greška pri otvaranju novčanika '%1 '. Molim pokušajte ponovo. (Kod greške %2: %3) "
-
-#: kwalletd.cpp:620
-msgid ""
-"KDE has requested to open the wallet. This is used to store sensitive data "
-"in a secure fashion. Please enter a password to use with this wallet or "
-"click cancel to deny the application's request."
-msgstr ""
-"KDE zahtijeva otvaranje novčanika. To je potrebno za spremanje osjetljivih "
-"podataka na siguran način. Molim unesite zaporku za korištenje tog novčanika "
-"ili kliknite na 'Odustani' da biste odbili zahtjev aplikacije."
-
-#: kwalletd.cpp:622
-#, kde-format
-msgid ""
-"The application '%1 ' has requested to open the KDE wallet. This "
-"is used to store sensitive data in a secure fashion. Please enter a password "
-"to use with this wallet or click cancel to deny the application's request."
-"qt>"
-msgstr ""
-"Aplikacija '%1 ' zahtijeva otvaranje KDE-ovog novčanika. To je "
-"potrebno za spremanje osjetljivih podataka na siguran način. Molim unesite "
-"zaporku za korištenje tog novčanika ili kliknite na 'Odustani' da biste "
-"odbili zahtjev aplikacije. "
-
-#: kwalletd.cpp:626
-#, kde-format
-msgid ""
-"KDE has requested to create a new wallet named '%1 '. Please "
-"choose a password for this wallet, or cancel to deny the application's "
-"request. "
-msgstr ""
-"KDE zahtijeva stvaranje novog novčanika imena '%1 '. Molim unesite "
-"zaporku za taj novčanik ili odbijte zahtjev aplikacije. "
-
-#: kwalletd.cpp:628
-#, kde-format
-msgid ""
-"The application '%1 ' has requested to create a new wallet named "
-"'%2 '. Please choose a password for this wallet, or cancel to deny the "
-"application's request. "
-msgstr ""
-"Aplikacija '%1 ' zahtijeva stvaranje novog novčanika imena '%2"
-"b>'. Molim unesite zaporku za taj novčanik ili odbijte zahtjev aplikacije."
-"qt>"
-
-#: kwalletd.cpp:733
-#, kde-format
-msgid "KDE has requested access to the open wallet '%1 '. "
-msgstr "KDE zahtijeva pristup otvorenom novčaniku '%1 '. "
-
-#: kwalletd.cpp:735
-#, kde-format
-msgid ""
-"The application '%1 ' has requested access to the open wallet '"
-"%2 '. "
-msgstr ""
-"Aplikacija '%1 ' zahtijeva pristup otvorenom novčaniku '%2 '."
-" "
-
-#: kwalletd.cpp:834
-msgid ""
-"Unable to open wallet. The wallet must be opened in order to change the "
-"password."
-msgstr ""
-"Ne mogu otvoriti novčanik. Novčanik mora biti otvoren da bi se promijenila "
-"zaporka."
-
-#: kwalletd.cpp:848
-#, kde-format
-msgid ""
-"The %1 wallet is encrypted using GPG key %2 . Please use "
-"GPG tools (such as kleopatra ) to change the passphrase "
-"associated to that key. "
-msgstr ""
-
-#: kwalletd.cpp:852
-#, kde-format
-msgid "Please choose a new password for the wallet '%1 '. "
-msgstr "Molim odaberite novu zaporku za novčanik '%1 '. "
-
-#: kwalletd.cpp:862
-msgid "Error re-encrypting the wallet. Password was not changed."
-msgstr "Greška pri ponovnoj enkripciji novčanika. Zaporka nije izmijenjena."
-
-#: kwalletd.cpp:867
-msgid "Error reopening the wallet. Data may be lost."
-msgstr "Greška pri ponovnom otvaranju novčanika. Možda su podaci izgubljeni."
-
-#: kwalletd.cpp:1384
-msgid ""
-"There have been repeated failed attempts to gain access to a wallet. An "
-"application may be misbehaving."
-msgstr ""
-"Bilo je ponovljenih neuspjelih pokušaja dobivanja pristupa novčaniku. Možda "
-"se aplikacija ne ponaša normalno."
-
-#: kwalletwizard.cpp:53
-msgid "KWallet"
-msgstr "KWallet"
-
-#: kwalletwizard.cpp:277
-msgid "Password is empty. (WARNING: Insecure) "
-msgstr "Zaporka je prazna. (UPOZORENJE: Nesigurno) "
-
-#: kwalletwizard.cpp:279
-msgid "Passwords match."
-msgstr "Zaporke se podudaraju."
-
-#: kwalletwizard.cpp:282
-msgid "Passwords do not match."
-msgstr "Zaporke se ne podudaraju."
-
-#. i18n: ectx: property (text), widget (QLabel, textLabel2_3)
-#: kwalletwizardpageexplanation.ui:17
-#, fuzzy
-#| msgid ""
-#| "The KDE Wallet system stores your data in a wallet file on your "
-#| "local hard disk. The data is only written in encrypted form, presently "
-#| "using the blowfish algorithm with your password as the key. When a "
-#| "wallet is opened, the wallet manager application will launch and display "
-#| "an icon in the system tray. You can use this application to manage your "
-#| "wallets. It even permits you to drag wallets and wallet contents, "
-#| "allowing you to easily copy a wallet to a remote system."
-msgid ""
-" The KDE Wallet system stores your data in a wallet file on your local hard disk. "
-"The data is only written in the encrypted form of your choice - blowfish "
-"algorithm with your password as the key or using a GPG encryption key. When "
-"a wallet is opened, the wallet manager application will launch and display "
-"an icon in the system tray. You can use this application to manage all of "
-"your wallets. It even permits you to drag wallets and wallet contents, "
-"allowing you to easily copy a wallet to a remote system.
"
-msgstr ""
-"KDE-ov sustav novčanika sprema vaše podatke u datoteku novčanika na "
-"Vaše računalo. Podaci se zapisuju isključivo kriptirani, trenutno pomoću "
-"algoritma blowfish s Vašom zaporkom kao ključem. Kada se novčanik otvori, "
-"aplikacija upravitelja novčanika će se pokrenuti i prikazat će se njena "
-"ikona u sistemskom bloku. Tu aplikaciju možete koristiti za upravljanje "
-"Vašim novčanicima. Čak Vam omogućuje povlačenje novčanika i njihovog "
-"sadržaja, što Vam omogućuje jednostavno i lako kopiranje novčanika na "
-"udaljeni sustav."
-
-#. i18n: ectx: property (text), widget (QLabel, label_3)
-#: kwalletwizardpagegpgkey.ui:24
-msgid ""
-" The GPG-based wallet use a GPG encryption key to "
-"securely encrypt data on disk. The key must be available when decrypting is "
-"needed or your wallet will not be accessible. For example, if you choose a "
-"SmartCard-based encryption key, the GPG system will prompt you to enter it "
-"and its associated PIN when attempting to open the wallet.
"
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QLabel, label)
-#: kwalletwizardpagegpgkey.ui:39
-msgid "Select encryption GPG key:"
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QLabel, label_2)
-#: kwalletwizardpagegpgkey.ui:78
-msgid ""
-"Unable to locate at least one encrypting GPG key . KDE Wallet needs "
-"such encrypting key to securely store passwords or other sensitive "
-"data on disk. If you still want to setup a GPG-based wallet, then cancel "
-"this wizard, set-up an encrypting GPG key , then retry this assistant. "
-"Otherwise, you may still click back, then choose a classic, blowfish "
-"encrypted file format on the previous page."
-msgstr ""
-
-#. i18n: ectx: property (text), widget (QLabel, textLabel2)
-#: kwalletwizardpageintro.ui:30
-msgid ""
-"Welcome to KWallet, the KDE Wallet System. KWallet allows you to store your "
-"passwords and other personal information on disk in an encrypted file, "
-"preventing others from viewing the information. This wizard will tell you "
-"about KWallet and help you configure it for the first time."
-msgstr ""
-"Dobrodošli u KWallet, KDE-ov sustav novčanika. KWallet Vam omogućuje "
-"spremanje Vaših zaporki i ostalih osobnih informacija na disk u enkriptiranu "
-"datoteku, ne omogućujući ostalima pregled tih informacija. Ovaj čarobnjak će "
-"Vam reći nešto o KWalletu i pomoći će Vam pri prvoj konfiguraciji istoga."
-
-#. i18n: ectx: property (text), widget (QRadioButton, _basic)
-#: kwalletwizardpageintro.ui:69
-msgid "&Basic setup (recommended)"
-msgstr "&Osnovno postavljanje (preporučeno)"
-
-#. i18n: ectx: property (text), widget (QRadioButton, _advanced)
-#: kwalletwizardpageintro.ui:79
-msgid "&Advanced setup"
-msgstr "&Napredno postavljanje"
-
-#. i18n: ectx: property (text), widget (QLabel, textLabel1_3)
-#: kwalletwizardpageoptions.ui:16
-msgid ""
-"The KDE Wallet system allows you to control the level of security of your "
-"personal data. Some of these settings do impact usability. While the "
-"default settings are generally acceptable for most users, you may wish to "
-"change some of them. You may further tune these settings from the KWallet "
-"control module."
-msgstr ""
-"KDE-ov sustav novčanika Vam omogućuje kontrolu razine sigurnosti Vaših "
-"osobnih podataka. Neke od tih postavki smanjuju jednostavnost korištenja "
-"podataka. Iako su možda uobičajene postavke prihvatljive za većinu "
-"korisnika, Vi ćete možda htjeti promijeniti neke. Detaljnije možete podesiti "
-"te postavke iz kontrolnog modula KWalleta."
-
-#. i18n: ectx: property (text), widget (QCheckBox, _closeIdle)
-#: kwalletwizardpageoptions.ui:48
-msgid "Automatically close idle wallets"
-msgstr "Automatski zatvori besposlene novčanike"
-
-#. i18n: ectx: property (text), widget (QCheckBox, _networkWallet)
-#: kwalletwizardpageoptions.ui:55
-msgid "Store network passwords and local passwords in separate wallet files"
-msgstr "Spremi mrežne i lokalne zaporke u odvojene datoteke novčanika"
-
-#. i18n: ectx: property (text), widget (QLabel, textLabel3)
-#: kwalletwizardpagepassword.ui:16
-msgid ""
-"Various applications may attempt to use the KDE wallet to store passwords or "
-"other information such as web form data and cookies. If you would like "
-"these applications to use the wallet, you must enable it now and choose a "
-"password. The password you choose cannot be recovered if it is lost, "
-"and will allow anyone who knows it to obtain all the information contained "
-"in the wallet."
-msgstr ""
-"Razne aplikacije će možda pokušati koristiti KDE-ov novčanik za spremanje "
-"zaporki i ostalih informacija poput podataka web formulara i kolačića. Ako "
-"želite da takve aplikacije koriste novčanik, to morate omogućiti sada i "
-"odabrati zaporku. Zaporka koju odaberete NE MOŽE biti otkrivena ako "
-"je izgubite, a svakome tko je poznaje će omogućiti pristup svim "
-"informacijama sadržanima u novčaniku."
-
-#. i18n: ectx: property (text), widget (QCheckBox, _useWallet)
-#: kwalletwizardpagepassword.ui:29 kwalletwizardpagepasswordgpg.ui:30
-msgid "Yes, I wish to use the KDE wallet to store my personal information."
-msgstr ""
-"Da, želim koristiti KDE-ov novčanik za spremanje svojih osobnih podataka"
-
-#. i18n: ectx: property (text), widget (QLabel, textLabel1_3)
-#: kwalletwizardpagepassword.ui:88 kwalletwizardpagepasswordgpg.ui:106
-msgid "Enter a new password:"
-msgstr "Unesite novu zaporku:"
-
-#. i18n: ectx: property (text), widget (QLabel, textLabel2_3)
-#: kwalletwizardpagepassword.ui:104 kwalletwizardpagepasswordgpg.ui:122
-msgid "Verify password:"
-msgstr "Provjera zaporke:"
-
-#. i18n: ectx: property (text), widget (QLabel, textLabel3)
-#: kwalletwizardpagepasswordgpg.ui:17
-#, fuzzy
-#| msgid ""
-#| "Various applications may attempt to use the KDE wallet to store passwords "
-#| "or other information such as web form data and cookies. If you would "
-#| "like these applications to use the wallet, you must enable it now and "
-#| "choose a password. The password you choose cannot be recovered if "
-#| "it is lost, and will allow anyone who knows it to obtain all the "
-#| "information contained in the wallet."
-msgid ""
-" Various applications may attempt to use the KDE wallet "
-"to store passwords or other information such as web form data and cookies. "
-"If you would like these applications to use the wallet, you must enable it "
-"now and choose method for its encryption.
GPG method is more secure, "
-"but you must have configured at least one encrypting key on your system."
-"p>
If you choose the classic format, be warned that the password you "
-"choose cannot be recovered if it "
-"is lost, and will allow anyone who knows it to obtain all the information "
-"contained in the wallet.
"
-msgstr ""
-"Razne aplikacije će možda pokušati koristiti KDE-ov novčanik za spremanje "
-"zaporki i ostalih informacija poput podataka web formulara i kolačića. Ako "
-"želite da takve aplikacije koriste novčanik, to morate omogućiti sada i "
-"odabrati zaporku. Zaporka koju odaberete NE MOŽE biti otkrivena ako "
-"je izgubite, a svakome tko je poznaje će omogućiti pristup svim "
-"informacijama sadržanima u novčaniku."
-
-#. i18n: ectx: property (title), widget (QGroupBox, _groupBox)
-#: kwalletwizardpagepasswordgpg.ui:46
-msgid "What kind of encryption do you wish?"
-msgstr ""
-
-#: main.cpp:51
-#, fuzzy
-#| msgid "KWallet"
-msgid "kwalletd"
-msgstr "KWallet"
-
-#: main.cpp:57
-msgid "(C) 2002-2013, The KDE Developers"
-msgstr ""
-
-#: main.cpp:58
-msgid "Valentin Rusu"
-msgstr ""
-
-#: main.cpp:58
-msgid "Maintainer, GPG backend support"
-msgstr ""
-
-#: main.cpp:59
-msgid "Michael Leupold"
-msgstr "Michael Leupold"
-
-#: main.cpp:59
-#, fuzzy
-#| msgid "Former maintainer"
-msgid "Former Maintainer"
-msgstr "Prijašnji održavatelj"
-
-#: main.cpp:60
-msgid "George Staikos"
-msgstr "George Staikos"
-
-#: main.cpp:60
-msgid "Former maintainer"
-msgstr "Prijašnji održavatelj"
-
-#: main.cpp:61
-msgid "Thiago Maceira"
-msgstr "Thiago Maceira"
-
-#: main.cpp:61
-msgid "D-Bus Interface"
-msgstr "D-Bus sučelje"
-
-#~ msgid "&Open"
-#~ msgstr "&Otvori"
-
-#~ msgid "C&reate"
-#~ msgstr "Stvo&ri"
-
-#~ msgid "(C) 2002-2008 George Staikos, Michael Leupold, Thiago Maceira"
-#~ msgstr "© 2002–2008 George Staikos, Michael Leupold, Thiago Maceira"
-
-#~ msgid "Maintainer"
-#~ msgstr "Održavatelj"
diff -Nru kde-l10n-hr-4.12.97/messages/frameworks/libkunitconversion.po kde-l10n-hr-4.13.0/messages/frameworks/libkunitconversion.po
--- kde-l10n-hr-4.12.97/messages/frameworks/libkunitconversion.po 2014-01-25 21:41:22.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/frameworks/libkunitconversion.po 1970-01-01 00:00:00.000000000 +0000
@@ -1,12136 +0,0 @@
-# Translation of libkunitconversion to Croatian
-#
-# Zarko Pintar , 2009.
-# Andrej Dundović , 2009, 2010.
-# Andrej Dundovic , 2009, 2010.
-# Marko Dimjasevic , 2011.
-# Marko Dimjašević , 2011.
-msgid ""
-msgstr ""
-"Project-Id-Version: \n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-08-02 06:20+0200\n"
-"PO-Revision-Date: 2011-07-24 13:27+0200\n"
-"Last-Translator: Marko Dimjašević \n"
-"Language-Team: Croatian \n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"Language: hr\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
-"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"X-Generator: Lokalize 1.2\n"
-"X-Environment: kde\n"
-"X-Accelerator-Marker: &\n"
-"X-Text-Markup: kde4\n"
-
-#: acceleration.cpp:28
-msgid "Acceleration"
-msgstr "Ubrzanje"
-
-#: acceleration.cpp:29
-#, kde-format
-msgctxt "%1 value, %2 unit symbol (acceleration)"
-msgid "%1 %2"
-msgstr "%1 %2"
-
-#: acceleration.cpp:32
-msgctxt "acceleration unit symbol"
-msgid "m/s²"
-msgstr "m/s²"
-
-#: acceleration.cpp:33
-msgctxt "unit description in lists"
-msgid "meters per second squared"
-msgstr "metri po sekundi na kvadrat"
-
-#: acceleration.cpp:35
-msgctxt "unit synonyms for matching user input"
-msgid "meter per second squared;meters per second squared;m/s²;m/s2;m/s^2"
-msgstr "metar u sekundi na kvadrat;metara u sekundi na kvadrat;m/s²;m/s2;m/s^2"
-
-#: acceleration.cpp:36
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 meters per second squared"
-msgstr "%1 metara u sekundi na kvadrat"
-
-#: acceleration.cpp:37
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 meter per second squared"
-msgid_plural "%1 meters per second squared"
-msgstr[0] "%1 metar u sekundi na kvadrat"
-msgstr[1] "%1 metra u sekundi na kvadrat"
-msgstr[2] "%1 metara u sekundi na kvadrat"
-
-#: acceleration.cpp:41
-msgctxt "acceleration unit symbol"
-msgid "ft/s²"
-msgstr "ft/s²"
-
-#: acceleration.cpp:42
-msgctxt "unit description in lists"
-msgid "feet per second squared"
-msgstr "stopa u sekundi na kvadrat"
-
-#: acceleration.cpp:44
-msgctxt "unit synonyms for matching user input"
-msgid "foot per second squared;feet per second squared;ft/s²;ft/s2;ft/s^2"
-msgstr ""
-"stopa u sekundi na kvadrat;stope u sekundi na kvadrat;ft/s²;ft/s2;ft/s^2"
-
-#: acceleration.cpp:45
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 feet per second squared"
-msgstr "%1 stope u sekundi na kvadrat"
-
-#: acceleration.cpp:46
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 foot per second squared"
-msgid_plural "%1 feet per second squared"
-msgstr[0] "%1 stopa u sekundi na kvadrat"
-msgstr[1] "%1 stope u sekundi na kvadrat"
-msgstr[2] "%1 stopa u sekundi na kvadrat"
-
-#: acceleration.cpp:50
-msgctxt "acceleration unit symbol"
-msgid "g"
-msgstr "g"
-
-#: acceleration.cpp:51
-msgctxt "unit description in lists"
-msgid "standard gravity"
-msgstr "standardna gravitacija"
-
-#: acceleration.cpp:52
-msgctxt "unit synonyms for matching user input"
-msgid "standard gravity;g"
-msgstr "standardna gravitacija;g"
-
-#: acceleration.cpp:53
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 times standard gravity"
-msgstr "%1 puta standardna gravitacija"
-
-#: acceleration.cpp:54
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 standard gravity"
-msgid_plural "%1 times standard gravity"
-msgstr[0] "%1 standardna gravitacija"
-msgstr[1] "%1 puta standardna gravitacija"
-msgstr[2] "%1 puta standardna gravitacija"
-
-#: angle.cpp:35
-msgid "Angle"
-msgstr "Kut"
-
-#: angle.cpp:36
-#, kde-format
-msgctxt "%1 value, %2 unit symbol (angle)"
-msgid "%1 %2"
-msgstr "%1 %2"
-
-#: angle.cpp:39
-msgctxt "angle unit symbol"
-msgid "°"
-msgstr "°"
-
-#: angle.cpp:40
-msgctxt "unit description in lists"
-msgid "degrees"
-msgstr "stupnjevi"
-
-#: angle.cpp:41
-msgctxt "unit synonyms for matching user input"
-msgid "deg;degree;degrees;°"
-msgstr "st;stupanj;stupnjevi;°"
-
-#: angle.cpp:42
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 degrees"
-msgstr "%1 stupnja"
-
-#: angle.cpp:43
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 degree"
-msgid_plural "%1 degrees"
-msgstr[0] "%1 stupanj"
-msgstr[1] "%1 stupnja"
-msgstr[2] "%1 stupnjeva"
-
-#: angle.cpp:46
-msgctxt "angle unit symbol"
-msgid "rad"
-msgstr "rad"
-
-#: angle.cpp:47
-msgctxt "unit description in lists"
-msgid "radians"
-msgstr "radijani"
-
-#: angle.cpp:48
-msgctxt "unit synonyms for matching user input"
-msgid "rad;radian;radians"
-msgstr "rad;radijan;radijani"
-
-#: angle.cpp:49
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 radians"
-msgstr "%1 radijana"
-
-#: angle.cpp:50
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 radian"
-msgid_plural "%1 radians"
-msgstr[0] "%1 radijan"
-msgstr[1] "%1 radijana"
-msgstr[2] "%1 radijana"
-
-#: angle.cpp:53
-msgctxt "angle unit symbol"
-msgid "grad"
-msgstr "grad"
-
-#: angle.cpp:54
-msgctxt "unit description in lists"
-msgid "gradians"
-msgstr "gradi"
-
-#: angle.cpp:55
-msgctxt "unit synonyms for matching user input"
-msgid "grad;gradian;gradians;grade;gon"
-msgstr "grad;gradi;gradi;gon"
-
-#: angle.cpp:56
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 gradians"
-msgstr "%1 grada"
-
-#: angle.cpp:57
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 gradian"
-msgid_plural "%1 gradians"
-msgstr[0] "%1 grad"
-msgstr[1] "%1 grada"
-msgstr[2] "%1 gradi"
-
-#: angle.cpp:60
-msgctxt "angle unit symbol"
-msgid "'"
-msgstr "'"
-
-#: angle.cpp:61
-msgctxt "unit description in lists"
-msgid "arc minutes"
-msgstr "lučne minute"
-
-#: angle.cpp:62
-msgctxt "unit synonyms for matching user input"
-msgid "minute of arc;MOA;arcminute;minute;'"
-msgstr "lučne minute;lučnih minuta;MOA;';minute"
-
-#: angle.cpp:63
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 arc minutes"
-msgstr "%1 lučnih minuta"
-
-#: angle.cpp:64
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 arc minute"
-msgid_plural "%1 arc minutes"
-msgstr[0] "%1 lučna minuta"
-msgstr[1] "%1 lučne minute"
-msgstr[2] "%1 lučnih minuta"
-
-#: angle.cpp:67
-msgctxt "angle unit symbol"
-msgid "\""
-msgstr "\""
-
-#: angle.cpp:68
-msgctxt "unit description in lists"
-msgid "arc seconds"
-msgstr "lučne sekunde"
-
-#: angle.cpp:69
-msgctxt "unit synonyms for matching user input"
-msgid "second of arc;arcsecond;second;\""
-msgstr "lučna sekunda;lučne sekunde;sekunde;\""
-
-#: angle.cpp:70
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 arc seconds"
-msgstr "%1 lučnih sekundi"
-
-#: angle.cpp:71
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 arc second"
-msgid_plural "%1 arc seconds"
-msgstr[0] "%1 lučna sekunda"
-msgstr[1] "%1 lučne sekunde"
-msgstr[2] "%1 lučnih sekundi"
-
-#: area.cpp:28
-msgctxt "Unit Category: two dimensional size of a surface"
-msgid "Area"
-msgstr "Površina"
-
-#. i18n: Used when converting to symbol string e.g. 2.34 m²
-#: area.cpp:30
-#, kde-format
-msgctxt "%1 value, %2 unit symbol (area)"
-msgid "%1 %2"
-msgstr "%1 %2"
-
-#. i18n: Used when unit symbol is needed.
-#: area.cpp:34
-msgctxt "area unit symbol"
-msgid "Ym²"
-msgstr "Ym²"
-
-#. i18n: unit as it will be shown to user wherever units are to
-#. be explicitly selected (listbox, radio buttons, checkboxes...).
-#. E.g. an application may give option "Unit of wind speed: [unit-list-box]"
-#: area.cpp:38
-msgctxt "unit description in lists"
-msgid "square yottameters"
-msgstr "jotametri kvadratni"
-
-#: area.cpp:46
-msgctxt "unit synonyms for matching user input"
-msgid "square yottameter;square yottameters;Ym²;Ym/-2;Ym^2;Ym2"
-msgstr "kvadratni jotametar;kvandratni jotametri;Ym²;Ym/-2;Ym^2;Ym2"
-
-#. i18n: This is used when a real-valued amount in units is given,
-#. such as "0.37 miles".
-#: area.cpp:49
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square yottameters"
-msgstr "%1 kvadratnih jotametara"
-
-#. i18n: This is used when a integer-valued amount in units is given,
-#. such as "1 mile" or "21 miles".
-#: area.cpp:52
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square yottameter"
-msgid_plural "%1 square yottameters"
-msgstr[0] "%1 kvadratni jotametar"
-msgstr[1] "%1 kvadratna jotametra"
-msgstr[2] "%1 kvadratnih jotametara"
-
-#: area.cpp:55
-msgctxt "area unit symbol"
-msgid "Zm²"
-msgstr "Zm²"
-
-#: area.cpp:56
-msgctxt "unit description in lists"
-msgid "square zettameters"
-msgstr "kvadratni zetametri"
-
-#: area.cpp:58
-msgctxt "unit synonyms for matching user input"
-msgid "square zettameter;square zettameters;Zm²;Zm/-2;Zm^2;Zm2"
-msgstr "kvadratni zetametar;kvadratni zetametri;Zm²;Zm/-2;Zm^2;Zm2"
-
-#: area.cpp:59
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square zettameters"
-msgstr "%1 kvadratnih zetametara"
-
-#: area.cpp:60
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square zettameter"
-msgid_plural "%1 square zettameters"
-msgstr[0] "%1 kvadratni zetametar"
-msgstr[1] "%1 kvadratna zetametra"
-msgstr[2] "%1 kvadratnih zetametara"
-
-#: area.cpp:63
-msgctxt "area unit symbol"
-msgid "Em²"
-msgstr "Em²"
-
-#: area.cpp:64
-msgctxt "unit description in lists"
-msgid "square exameters"
-msgstr "kvadratni eksametri"
-
-#: area.cpp:66
-msgctxt "unit synonyms for matching user input"
-msgid "square exameter;square exameters;Em²;Em/-2;Em^2;Em2"
-msgstr "kvadratni eksametar;kvadratni eksametri;Em²;Em/-2;Em^2;Em2"
-
-#: area.cpp:67
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square exameters"
-msgstr "%1 kvadratnih eksametara"
-
-#: area.cpp:68
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square exameter"
-msgid_plural "%1 square exameters"
-msgstr[0] "%1 kvadratni eksametar"
-msgstr[1] "%1 kvadratna eksametra"
-msgstr[2] "%1 kvadratnih eksametara"
-
-#: area.cpp:71
-msgctxt "area unit symbol"
-msgid "Pm²"
-msgstr "Pm²"
-
-#: area.cpp:72
-msgctxt "unit description in lists"
-msgid "square petameters"
-msgstr "kvadratni petametri"
-
-#: area.cpp:74
-msgctxt "unit synonyms for matching user input"
-msgid "square petameter;square petameters;Pm²;Pm/-2;Pm^2;Pm2"
-msgstr "kvadratni petametar;kvadratni petametari;Pm²;Pm/-2;Pm^2;Pm2"
-
-#: area.cpp:75
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square petameters"
-msgstr "%1 kvadratnih petametara"
-
-#: area.cpp:76
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square petameter"
-msgid_plural "%1 square petameters"
-msgstr[0] "%1 kvadratni petametar"
-msgstr[1] "%1 kvadratna petametra"
-msgstr[2] "%1 kvadratnih petametara"
-
-#: area.cpp:79
-msgctxt "area unit symbol"
-msgid "Tm²"
-msgstr "Tm²"
-
-#: area.cpp:80
-msgctxt "unit description in lists"
-msgid "square terameters"
-msgstr "kvadratni terametri"
-
-#: area.cpp:82
-msgctxt "unit synonyms for matching user input"
-msgid "square terameter;square terameters;Tm²;Tm/-2;Tm^2;Tm2"
-msgstr "kvadratni terametar;kvadratni terametari;Tm²;Tm/-2;Tm^2;Tm2"
-
-#: area.cpp:83
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square terameters"
-msgstr "%1 kvadratnih terametara"
-
-#: area.cpp:84
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square terameter"
-msgid_plural "%1 square terameters"
-msgstr[0] "%1 kvadratni terametar"
-msgstr[1] "%1 kvadratna terametra"
-msgstr[2] "%1 kvadratnih terametara"
-
-#: area.cpp:87
-msgctxt "area unit symbol"
-msgid "Gm²"
-msgstr "Gm²"
-
-#: area.cpp:88
-msgctxt "unit description in lists"
-msgid "square gigameters"
-msgstr "kvadratni gigametri"
-
-#: area.cpp:90
-msgctxt "unit synonyms for matching user input"
-msgid "square gigameter;square gigameters;Gm²;Gm/-2;Gm^2;Gm2"
-msgstr "kvadratni gigametar;kvadratni gigametri;Gm²;Gm/-2;Gm^2;Gm2"
-
-#: area.cpp:91
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square gigameters"
-msgstr "%1 kvadratnih gigametara"
-
-#: area.cpp:92
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square gigameter"
-msgid_plural "%1 square gigameters"
-msgstr[0] "%1 kvadratni gigametar"
-msgstr[1] "%1 kvadratna gigametra"
-msgstr[2] "%1 kvadratnih gigametara"
-
-#: area.cpp:95
-msgctxt "area unit symbol"
-msgid "Mm²"
-msgstr "Mm²"
-
-#: area.cpp:96
-msgctxt "unit description in lists"
-msgid "square megameters"
-msgstr "kvadratni megametri"
-
-#: area.cpp:98
-msgctxt "unit synonyms for matching user input"
-msgid "square megameter;square megameters;Mm²;Mm/-2;Mm^2;Mm2"
-msgstr "kvadratni megametar;kvadratni megametri;Mm²;Mm/-2;Mm^2;Mm2"
-
-#: area.cpp:99
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square megameters"
-msgstr "%1 kvadratnih megametara"
-
-#: area.cpp:100
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square megameter"
-msgid_plural "%1 square megameters"
-msgstr[0] "%1 kvadratni megametar"
-msgstr[1] "%1 kvadratna megametra"
-msgstr[2] "%1 kvadratnih megametara"
-
-#: area.cpp:103
-msgctxt "area unit symbol"
-msgid "km²"
-msgstr "km²"
-
-#: area.cpp:104
-msgctxt "unit description in lists"
-msgid "square kilometers"
-msgstr "kvadratni kilometri"
-
-#: area.cpp:106
-msgctxt "unit synonyms for matching user input"
-msgid "square kilometer;square kilometers;km²;km/-2;km^2;km2"
-msgstr ""
-"kvadratni kilometar;kilometar kvadratni;kvadratni kilometri;kilometri "
-"kvadratni;km²;km/-2;km^2;km2"
-
-#: area.cpp:107
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square kilometers"
-msgstr "%1 kvadratnih kilometara"
-
-#: area.cpp:108
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square kilometer"
-msgid_plural "%1 square kilometers"
-msgstr[0] "%1 kvadratni kilometar"
-msgstr[1] "%1 kvadratna kilometra"
-msgstr[2] "%1 kvadratnih kilometara"
-
-#: area.cpp:111
-msgctxt "area unit symbol"
-msgid "hm²"
-msgstr "hm²"
-
-#: area.cpp:112
-msgctxt "unit description in lists"
-msgid "square hectometers"
-msgstr "kvadratni hektometri"
-
-#: area.cpp:114
-msgctxt "unit synonyms for matching user input"
-msgid ""
-"square hectometer;square hectometers;hm²;hm/-2;hm^2;hm2;hectare;hectares"
-msgstr ""
-"kvadratni hektometar;kvadratni hektometri;hm²;hm/-2;hm^2;hm2;hektar;hektari"
-
-#: area.cpp:115
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square hectometers"
-msgstr "%1 kvadratnih hektometara"
-
-#: area.cpp:116
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square hectometer"
-msgid_plural "%1 square hectometers"
-msgstr[0] "%1 kvadratni hektometar"
-msgstr[1] "%1 kvadratna hektometra"
-msgstr[2] "%1 kvadratnih hektometara"
-
-#: area.cpp:119
-msgctxt "area unit symbol"
-msgid "dam²"
-msgstr "dam²"
-
-#: area.cpp:120
-msgctxt "unit description in lists"
-msgid "square decameters"
-msgstr "kvadratni dekametri"
-
-#: area.cpp:122
-msgctxt "unit synonyms for matching user input"
-msgid "square decameter;square decameters;dam²;dam/-2;dam^2;dam2"
-msgstr "kvadratni dekametar;kvadratni dekametri;dam²;dam/-2;dam^2;dam2"
-
-#: area.cpp:123
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square decameters"
-msgstr "%1 kvadratnih dekametara"
-
-#: area.cpp:124
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square decameter"
-msgid_plural "%1 square decameters"
-msgstr[0] "%1 kvadratni dekametar"
-msgstr[1] "%1 kvadratna dekametra"
-msgstr[2] "%1 kvadratnih dekametara"
-
-#: area.cpp:127
-msgctxt "area unit symbol"
-msgid "m²"
-msgstr "m²"
-
-#: area.cpp:128
-msgctxt "unit description in lists"
-msgid "square meters"
-msgstr "kvadratni metri"
-
-#: area.cpp:129
-msgctxt "unit synonyms for matching user input"
-msgid "square meter;square meters;m²;m/-2;m^2;m2"
-msgstr "kvadratni metar;kvadratni metri;m²;m/-2;m^2;m2"
-
-#: area.cpp:130
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square meters"
-msgstr "%1 kvadratnih metara"
-
-#: area.cpp:131
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square meter"
-msgid_plural "%1 square meters"
-msgstr[0] "%1 kvadratni metar"
-msgstr[1] "%1 kvadratna metra"
-msgstr[2] "%1 kvadratnih metara"
-
-#: area.cpp:134
-msgctxt "area unit symbol"
-msgid "dm²"
-msgstr "dm²"
-
-#: area.cpp:135
-msgctxt "unit description in lists"
-msgid "square decimeters"
-msgstr "kvadratni decimetri"
-
-#: area.cpp:137
-msgctxt "unit synonyms for matching user input"
-msgid "square decimeter;square decimeters;dm²;dm/-2;dm^2;dm2"
-msgstr "kvadratni decimetar;kvadratni decimetri;dm²;dm/-2;dm^2;dm2"
-
-#: area.cpp:138
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square decimeters"
-msgstr "%1 kvadratnih decimetara"
-
-#: area.cpp:139
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square decimeter"
-msgid_plural "%1 square decimeters"
-msgstr[0] "%1 kvadratni decimetar"
-msgstr[1] "%1 kvadratna decimetra"
-msgstr[2] "%1 kvadratnih decimetara"
-
-#: area.cpp:142
-msgctxt "area unit symbol"
-msgid "cm²"
-msgstr "cm²"
-
-#: area.cpp:143
-msgctxt "unit description in lists"
-msgid "square centimeters"
-msgstr "kvadratni centimetri"
-
-#: area.cpp:145
-msgctxt "unit synonyms for matching user input"
-msgid "square centimeter;square centimeters;cm²;cm/-2;cm^2;cm2"
-msgstr "kvadratni centimetar;kvadratni centimetri;cm²;cm/-2;cm^2;cm2"
-
-#: area.cpp:146
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square centimeters"
-msgstr "%1 kvadratnih centimetara"
-
-#: area.cpp:147
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square centimeter"
-msgid_plural "%1 square centimeters"
-msgstr[0] "%1 kvadratni centimetar"
-msgstr[1] "%1 kvadratna centimetra"
-msgstr[2] "%1 kvadratnih centimetara"
-
-#: area.cpp:150
-msgctxt "area unit symbol"
-msgid "mm²"
-msgstr "mm²"
-
-#: area.cpp:151
-msgctxt "unit description in lists"
-msgid "square millimeters"
-msgstr "kvadratni milimetri"
-
-#: area.cpp:153
-msgctxt "unit synonyms for matching user input"
-msgid "square millimeter;square millimeters;mm²;mm/-2;mm^2;mm2"
-msgstr "kvadratni milimetar;kvadratni milimetri;mm²;mm/-2;mm^2;mm2"
-
-#: area.cpp:154
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square millimeters"
-msgstr "%1 kvadratnih milimetara"
-
-#: area.cpp:155
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square millimeter"
-msgid_plural "%1 square millimeters"
-msgstr[0] "%1 kvadratni milimetar"
-msgstr[1] "%1 kvadratna milimetra"
-msgstr[2] "%1 kvadratnih milimetara"
-
-#: area.cpp:158
-msgctxt "area unit symbol"
-msgid "µm²"
-msgstr "µm²"
-
-#: area.cpp:159
-msgctxt "unit description in lists"
-msgid "square micrometers"
-msgstr "kvadratni mikrometri"
-
-#: area.cpp:161
-msgctxt "unit synonyms for matching user input"
-msgid "square micrometer;square micrometers;µm²;um²;µm/-2;µm^2;µm2"
-msgstr "kvadratni mikrometar;kvadratni mikrometri;µm²;um²;µm/-2;µm^2;µm2"
-
-#: area.cpp:162
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square micrometers"
-msgstr "%1 kvadratnih mikrometara"
-
-#: area.cpp:163
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square micrometer"
-msgid_plural "%1 square micrometers"
-msgstr[0] "%1 kvadratni mikrometar"
-msgstr[1] "%1 kvadratna mikrometra"
-msgstr[2] "%1 kvadratnih mikrometara"
-
-#: area.cpp:166
-msgctxt "area unit symbol"
-msgid "nm²"
-msgstr "nm²"
-
-#: area.cpp:167
-msgctxt "unit description in lists"
-msgid "square nanometers"
-msgstr "kvadratni nanometri"
-
-#: area.cpp:169
-msgctxt "unit synonyms for matching user input"
-msgid "square nanometer;square nanometers;nm²;nm/-2;nm^2;nm2"
-msgstr "kvadratni nanometar;kvadratni nanometri;nm²;nm/-2;nm^2;nm2"
-
-#: area.cpp:170
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square nanometers"
-msgstr "%1 kvadratnih nanometara"
-
-#: area.cpp:171
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square nanometer"
-msgid_plural "%1 square nanometers"
-msgstr[0] "%1 kvadratni nanometar"
-msgstr[1] "%1 kvadratna nanometra"
-msgstr[2] "%1 kvadratnih nanometara"
-
-#: area.cpp:174
-msgctxt "area unit symbol"
-msgid "pm²"
-msgstr "pm²"
-
-#: area.cpp:175
-msgctxt "unit description in lists"
-msgid "square picometers"
-msgstr "kvadratni pikometri"
-
-#: area.cpp:177
-msgctxt "unit synonyms for matching user input"
-msgid "square picometer;square picometers;pm²;pm/-2;pm^2;pm2"
-msgstr "kvadratni pikometar;kvadratni pikometri;pm²;pm/-2;pm^2;pm2"
-
-#: area.cpp:178
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square picometers"
-msgstr "%1 kvadratnih pikometara"
-
-#: area.cpp:179
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square picometer"
-msgid_plural "%1 square picometers"
-msgstr[0] "%1 kvadratni pikometar"
-msgstr[1] "%1 kvadratna pikometra"
-msgstr[2] "%1 kvadratnih pikometara"
-
-#: area.cpp:182
-msgctxt "area unit symbol"
-msgid "fm²"
-msgstr "fm²"
-
-#: area.cpp:183
-msgctxt "unit description in lists"
-msgid "square femtometers"
-msgstr "kvadratni femtometri"
-
-#: area.cpp:185
-msgctxt "unit synonyms for matching user input"
-msgid "square femtometer;square femtometers;fm²;fm/-2;fm^2;fm2"
-msgstr "kvadratni femtometar;kvadratni femtometri;fm²;fm/-2;fm^2;fm2"
-
-#: area.cpp:186
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square femtometers"
-msgstr "%1 kvadratnih femtometara"
-
-#: area.cpp:187
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square femtometer"
-msgid_plural "%1 square femtometers"
-msgstr[0] "%1 kvadratni femtometar"
-msgstr[1] "%1 kvadratna femtometra"
-msgstr[2] "%1 kvadratnih femtometara"
-
-#: area.cpp:190
-msgctxt "area unit symbol"
-msgid "am²"
-msgstr "am²"
-
-#: area.cpp:191
-msgctxt "unit description in lists"
-msgid "square attometers"
-msgstr "kvadratni atometri"
-
-#: area.cpp:193
-msgctxt "unit synonyms for matching user input"
-msgid "square attometer;square attometers;am²;am/-2;am^2;am2"
-msgstr "kvadratni atometar;kvadratni atometri;am²;am/-2;am^2;am2"
-
-#: area.cpp:194
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square attometers"
-msgstr "%1 kvadratnih atometara"
-
-#: area.cpp:195
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square attometer"
-msgid_plural "%1 square attometers"
-msgstr[0] "%1 kvadratni atometar"
-msgstr[1] "%1 kvadratna atometra"
-msgstr[2] "%1 kvadratnih atometara"
-
-#: area.cpp:198
-msgctxt "area unit symbol"
-msgid "zm²"
-msgstr "zm²"
-
-#: area.cpp:199
-msgctxt "unit description in lists"
-msgid "square zeptometers"
-msgstr "kvadratni zeptometri"
-
-#: area.cpp:201
-msgctxt "unit synonyms for matching user input"
-msgid "square zeptometer;square zeptometers;zm²;zm/-2;zm^2;zm2"
-msgstr "kvadratni zeptometar;kvadratni zeptometri;zm²;zm/-2;zm^2;zm2"
-
-#: area.cpp:202
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square zeptometers"
-msgstr "%1 kvadratnih zeptometara"
-
-#: area.cpp:203
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square zeptometer"
-msgid_plural "%1 square zeptometers"
-msgstr[0] "%1 kvadratni zeptometar"
-msgstr[1] "%1 kvadratna zeptometra"
-msgstr[2] "%1 kvadratnih zeptometara"
-
-#: area.cpp:206
-msgctxt "area unit symbol"
-msgid "ym²"
-msgstr "ym²"
-
-#: area.cpp:207
-msgctxt "unit description in lists"
-msgid "square yoctometers"
-msgstr "kvadratni joktometri"
-
-#: area.cpp:209
-msgctxt "unit synonyms for matching user input"
-msgid "square yoctometer;square yoctometers;ym²;ym/-2;ym^2;ym2"
-msgstr "kvadratni joktometar;kvadratni joktometri;ym²;ym/-2;ym^2;ym2"
-
-#: area.cpp:210
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square yoctometers"
-msgstr "%1 kvadratnih joktometara"
-
-#: area.cpp:211
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square yoctometer"
-msgid_plural "%1 square yoctometers"
-msgstr[0] "%1 kvadratni joktometar"
-msgstr[1] "%1 kvadratna joktometra"
-msgstr[2] "%1 kvadratnih joktometara"
-
-#: area.cpp:214
-msgctxt "area unit symbol"
-msgid "acre"
-msgstr "Aker"
-
-#: area.cpp:215
-msgctxt "unit description in lists"
-msgid "acres"
-msgstr "akri"
-
-#: area.cpp:216
-msgctxt "unit synonyms for matching user input"
-msgid "acre;acres"
-msgstr "aker;akri;acre;acres"
-
-#: area.cpp:217
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 acres"
-msgstr "%1 akra"
-
-#: area.cpp:218
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 acre"
-msgid_plural "%1 acres"
-msgstr[0] "%1 aker"
-msgstr[1] "%1 akra"
-msgstr[2] "%1 akra"
-
-#: area.cpp:221
-msgctxt "area unit symbol"
-msgid "ft²"
-msgstr "ft²"
-
-#: area.cpp:222
-msgctxt "unit description in lists"
-msgid "square feet"
-msgstr "kvadratne stope"
-
-#: area.cpp:224
-msgctxt "unit synonyms for matching user input"
-msgid "square foot;square feet;ft²;square ft;sq foot;sq ft;sq feet;feet²"
-msgstr ""
-"kvadratna stopa;kvadratne stope;ft²;square ft;sq foot;kvad stopa;kvad ft;sq "
-"feet; feet²;kvadratne stope; stopa²"
-
-#: area.cpp:225
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square feet"
-msgstr "%1 kvadratnih stopa"
-
-#: area.cpp:226
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square foot"
-msgid_plural "%1 square feet"
-msgstr[0] "%1 kvadratna stopa"
-msgstr[1] "%1 kvadratne stope"
-msgstr[2] "%1 kvadratnih stopa"
-
-#: area.cpp:229
-msgctxt "area unit symbol"
-msgid "in²"
-msgstr "in²"
-
-#: area.cpp:230
-msgctxt "unit description in lists"
-msgid "square inches"
-msgstr "kvadratni inči"
-
-#: area.cpp:232
-msgctxt "unit synonyms for matching user input"
-msgid ""
-"square inch;square inches;in²;square inch;square in;sq inches;sq inch;sq in;"
-"inch²"
-msgstr ""
-"kvadratni inč; kvadratni inči;in²;square inch;kvadratni in;kvad inči;kvad "
-"inč;kvad in;inč²;inch²"
-
-#: area.cpp:233
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square inches"
-msgstr "%1 kvadratnih inči"
-
-#: area.cpp:234
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square inch"
-msgid_plural "%1 square inches"
-msgstr[0] "%1 kvadratni inč"
-msgstr[1] "%1 kvadratna inča"
-msgstr[2] "%1 kvadratnih inči"
-
-#: area.cpp:237
-msgctxt "area unit symbol"
-msgid "mi²"
-msgstr "mi²"
-
-#: area.cpp:238
-msgctxt "unit description in lists"
-msgid "square miles"
-msgstr "kvadratne milje"
-
-#: area.cpp:240
-msgctxt "unit synonyms for matching user input"
-msgid "square mile;square miles;mi²;square mi;sq miles;sq mile;sq mi;mile²"
-msgstr ""
-"kvadratna milja;kvadratne milje;mi²;kvadratna mi;kvad milje;kvad milja;kvad "
-"mi;milja²;mile²"
-
-#: area.cpp:241
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 square miles"
-msgstr "%1 kvadratnih milja"
-
-#: area.cpp:242
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 square mile"
-msgid_plural "%1 square miles"
-msgstr[0] "%1 kvadratna milja"
-msgstr[1] "%1 kvadratne milje"
-msgstr[2] "%1 kvadratnih milja"
-
-#: converter.cpp:55
-msgid "Invalid"
-msgstr "Neispravno"
-
-#: converter.cpp:57
-#, kde-format
-msgctxt "%1 value, %2 unit symbol (default)"
-msgid "%1 %2"
-msgstr "%1 %2"
-
-#: currency.cpp:52
-msgid "Currency"
-msgstr "Valuta"
-
-#: currency.cpp:53
-msgid "From ECB"
-msgstr "Iz ECB-a"
-
-#: currency.cpp:55
-#, kde-format
-msgctxt "%1 value, %2 unit symbol (currency)"
-msgid "%1 %2"
-msgstr "%1 %2"
-
-#: currency.cpp:61
-msgctxt "EUR Euro - unit synonyms for matching user input"
-msgid "euro;euros"
-msgstr "euro;euri"
-
-#: currency.cpp:63
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 euros"
-msgstr "%1 eura"
-
-#: currency.cpp:64
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 euro"
-msgid_plural "%1 euros"
-msgstr[0] "%1 euro"
-msgstr[1] "%1 eura"
-msgstr[2] "%1 eura"
-
-#: currency.cpp:70
-msgctxt "ATS Austrian Schilling - unit synonyms for matching user input"
-msgid "schilling;schillings"
-msgstr "šiling;šilinzi"
-
-#: currency.cpp:72
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 schillings"
-msgstr "%1 šilinga"
-
-#: currency.cpp:73
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 schilling"
-msgid_plural "%1 schillings"
-msgstr[0] "%1 šiling"
-msgstr[1] "%1 šilinga"
-msgstr[2] "%1 šilinga"
-
-#: currency.cpp:78
-msgctxt "BEF Belgian Franc - unit synonyms for matching user input"
-msgid "franc;francs"
-msgstr "frank;franci"
-
-#: currency.cpp:81
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 Belgian francs"
-msgstr "%1 belgijskih franaka"
-
-#: currency.cpp:82
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 Belgian franc"
-msgid_plural "%1 Belgian francs"
-msgstr[0] "%1 belgijski franak"
-msgstr[1] "%1 belgijska franka"
-msgstr[2] "%1 belgijskih franaka"
-
-#: currency.cpp:87
-msgctxt "NLG Netherlands Guilder - unit synonyms for matching user input"
-msgid "guilder;guilders"
-msgstr "gulden;gudleni;guilder;guilders"
-
-#: currency.cpp:90
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 guilders"
-msgstr "%1 guldena"
-
-#: currency.cpp:91
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 guilder"
-msgid_plural "%1 guilders"
-msgstr[0] "%1 gulden"
-msgstr[1] "%1 guldena"
-msgstr[2] "%1 guldena"
-
-#: currency.cpp:97
-msgctxt "FIM Finnish Markka - unit synonyms for matching user input"
-msgid "markka;markkas;markkaa"
-msgstr "markka;markke;mk"
-
-#: currency.cpp:100
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 markkas"
-msgstr "%1 marakka"
-
-#: currency.cpp:101
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 markka"
-msgid_plural "%1 markkas"
-msgstr[0] "%1 markka"
-msgstr[1] "%1 markke"
-msgstr[2] "%1 marakka"
-
-#: currency.cpp:106
-msgctxt "FRF French Franc - unit synonyms for matching user input"
-msgid "franc;francs"
-msgstr "frank;franci"
-
-#: currency.cpp:109
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 French francs"
-msgstr "%1 francuskih franaka"
-
-#: currency.cpp:110
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 French franc"
-msgid_plural "%1 French francs"
-msgstr[0] "%1 francuski frank"
-msgstr[1] "%1 francuska franka"
-msgstr[2] "%1 francuskih franaka"
-
-#: currency.cpp:115
-msgctxt "DEM German Mark - unit synonyms for matching user input"
-msgid "mark;marks"
-msgstr "marka;marke"
-
-#: currency.cpp:118
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 marks"
-msgstr "%1 maraka"
-
-#: currency.cpp:119
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 mark"
-msgid_plural "%1 marks"
-msgstr[0] "%1 marka"
-msgstr[1] "%1 marke"
-msgstr[2] "%1 maraka"
-
-#: currency.cpp:124
-msgctxt "IEP Irish Pound - unit synonyms for matching user input"
-msgid "Irish pound;Irish pounds"
-msgstr "irska funta;irske funte;"
-
-#: currency.cpp:127
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 Irish pounds"
-msgstr "%1 irskih funti"
-
-#: currency.cpp:128
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 Irish pound"
-msgid_plural "%1 Irish pounds"
-msgstr[0] "%1 irska funta"
-msgstr[1] "%1 irske funte"
-msgstr[2] "%1 irskih funti"
-
-#: currency.cpp:133
-msgctxt "ITL Italian Lira - unit synonyms for matching user input"
-msgid "lira;liras"
-msgstr "lira;lire"
-
-#: currency.cpp:136
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 Italian lira"
-msgstr "%1 talijanskih lira"
-
-#: currency.cpp:137
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 Italian lira"
-msgid_plural "%1 Italian lira"
-msgstr[0] "%1 talijanska lira"
-msgstr[1] "%1 talijanske lire"
-msgstr[2] "%1 talijanskih lira"
-
-#: currency.cpp:142
-msgctxt "LUF Luxembourgish Franc - unit synonyms for matching user input"
-msgid "franc;francs"
-msgstr "frank;franci"
-
-#: currency.cpp:145
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 Luxembourgish francs"
-msgstr "%1 luksemburških franaka"
-
-#: currency.cpp:146
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 Luxembourgish franc"
-msgid_plural "%1 Luxembourgish francs"
-msgstr[0] "%1 luksemburški frank"
-msgstr[1] "%1 luksemburška franka"
-msgstr[2] "%1 luksemburških franaka"
-
-#: currency.cpp:151
-msgctxt "PTE Portugeuse Escudo - unit synonyms for matching user input"
-msgid "escudo;escudos"
-msgstr "eskudo;eskudoi"
-
-#: currency.cpp:154
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 escudos"
-msgstr "%1 eskudoa"
-
-#: currency.cpp:155
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 escudo"
-msgid_plural "%1 escudos"
-msgstr[0] "%1 eskudo"
-msgstr[1] "%1 eskudoa"
-msgstr[2] "%1 eskudoa"
-
-#: currency.cpp:160
-msgctxt "ESP Spanish Pesetas - unit synonyms for matching user input"
-msgid "peseta;pesetas"
-msgstr "peseta;pesete"
-
-#: currency.cpp:163
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 pesetas"
-msgstr "%1 peseta"
-
-#: currency.cpp:164
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 peseta"
-msgid_plural "%1 pesetas"
-msgstr[0] "%1 peseta"
-msgstr[1] "%1 pesete"
-msgstr[2] "%1 peseta"
-
-#: currency.cpp:169
-msgctxt "GRD Greek Drachma - unit synonyms for matching user input"
-msgid "drachma;drachmas"
-msgstr "drahma;drahmi;drahme"
-
-#: currency.cpp:172
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 drachmas"
-msgstr "%1 drahmi"
-
-#: currency.cpp:173
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 drachma"
-msgid_plural "%1 drachmas"
-msgstr[0] "%1 drahma"
-msgstr[1] "%1 drahme"
-msgstr[2] "%1 drahmi"
-
-#: currency.cpp:178
-msgctxt "SIT Slovenian Tolar - unit synonyms for matching user input"
-msgid "tolar;tolars;tolarjev"
-msgstr "tolar;tolari;tolara"
-
-#: currency.cpp:180
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 tolars"
-msgstr "%1 tolara"
-
-#: currency.cpp:181
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 tolar"
-msgid_plural "%1 tolars"
-msgstr[0] "%1 tolar"
-msgstr[1] "%1 tolara"
-msgstr[2] "%1 tolara"
-
-#: currency.cpp:187
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "cypriot pound;cypriot pounds;CYP;cyp;cyprus"
-msgctxt "CYP Cypriot Pound - unit synonyms for matching user input"
-msgid "Cypriot pound;Cypriot pounds"
-msgstr "ciparska funta;ciparske funte;CYP;cyp;ciparska"
-
-#: currency.cpp:190
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 cypriot pounds"
-msgctxt "amount in units (real)"
-msgid "%1 Cypriot pounds"
-msgstr "%1 ciparskih funti"
-
-#: currency.cpp:191
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 cypriot pound"
-#| msgid_plural "%1 cypriot pounds"
-msgctxt "amount in units (integer)"
-msgid "%1 Cypriot pound"
-msgid_plural "%1 Cypriot pounds"
-msgstr[0] "%1 ciparska funta"
-msgstr[1] "%1 ciparske funte"
-msgstr[2] "%1 ciparskih funti"
-
-#: currency.cpp:196
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "maltese liras"
-msgctxt "MTL Maltese Lira - unit synonyms for matching user input"
-msgid "Maltese lira"
-msgstr "malteške lire"
-
-#: currency.cpp:198
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 maltese lira"
-#| msgid_plural "%1 maltese liras"
-msgctxt "amount in units (real)"
-msgid "%1 Maltese lira"
-msgstr "%1 malteška lira"
-
-#: currency.cpp:199
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 maltese lira"
-#| msgid_plural "%1 maltese liras"
-msgctxt "amount in units (integer)"
-msgid "%1 Maltese lira"
-msgid_plural "%1 Maltese lira"
-msgstr[0] "%1 malteška lira"
-msgstr[1] "%1 malteške lire"
-msgstr[2] "%1 malteških lira"
-
-#: currency.cpp:205
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "koruna;korunas;SKK;skk;slovakia"
-msgctxt "SKK Slovak Koruna - unit synonyms for matching user input"
-msgid "koruna;korunas;koruny;korun"
-msgstr "kruna;krune;SKK;skk;slovačka"
-
-#: currency.cpp:208
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 slovak korunas"
-msgctxt "amount in units (real)"
-msgid "%1 Slovak korunas"
-msgstr "%1 slovačkih kruna"
-
-#: currency.cpp:209
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 slovak koruna"
-#| msgid_plural "%1 slovak korunas"
-msgctxt "amount in units (integer)"
-msgid "%1 Slovak koruna"
-msgid_plural "%1 Slovak korunas"
-msgstr[0] "%1 slovačka kruna"
-msgstr[1] "%1 slovačke krune"
-msgstr[2] "%1 slovačkih kruna"
-
-#: currency.cpp:216
-msgctxt "USD United States Dollars - unit synonyms for matching user input"
-msgid "dollar;dollars"
-msgstr "dolar;dolari"
-
-#: currency.cpp:219
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 United States dollars"
-msgstr "%1 američkih dolara"
-
-#: currency.cpp:220
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 United States dollar"
-msgid_plural "%1 United States dollars"
-msgstr[0] "%1 američki dolar"
-msgstr[1] "%1 američka dolara"
-msgstr[2] "%1 američkih dolara"
-
-#: currency.cpp:225
-msgctxt "JPY Japanese Yen - unit synonyms for matching user input"
-msgid "yen"
-msgstr "jen;yen"
-
-#: currency.cpp:228
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 yen"
-msgstr "%1 jena"
-
-#: currency.cpp:229
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 yen"
-msgid_plural "%1 yen"
-msgstr[0] "%1 jen"
-msgstr[1] "%1 jena"
-msgstr[2] "%1 jena"
-
-#: currency.cpp:234
-msgctxt "BGN Bulgarian Lev - unit synonyms for matching user input"
-msgid "lev;leva"
-msgstr "lev;leva"
-
-#: currency.cpp:236
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 leva"
-msgstr "%1 leva"
-
-#: currency.cpp:237
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 lev"
-msgid_plural "%1 leva"
-msgstr[0] "%1 lev"
-msgstr[1] "%1 leva"
-msgstr[2] "%1 leva"
-
-#: currency.cpp:242
-msgctxt "CZK Czech Koruna - unit synonyms for matching user input"
-msgid "koruna;korunas"
-msgstr "kruna;krune"
-
-#: currency.cpp:245
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 Czech korunas"
-msgstr "%1 čeških kruna"
-
-#: currency.cpp:247
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 Czech koruna"
-msgid_plural "%1 Czech korunas"
-msgstr[0] "%1 češka kruna"
-msgstr[1] "%1 češke krune"
-msgstr[2] "%1 čeških kruna"
-
-#: currency.cpp:253
-msgctxt "DKK Danish Krone - unit synonyms for matching user input"
-msgid "Danish krone;Danish kroner"
-msgstr "danska kruna;danskih kruna"
-
-#: currency.cpp:256
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 Danish kroner"
-msgstr "%1 danska kruna"
-
-#: currency.cpp:257
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 Danish krone"
-msgid_plural "%1 Danish kroner"
-msgstr[0] "%1 danska kruna"
-msgstr[1] "%1 danske krune"
-msgstr[2] "%1 danskih kruna"
-
-#: currency.cpp:262
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "kroon;kroons;EEK;eek;estonia"
-msgctxt "EEK Estonian Kroon - unit synonyms for matching user input"
-msgid "kroon;kroons;krooni"
-msgstr "estonska kruna;estonske krune;EEK;eek;estonska;kroon"
-
-#: currency.cpp:265
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 kroons"
-msgstr "%1 estonskih kruna"
-
-#: currency.cpp:266
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 kroon"
-msgid_plural "%1 kroons"
-msgstr[0] "%1 estonska kruna"
-msgstr[1] "%1 estonske krune"
-msgstr[2] "%1 estonskih kruna"
-
-#: currency.cpp:272
-msgctxt "GBP British Pound - unit synonyms for matching user input"
-msgid "pound;pounds;pound sterling;pounds sterling"
-msgstr "funta;funti;funte;britanska funta;britanskih funta;britanske funte"
-
-#: currency.cpp:276
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 pounds sterling"
-msgstr "%1 britanskih funti"
-
-#: currency.cpp:277
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 pound sterling"
-msgid_plural "%1 pounds sterling"
-msgstr[0] "%1 britanska funta"
-msgstr[1] "%1 britanske funte"
-msgstr[2] "%1 britanskih funti"
-
-#: currency.cpp:282
-msgctxt "HUF hungarian Forint - unit synonyms for matching user input"
-msgid "forint"
-msgstr "forinta"
-
-#: currency.cpp:285
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 forint"
-msgstr "%1 forinta"
-
-#: currency.cpp:286
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 forint"
-msgid_plural "%1 forint"
-msgstr[0] "%1 forinta"
-msgstr[1] "%1 forinte"
-msgstr[2] "%1 forinta"
-
-#: currency.cpp:291
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "litas;litass;LTL;ltl;lithuania"
-msgctxt "LTL Lithuanian Litas - unit synonyms for matching user input"
-msgid "litas;litai;litu"
-msgstr "litas;litasi;LTL;ltl;litvanska"
-
-#: currency.cpp:294
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 litas"
-#| msgid_plural "%1 litass"
-msgctxt "amount in units (real)"
-msgid "%1 litas"
-msgstr "%1 litas"
-
-#: currency.cpp:295
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 litas"
-#| msgid_plural "%1 litass"
-msgctxt "amount in units (integer)"
-msgid "%1 litas"
-msgid_plural "%1 litai"
-msgstr[0] "%1 litas"
-msgstr[1] "%1 litasa"
-msgstr[2] "%1 litasa"
-
-#: currency.cpp:300
-msgctxt "LVL Latvian Lats - unit synonyms for matching user input"
-msgid "lats;lati"
-msgstr ""
-
-#: currency.cpp:302
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 lats"
-#| msgid_plural "%1 latss"
-msgctxt "amount in units (real)"
-msgid "%1 lati"
-msgstr "%1 lats"
-
-#: currency.cpp:303
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 lats"
-#| msgid_plural "%1 latss"
-msgctxt "amount in units (integer)"
-msgid "%1 lats"
-msgid_plural "%1 lati"
-msgstr[0] "%1 lats"
-msgstr[1] "%1 latsa"
-msgstr[2] "%1 latsa"
-
-#: currency.cpp:308
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "zloty;zlotys;PLN;pln;poland"
-msgctxt "PLN Polish Zloty - unit synonyms for matching user input"
-msgid "zloty;zlotys;zloties"
-msgstr "zlot;zloti;PLN;pln;poljska"
-
-#: currency.cpp:311
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 zlotys"
-msgstr "%1 zlota"
-
-#: currency.cpp:312
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 zloty"
-msgid_plural "%1 zlotys"
-msgstr[0] "%1 zlot"
-msgstr[1] "%1 zlota"
-msgstr[2] "%1 zlota"
-
-#: currency.cpp:317
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "mile;miles;mi"
-msgctxt "RON Roumanian Leu - unit synonyms for matching user input"
-msgid "leu;lei"
-msgstr "milja;milje;mi"
-
-#: currency.cpp:320
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 levs"
-msgctxt "amount in units (real)"
-msgid "%1 lei"
-msgstr "%1 leva"
-
-#: currency.cpp:321
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 leu"
-#| msgid_plural "%1 leus"
-msgctxt "amount in units (integer)"
-msgid "%1 leu"
-msgid_plural "%1 lei"
-msgstr[0] "%1 leu"
-msgstr[1] "%1 leua"
-msgstr[2] "%1 leua"
-
-#: currency.cpp:326
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "kroon;kroons;EEK;eek;estonia"
-msgctxt "SEK Swedish Krona - unit synonyms for matching user input"
-msgid "krona;kronor"
-msgstr "estonska kruna;estonske krune;EEK;eek;estonska;kroon"
-
-#: currency.cpp:329
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 kroon"
-#| msgid_plural "%1 kroons"
-msgctxt "amount in units (real)"
-msgid "%1 kronor"
-msgstr "%1 estonska kruna"
-
-#: currency.cpp:330
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 krona"
-#| msgid_plural "%1 kronas"
-msgctxt "amount in units (integer)"
-msgid "%1 krona"
-msgid_plural "%1 kronor"
-msgstr[0] "%1 švedska kruna"
-msgstr[1] "%1 švedske krune"
-msgstr[2] "%1 švedskih kruna"
-
-#: currency.cpp:335
-msgctxt "CHF Swiss Francs - unit synonyms for matching user input"
-msgid "franc;francs"
-msgstr "franak;franaka;franka"
-
-#: currency.cpp:338
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 Swiss francs"
-msgstr "%1 švicarskih franaka"
-
-#: currency.cpp:339
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 Swiss franc"
-msgid_plural "%1 Swiss francs"
-msgstr[0] "%1 švicarski franak"
-msgstr[1] "%1 švicarska franka"
-msgstr[2] "%1 švicarskih franaka"
-
-#: currency.cpp:345
-msgctxt "Norwegian Krone - unit synonyms for matching user input"
-msgid "Norwegian krone;Norwegian kroner"
-msgstr "norveška kruna;norveške krune;noverških kruna"
-
-#: currency.cpp:348
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 Norwegian kroner"
-msgstr "%1 norveških kruna"
-
-#: currency.cpp:349
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 Norwegian krone"
-msgid_plural "%1 Norwegian kroner"
-msgstr[0] "%1 norveška kruna"
-msgstr[1] "%1 norveške krune"
-msgstr[2] "%1 norveških kruna"
-
-#: currency.cpp:354
-msgctxt "HRK Croatian Kuna - unit synonyms for matching user input"
-msgid "kuna;kune"
-msgstr "kuna;kune"
-
-#: currency.cpp:357
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 kune"
-msgstr "%1 kuna"
-
-#: currency.cpp:358
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 kuna"
-msgid_plural "%1 kune"
-msgstr[0] "%1 kuna"
-msgstr[1] "%1 kune"
-msgstr[2] "%1 kuna"
-
-#: currency.cpp:364
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "rouble;roubles;RUB;rub;russia"
-msgctxt "RUB Russsian Ruble - unit synonyms for matching user input"
-msgid "ruble;rubles;rouble;roubles"
-msgstr "rubalj;rublji;RUB;rub;ruska"
-
-#: currency.cpp:367
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 roubles"
-msgctxt "amount in units (real)"
-msgid "%1 rubles"
-msgstr "%1 rubalja"
-
-#: currency.cpp:368
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 rouble"
-#| msgid_plural "%1 roubles"
-msgctxt "amount in units (integer)"
-msgid "%1 ruble"
-msgid_plural "%1 rubles"
-msgstr[0] "%1 rublja"
-msgstr[1] "%1 rublje"
-msgstr[2] "%1 rubalja"
-
-#: currency.cpp:373
-msgctxt "TRY Turkish Lira - unit synonyms for matching user input"
-msgid "lira"
-msgstr ""
-
-#: currency.cpp:376
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 turkish lira"
-#| msgid_plural "%1 turkish liras"
-msgctxt "amount in units (real)"
-msgid "%1 Turkish lira"
-msgstr "%1 turska lira"
-
-#: currency.cpp:377
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 turkish lira"
-#| msgid_plural "%1 turkish liras"
-msgctxt "amount in units (integer)"
-msgid "%1 Turkish lira"
-msgid_plural "%1 Turkish lira"
-msgstr[0] "%1 turska lira"
-msgstr[1] "%1 turske lire"
-msgstr[2] "%1 turskih lira"
-
-#: currency.cpp:383
-msgctxt "AUD Australian Dollar - unit synonyms for matching user input"
-msgid "Australian dollar;Australian dollars"
-msgstr "australski dolar;australski dolari"
-
-#: currency.cpp:386
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 Australian dollars"
-msgstr "%1 australskih dolara"
-
-#: currency.cpp:387
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 Australian dollar"
-msgid_plural "%1 Australian dollars"
-msgstr[0] "%1 australski dolar"
-msgstr[1] "%1 australska dolara"
-msgstr[2] "%1 australskih dolara"
-
-#: currency.cpp:392
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "reals"
-msgctxt "BRL Brazillian Real - unit synonyms for matching user input"
-msgid "real;reais"
-msgstr "reali"
-
-#: currency.cpp:395
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 reals"
-msgctxt "amount in units (real)"
-msgid "%1 reais"
-msgstr "%1 reala"
-
-#: currency.cpp:396
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 real"
-#| msgid_plural "%1 reals"
-msgctxt "amount in units (integer)"
-msgid "%1 real"
-msgid_plural "%1 reais"
-msgstr[0] "%1 real"
-msgstr[1] "%1 reala"
-msgstr[2] "%1 reala"
-
-#: currency.cpp:402
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "canadian dollar;canadian dollars;CAD;cad;canada"
-msgctxt "Canadian Dollar - unit synonyms for matching user input"
-msgid "Canadian dollar;Canadian dollars"
-msgstr "kanadski dolar;kanadski dolari;CAD;cad;kanadska"
-
-#: currency.cpp:405
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 canadian dollars"
-msgctxt "amount in units (real)"
-msgid "%1 Canadian dollars"
-msgstr "%1 kanadskih dolara"
-
-#: currency.cpp:406
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 canadian dollar"
-#| msgid_plural "%1 canadian dollars"
-msgctxt "amount in units (integer)"
-msgid "%1 Canadian dollar"
-msgid_plural "%1 Canadian dollars"
-msgstr[0] "%1 kanadski dolar"
-msgstr[1] "%1 kanadska dolara"
-msgstr[2] "%1 kanadskih dolara"
-
-#: currency.cpp:411
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "yuans"
-msgctxt "Chinese Yuan - unit synonyms for matching user input"
-msgid "yuan"
-msgstr "yuani"
-
-#: currency.cpp:414
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 yuan"
-#| msgid_plural "%1 yuans"
-msgctxt "amount in units (real)"
-msgid "%1 yuan"
-msgstr "%1 yuan"
-
-#: currency.cpp:415
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 yuan"
-#| msgid_plural "%1 yuans"
-msgctxt "amount in units (integer)"
-msgid "%1 yuan"
-msgid_plural "%1 yuan"
-msgstr[0] "%1 yuan"
-msgstr[1] "%1 yuana"
-msgstr[2] "%1 yuana"
-
-#: currency.cpp:421
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "hong kong dollar;hong kong dollars;HKD;hkd;hong kong"
-msgctxt "Hong Kong Dollar - unit synonyms for matching user input"
-msgid "Hong Kong dollar;Hong Kong dollars"
-msgstr "hongkonški dolar;hongkonški dolari;HKD;hkd;hongkonška"
-
-#: currency.cpp:424
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 hong kong dollars"
-msgctxt "amount in units (real)"
-msgid "%1 Hong Kong dollars"
-msgstr "%1 hongkonških dolara"
-
-#: currency.cpp:425
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 hong kong dollar"
-#| msgid_plural "%1 hong kong dollars"
-msgctxt "amount in units (integer)"
-msgid "%1 Hong Kong dollar"
-msgid_plural "%1 Hong Kong dollars"
-msgstr[0] "%1 hongkonški dolar"
-msgstr[1] "%1 hongkonška dolara"
-msgstr[2] "%1 hongkonških dolara"
-
-#: currency.cpp:430
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "rupiahs"
-msgctxt "IDR Indonesian Rupiah - unit synonyms for matching user input"
-msgid "rupiah;rupiahs"
-msgstr "rupiji"
-
-#: currency.cpp:433
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 rupiahs"
-msgstr "%1 rupija"
-
-#: currency.cpp:434
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 rupiah"
-msgid_plural "%1 rupiahs"
-msgstr[0] "%1 rupi"
-msgstr[1] "%1 rupija"
-msgstr[2] "%1 rupija"
-
-#: currency.cpp:439
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "rupees"
-msgctxt "INR Indian Rupee - unit synonyms for matching user input"
-msgid "rupee;rupees"
-msgstr "indijski rupiji"
-
-#: currency.cpp:442
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 rupees"
-msgstr "%1 indijskih rupija"
-
-#: currency.cpp:443
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 rupee"
-msgid_plural "%1 rupees"
-msgstr[0] "%1 indijski rupi"
-msgstr[1] "%1 indijska rupija"
-msgstr[2] "%1 indijskih rupija"
-
-#: currency.cpp:448
-msgctxt "KRW Korean Won - unit synonyms for matching user input"
-msgid "won"
-msgstr "won"
-
-#: currency.cpp:451
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 won"
-msgstr "%1 wona"
-
-#: currency.cpp:452
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 won"
-msgid_plural "%1 won"
-msgstr[0] "%1 won"
-msgstr[1] "%1 wona"
-msgstr[2] "%1 wona"
-
-#: currency.cpp:458
-msgctxt "MXN Mexican Peso - unit synonyms for matching user input"
-msgid "Mexican peso;Mexican pesos"
-msgstr "meksički peso;meksički pesosi;"
-
-#: currency.cpp:461
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 mexican pesos"
-msgctxt "amount in units (real)"
-msgid "%1 Mexican pesos"
-msgstr "%1 meksičkih pesosa"
-
-#: currency.cpp:462
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 mexican peso"
-#| msgid_plural "%1 mexican pesos"
-msgctxt "amount in units (integer)"
-msgid "%1 Mexican peso"
-msgid_plural "%1 Mexican pesos"
-msgstr[0] "%1 meksički peso"
-msgstr[1] "%1 meksička pesoa"
-msgstr[2] "%1 meksičkih pesosa"
-
-#: currency.cpp:467
-msgctxt "MYR Malasian Ringgit - unit synonyms for matching user input"
-msgid "ringgit;ringgits"
-msgstr "ringgit;riggiti"
-
-#: currency.cpp:470
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 ringgit"
-msgstr "%1 ringgita"
-
-#: currency.cpp:471
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 ringgit"
-msgid_plural "%1 ringgit"
-msgstr[0] "%1 ringgit"
-msgstr[1] "%1 ringgita"
-msgstr[2] "%1 ringgita"
-
-#: currency.cpp:477
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "new zealand dollar;new zealand dollars;NZD;nzd;new zealand"
-msgctxt "NZD New Zealand Dollar - unit synonyms for matching user input"
-msgid "New Zealand dollar;New Zealand dollars"
-msgstr "novozelandski dolari;novozelandski dolari;NZD;nzd;novozelandska"
-
-#: currency.cpp:480
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 new zealand dollars"
-msgctxt "amount in units (real)"
-msgid "%1 New Zealand dollars"
-msgstr "%1 novozelandskih dolara"
-
-#: currency.cpp:481
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 new zealand dollar"
-#| msgid_plural "%1 new zealand dollars"
-msgctxt "amount in units (integer)"
-msgid "%1 New Zealand dollar"
-msgid_plural "%1 New Zealand dollars"
-msgstr[0] "%1 novozelandski dolar"
-msgstr[1] "%1 novozelandska dolara"
-msgstr[2] "%1 novozelandskih dolara"
-
-#: currency.cpp:487
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "philippine peso;philippine pesos;PHP;php;philippines"
-msgctxt "PHP Philippine Peso - unit synonyms for matching user input"
-msgid "Philippine peso;Philippine pesos"
-msgstr "filipinski peso;filipinski pesosi;PHP;php;filipinska"
-
-#: currency.cpp:490
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 philippine pesos"
-msgctxt "amount in units (real)"
-msgid "%1 Philippine pesos"
-msgstr "%1 filipinskih pesosa"
-
-#: currency.cpp:491
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 philippine peso"
-#| msgid_plural "%1 philippine pesos"
-msgctxt "amount in units (integer)"
-msgid "%1 Philippine peso"
-msgid_plural "%1 Philippine pesos"
-msgstr[0] "%1 filipinski peso"
-msgstr[1] "%1 filipinska pesosa"
-msgstr[2] "%1 filipinskih pesosa"
-
-#: currency.cpp:497
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "singapore dollar;singapore dollars;SGD;sgd;singapore"
-msgctxt "SGD Singapore Dollar - unit synonyms for matching user input"
-msgid "Singapore dollar;Singapore dollars"
-msgstr "singapurski dolar;singapurski dolari;SGD;sgd;singapurska"
-
-#: currency.cpp:500
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 singapore dollars"
-msgctxt "amount in units (real)"
-msgid "%1 Singapore dollars"
-msgstr "%1 singapurskih dolara"
-
-#: currency.cpp:501
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 singapore dollar"
-#| msgid_plural "%1 singapore dollars"
-msgctxt "amount in units (integer)"
-msgid "%1 Singapore dollar"
-msgid_plural "%1 Singapore dollars"
-msgstr[0] "%1 singapurski dolar"
-msgstr[1] "%1 singapurska dolara"
-msgstr[2] "%1 singapurskih dolara"
-
-#: currency.cpp:506
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "bahts"
-msgctxt "THB Thai Baht - unit synonyms for matching user input"
-msgid "baht"
-msgstr "bahti"
-
-#: currency.cpp:509
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 baht"
-#| msgid_plural "%1 bahts"
-msgctxt "amount in units (real)"
-msgid "%1 baht"
-msgstr "%1 baht"
-
-#: currency.cpp:510
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 baht"
-#| msgid_plural "%1 bahts"
-msgctxt "amount in units (integer)"
-msgid "%1 baht"
-msgid_plural "%1 baht"
-msgstr[0] "%1 baht"
-msgstr[1] "%1 bahta"
-msgstr[2] "%1 bahti"
-
-#: currency.cpp:515
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "rands"
-msgctxt "South African Rand - unit synonyms for matching user input"
-msgid "rand"
-msgstr "randi"
-
-#: currency.cpp:518
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 rand"
-#| msgid_plural "%1 rands"
-msgctxt "amount in units (real)"
-msgid "%1 rand"
-msgstr "%1 rand"
-
-#: currency.cpp:519
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 rand"
-#| msgid_plural "%1 rands"
-msgctxt "amount in units (integer)"
-msgid "%1 rand"
-msgid_plural "%1 rand"
-msgstr[0] "%1 rand"
-msgstr[1] "%1 randa"
-msgstr[2] "%1 randi"
-
-#: density.cpp:28
-msgid "Density"
-msgstr "Gustoća"
-
-#: density.cpp:29
-#, kde-format
-msgctxt "%1 value, %2 unit symbol (density)"
-msgid "%1 %2"
-msgstr "%1 %2"
-
-#: density.cpp:32
-msgctxt "density unit symbol"
-msgid "kg/m³"
-msgstr "kg/m³"
-
-#: density.cpp:33
-msgctxt "unit description in lists"
-msgid "kilograms per cubic meter"
-msgstr "kilograma po kubičnom metru"
-
-#: density.cpp:35
-msgctxt "unit synonyms for matching user input"
-msgid "kilogram per cubic meter;kilograms per cubic meter;kg/m³"
-msgstr ""
-"kilogram po kubičnom metru;kilogram po metru kubičnom;kilograma po kubičnom "
-"metru;kilograma po metru kubičnom;kg/m³"
-
-#: density.cpp:36
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 kilograms per cubic meter"
-msgstr "%1 kilograma po kubičnom metru"
-
-#: density.cpp:38
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 kilogram per cubic meter"
-msgid_plural "%1 kilograms per cubic meter"
-msgstr[0] "%1 kilogram po kubičnom metru"
-msgstr[1] "%1 kilograma po kubičnom metru"
-msgstr[2] "%1 kilograma po kubičnom metru"
-
-#: density.cpp:43
-msgctxt "density unit symbol"
-msgid "kg/l"
-msgstr "kg/l"
-
-#: density.cpp:44
-msgctxt "unit description in lists"
-msgid "kilograms per liter"
-msgstr "kilograma po litri"
-
-#: density.cpp:46
-msgctxt "unit synonyms for matching user input"
-msgid "kilogram per liter;kilograms per liter;kg/l"
-msgstr "kilogram po litri;kilograma po litri;kg/l"
-
-#: density.cpp:47
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 kilograms per liter"
-msgstr "%1 kilograma po litri"
-
-#: density.cpp:48
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 kilogram per liter"
-msgid_plural "%1 kilograms per liter"
-msgstr[0] "%1 kilogram po litri"
-msgstr[1] "%1 kilograma po litri"
-msgstr[2] "%1 kilograma po litri"
-
-#: density.cpp:51
-msgctxt "density unit symbol"
-msgid "g/l"
-msgstr "g/l"
-
-#: density.cpp:52
-msgctxt "unit description in lists"
-msgid "grams per liter"
-msgstr "grama po litri"
-
-#: density.cpp:53
-msgctxt "unit synonyms for matching user input"
-msgid "gram per liter;grams per liter;g/l"
-msgstr "gram po litri;grama po litri;g/l"
-
-#: density.cpp:54
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 grams per liter"
-msgstr "%1 grama po litri"
-
-#: density.cpp:55
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 gram per liter"
-msgid_plural "%1 grams per liter"
-msgstr[0] "%1 gram po litri"
-msgstr[1] "%1 grama po litri"
-msgstr[2] "%1 grama po litri"
-
-#: density.cpp:58
-msgctxt "density unit symbol"
-msgid "g/ml"
-msgstr "g/ml"
-
-#: density.cpp:59
-msgctxt "unit description in lists"
-msgid "grams per milliliter"
-msgstr "grama po mililitri"
-
-#: density.cpp:61
-msgctxt "unit synonyms for matching user input"
-msgid "gram per milliliter;grams per milliliter;g/ml"
-msgstr "gram po mililitri;grama po mililitri;g/ml"
-
-#: density.cpp:62
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 grams per milliliter"
-msgstr "%1 grama po mililitri"
-
-#: density.cpp:63
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 gram per milliliter"
-msgid_plural "%1 grams per milliliter"
-msgstr[0] "%1 gram po mililitri"
-msgstr[1] "%1 grama po mililitri"
-msgstr[2] "%1 grama po mililitri"
-
-#: density.cpp:68
-msgctxt "density unit symbol"
-msgid "oz/in³"
-msgstr "oz/in³"
-
-#: density.cpp:69
-msgctxt "unit description in lists"
-msgid "ounces per cubic inch"
-msgstr "unci po kubičnom inču"
-
-#: density.cpp:71
-msgctxt "unit synonyms for matching user input"
-msgid "ounce per cubic inch;ounces per cubic inch;oz/in³"
-msgstr "unca po kubičnom inču;unci po kubičnom inču;oz/in³"
-
-#: density.cpp:72
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 ounces per cubic inch"
-msgstr "%1 unca po kubičnom inču"
-
-#: density.cpp:73
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 ounce per cubic inch"
-msgid_plural "%1 ounces per cubic inch"
-msgstr[0] "%1 unca po kubičnom inču"
-msgstr[1] "%1 unca po kubičnom inču"
-msgstr[2] "%1 unca po kubičnom inču"
-
-#: density.cpp:76
-msgctxt "density unit symbol"
-msgid "oz/ft³"
-msgstr "oz/ft³"
-
-#: density.cpp:77
-msgctxt "unit description in lists"
-msgid "ounces per cubic foot"
-msgstr "unci po kubičnoj stopi"
-
-#: density.cpp:79
-msgctxt "unit synonyms for matching user input"
-msgid "ounce per cubic foot;ounces per cubic foot;oz/ft³"
-msgstr "unca po kubičnoj stopi;unci po kubičnoj stopi;oz/ft³"
-
-#: density.cpp:80
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 ounces per cubic foot"
-msgstr "%1 unca po kubičnoj stopi"
-
-#: density.cpp:81
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 ounce per cubic foot"
-msgid_plural "%1 ounces per cubic foot"
-msgstr[0] "%1 unca po kubičnoj stopi"
-msgstr[1] "%1 unca po kubičnoj stopi"
-msgstr[2] "%1 unca po kubičnoj stopi"
-
-#: density.cpp:84
-msgctxt "density unit symbol"
-msgid "lb/in³"
-msgstr "lb/in³"
-
-#: density.cpp:85
-msgctxt "unit description in lists"
-msgid "pounds per cubic inch"
-msgstr "funte po kubičnom inču"
-
-#: density.cpp:87
-msgctxt "unit synonyms for matching user input"
-msgid "pound per cubic inch;pounds per cubic inch;lb/in³"
-msgstr "funta po kubičnom inču;funte po kubičnom inču;lb/in³"
-
-#: density.cpp:88
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 pounds per cubic inch"
-msgstr "%1 funti po kubičnom inču"
-
-#: density.cpp:89
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 pound per cubic inch"
-msgid_plural "%1 pounds per cubic inch"
-msgstr[0] "%1 funta po kubičnom inču"
-msgstr[1] "%1 funte po kubičnom inču"
-msgstr[2] "%1 funti po kubičnom inču"
-
-#: density.cpp:92
-msgctxt "density unit symbol"
-msgid "lb/ft³"
-msgstr "lb/ft³"
-
-#: density.cpp:93
-msgctxt "unit description in lists"
-msgid "pounds per cubic foot"
-msgstr "funte po kubičnoj stopi"
-
-#: density.cpp:95
-msgctxt "unit synonyms for matching user input"
-msgid "pound per cubic foot;pounds per cubic foot;lb/ft³"
-msgstr "funta po kubičnoj stopi;funte po kubičnoj stopi;lb/ft³"
-
-#: density.cpp:96
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 pounds per cubic foot"
-msgstr "%1 funti po kubičnoj stopi"
-
-#: density.cpp:97
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 pound per cubic foot"
-msgid_plural "%1 pounds per cubic foot"
-msgstr[0] "%1 funta po kubičnoj stopi"
-msgstr[1] "%1 funte po kubičnoj stopi"
-msgstr[2] "%1 funti po kubičnoj stopi"
-
-#: density.cpp:100
-msgctxt "density unit symbol"
-msgid "lb/yd³"
-msgstr "lb/yd³"
-
-#: density.cpp:101
-msgctxt "unit description in lists"
-msgid "pounds per cubic yard"
-msgstr "funte po kubičnom yardu"
-
-#: density.cpp:103
-msgctxt "unit synonyms for matching user input"
-msgid "pound per cubic yard;pounds per cubic yard;lb/yd³"
-msgstr "funta po kubičnom yardu;funte po kubičnom yardu;lb/yd³"
-
-#: density.cpp:104
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 pounds per cubic yard"
-msgstr "%1 funti po kubičnom yardu"
-
-#: density.cpp:105
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 pound per cubic yard"
-msgid_plural "%1 pounds per cubic yard"
-msgstr[0] "%1 funta po kubičnom yardu"
-msgstr[1] "%1 funte po kubičnom yardu"
-msgstr[2] "%1 funti po kubičnom yardu"
-
-#: energy.cpp:34
-msgid "Energy"
-msgstr "Energija"
-
-#: energy.cpp:35
-#, kde-format
-msgctxt "%1 value, %2 unit symbol (energy)"
-msgid "%1 %2"
-msgstr "%1 %2"
-
-#: energy.cpp:38
-msgctxt "energy unit symbol"
-msgid "YJ"
-msgstr "YJ"
-
-#: energy.cpp:39
-msgctxt "unit description in lists"
-msgid "yottajoules"
-msgstr "jotadžuli"
-
-#: energy.cpp:40
-msgctxt "unit synonyms for matching user input"
-msgid "yottajoule;yottajoules;YJ"
-msgstr "jotadžul;jotadžuli;YJ"
-
-#: energy.cpp:41
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 yottajoules"
-msgstr "%1 jotadžula"
-
-#: energy.cpp:42
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 yottajoule"
-msgid_plural "%1 yottajoules"
-msgstr[0] "%1 jotadžul"
-msgstr[1] "%1 jotadžula"
-msgstr[2] "%1 jotadžula"
-
-#: energy.cpp:45
-msgctxt "energy unit symbol"
-msgid "ZJ"
-msgstr "ZJ"
-
-#: energy.cpp:46
-msgctxt "unit description in lists"
-msgid "zettajoules"
-msgstr "zetadžuli"
-
-#: energy.cpp:47
-msgctxt "unit synonyms for matching user input"
-msgid "zettajoule;zettajoules;ZJ"
-msgstr "zetadžul;zetadžuli;ZJ"
-
-#: energy.cpp:48
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 zettajoules"
-msgstr "%1 zetadžula"
-
-#: energy.cpp:49
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 zettajoule"
-msgid_plural "%1 zettajoules"
-msgstr[0] "%1 zetadžul"
-msgstr[1] "%1 zetadžula"
-msgstr[2] "%1 zetadžula"
-
-#: energy.cpp:52
-msgctxt "energy unit symbol"
-msgid "EJ"
-msgstr "EJ"
-
-#: energy.cpp:53
-msgctxt "unit description in lists"
-msgid "exajoules"
-msgstr "eksadžuli"
-
-#: energy.cpp:54
-msgctxt "unit synonyms for matching user input"
-msgid "exajoule;exajoules;EJ"
-msgstr "eksadžul;eksadžuli;EJ"
-
-#: energy.cpp:55
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 exajoules"
-msgstr "%1 eksadžula"
-
-#: energy.cpp:56
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 exajoule"
-msgid_plural "%1 exajoules"
-msgstr[0] "%1 eksadžul"
-msgstr[1] "%1 eksadžula"
-msgstr[2] "%1 eksadžula"
-
-#: energy.cpp:59
-msgctxt "energy unit symbol"
-msgid "PJ"
-msgstr "PJ"
-
-#: energy.cpp:60
-msgctxt "unit description in lists"
-msgid "petajoules"
-msgstr "petadžuli"
-
-#: energy.cpp:61
-msgctxt "unit synonyms for matching user input"
-msgid "petajoule;petajoules;PJ"
-msgstr "petadžul;petadžuli;PJ"
-
-#: energy.cpp:62
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 petajoules"
-msgstr "%1 petadžula"
-
-#: energy.cpp:63
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 petajoule"
-msgid_plural "%1 petajoules"
-msgstr[0] "%1 petadžul"
-msgstr[1] "%1 petadžula"
-msgstr[2] "%1 petadžula"
-
-#: energy.cpp:66
-msgctxt "energy unit symbol"
-msgid "TJ"
-msgstr "TJ"
-
-#: energy.cpp:67
-msgctxt "unit description in lists"
-msgid "terajoules"
-msgstr "teradžuli"
-
-#: energy.cpp:68
-msgctxt "unit synonyms for matching user input"
-msgid "terajoule;terajoules;TJ"
-msgstr "teradžul;teradžuli;TJ"
-
-#: energy.cpp:69
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 terajoules"
-msgstr "%1 teradžula"
-
-#: energy.cpp:70
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 terajoule"
-msgid_plural "%1 terajoules"
-msgstr[0] "%1 teradžul"
-msgstr[1] "%1 teradžula"
-msgstr[2] "%1 teradžula"
-
-#: energy.cpp:73
-msgctxt "energy unit symbol"
-msgid "GJ"
-msgstr "GJ"
-
-#: energy.cpp:74
-msgctxt "unit description in lists"
-msgid "gigajoules"
-msgstr "gigadžuli"
-
-#: energy.cpp:75
-msgctxt "unit synonyms for matching user input"
-msgid "gigajoule;gigajoules;GJ"
-msgstr "gigadžul;gigadžuli;GJ"
-
-#: energy.cpp:76
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 gigajoules"
-msgstr "%1 gigadžula"
-
-#: energy.cpp:77
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 gigajoule"
-msgid_plural "%1 gigajoules"
-msgstr[0] "%1 gigadžul"
-msgstr[1] "%1 gigadžula"
-msgstr[2] "%1 gigadžula"
-
-#: energy.cpp:80
-msgctxt "energy unit symbol"
-msgid "MJ"
-msgstr "MJ"
-
-#: energy.cpp:81
-msgctxt "unit description in lists"
-msgid "megajoules"
-msgstr "megadžuli"
-
-#: energy.cpp:82
-msgctxt "unit synonyms for matching user input"
-msgid "megajoule;megajoules;MJ"
-msgstr "megadžul;megadžuli;MJ"
-
-#: energy.cpp:83
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 megajoules"
-msgstr "%1 megadžula"
-
-#: energy.cpp:84
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 megajoule"
-msgid_plural "%1 megajoules"
-msgstr[0] "%1 megadžul"
-msgstr[1] "%1 megadžula"
-msgstr[2] "%1 megadžula"
-
-#: energy.cpp:87
-msgctxt "energy unit symbol"
-msgid "kJ"
-msgstr "kJ"
-
-#: energy.cpp:88
-msgctxt "unit description in lists"
-msgid "kilojoules"
-msgstr "kilodžuli"
-
-#: energy.cpp:89
-msgctxt "unit synonyms for matching user input"
-msgid "kilojoule;kilojoules;kJ"
-msgstr "kilodžul;kilodžuli;kJ"
-
-#: energy.cpp:90
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 kilojoules"
-msgstr "%1 kilodžula"
-
-#: energy.cpp:91
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 kilojoule"
-msgid_plural "%1 kilojoules"
-msgstr[0] "%1 kilodžul"
-msgstr[1] "%1 kilodžula"
-msgstr[2] "%1 kilodžula"
-
-#: energy.cpp:94
-msgctxt "energy unit symbol"
-msgid "hJ"
-msgstr "hJ"
-
-#: energy.cpp:95
-msgctxt "unit description in lists"
-msgid "hectojoules"
-msgstr "hektodžuli"
-
-#: energy.cpp:96
-msgctxt "unit synonyms for matching user input"
-msgid "hectojoule;hectojoules;hJ"
-msgstr "hektodžul;hektodžuli;hJ"
-
-#: energy.cpp:97
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 hectojoules"
-msgstr "%1 hektodžula"
-
-#: energy.cpp:98
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 hectojoule"
-msgid_plural "%1 hectojoules"
-msgstr[0] "%1 hektodžul"
-msgstr[1] "%1 hektodžula"
-msgstr[2] "%1 hektodžula"
-
-#: energy.cpp:101
-msgctxt "energy unit symbol"
-msgid "daJ"
-msgstr "daJ"
-
-#: energy.cpp:102
-msgctxt "unit description in lists"
-msgid "decajoules"
-msgstr "dekadžuli"
-
-#: energy.cpp:103
-msgctxt "unit synonyms for matching user input"
-msgid "decajoule;decajoules;daJ"
-msgstr "dekadžul;dekadžuli;daJ"
-
-#: energy.cpp:104
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 decajoules"
-msgstr "%1 dekadžula"
-
-#: energy.cpp:105
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 decajoule"
-msgid_plural "%1 decajoules"
-msgstr[0] "%1 dekadžul"
-msgstr[1] "%1 dekadžula"
-msgstr[2] "%1 dekadžula"
-
-#: energy.cpp:108
-msgctxt "energy unit symbol"
-msgid "J"
-msgstr "J"
-
-#: energy.cpp:109
-msgctxt "unit description in lists"
-msgid "joules"
-msgstr "džuli"
-
-#: energy.cpp:110
-msgctxt "unit synonyms for matching user input"
-msgid "joule;joules;J"
-msgstr "džul;džuli;J"
-
-#: energy.cpp:111
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 joules"
-msgstr "%1 džula"
-
-#: energy.cpp:112
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 joule"
-msgid_plural "%1 joules"
-msgstr[0] "%1 džul"
-msgstr[1] "%1 džula"
-msgstr[2] "%1 džula"
-
-#: energy.cpp:115
-msgctxt "energy unit symbol"
-msgid "dJ"
-msgstr "dJ"
-
-#: energy.cpp:116
-msgctxt "unit description in lists"
-msgid "decijoules"
-msgstr "decidžuli"
-
-#: energy.cpp:117
-msgctxt "unit synonyms for matching user input"
-msgid "decijoule;decijoules;dJ"
-msgstr "decidžul;decidžuli;dJ"
-
-#: energy.cpp:118
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 decijoules"
-msgstr "%1 decidžula"
-
-#: energy.cpp:119
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 decijoule"
-msgid_plural "%1 decijoules"
-msgstr[0] "%1 decidžul"
-msgstr[1] "%1 decidžula"
-msgstr[2] "%1 decidžula"
-
-#: energy.cpp:122
-msgctxt "energy unit symbol"
-msgid "cJ"
-msgstr "cJ"
-
-#: energy.cpp:123
-msgctxt "unit description in lists"
-msgid "centijoules"
-msgstr "centidžuli"
-
-#: energy.cpp:124
-msgctxt "unit synonyms for matching user input"
-msgid "centijoule;centijoules;cJ"
-msgstr "centidžul;centidžuli;cJ"
-
-#: energy.cpp:125
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 centijoules"
-msgstr "%1 centidžula"
-
-#: energy.cpp:126
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 centijoule"
-msgid_plural "%1 centijoules"
-msgstr[0] "%1 centidžul"
-msgstr[1] "%1 centidžula"
-msgstr[2] "%1 centidžula"
-
-#: energy.cpp:129
-msgctxt "energy unit symbol"
-msgid "mJ"
-msgstr "mJ"
-
-#: energy.cpp:130
-msgctxt "unit description in lists"
-msgid "millijoules"
-msgstr "milidžuli"
-
-#: energy.cpp:131
-msgctxt "unit synonyms for matching user input"
-msgid "millijoule;millijoules;mJ"
-msgstr "milidžul;milidžuli;mJ"
-
-#: energy.cpp:132
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 millijoules"
-msgstr "%1 milidžula"
-
-#: energy.cpp:133
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 millijoule"
-msgid_plural "%1 millijoules"
-msgstr[0] "%1 milidžul"
-msgstr[1] "%1 milidžula"
-msgstr[2] "%1 milidžula"
-
-#: energy.cpp:136
-msgctxt "energy unit symbol"
-msgid "µJ"
-msgstr "µJ"
-
-#: energy.cpp:137
-msgctxt "unit description in lists"
-msgid "microjoules"
-msgstr "mikrodžuli"
-
-#: energy.cpp:138
-msgctxt "unit synonyms for matching user input"
-msgid "microjoule;microjoules;µJ;uJ"
-msgstr "mikrodžul;mikrodžuli;µJ;uJ"
-
-#: energy.cpp:139
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 microjoules"
-msgstr "%1 mikrodžula"
-
-#: energy.cpp:140
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 microjoule"
-msgid_plural "%1 microjoules"
-msgstr[0] "%1 mikrodžul"
-msgstr[1] "%1 mikrodžula"
-msgstr[2] "%1 mikrodžula"
-
-#: energy.cpp:143
-msgctxt "energy unit symbol"
-msgid "nJ"
-msgstr "nJ"
-
-#: energy.cpp:144
-msgctxt "unit description in lists"
-msgid "nanojoules"
-msgstr "nanodžuli"
-
-#: energy.cpp:145
-msgctxt "unit synonyms for matching user input"
-msgid "nanojoule;nanojoules;nJ"
-msgstr "nanodžul;nanodžuli;nJ"
-
-#: energy.cpp:146
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 nanojoules"
-msgstr "%1 nanodžula"
-
-#: energy.cpp:147
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 nanojoule"
-msgid_plural "%1 nanojoules"
-msgstr[0] "%1 nanodžul"
-msgstr[1] "%1 nanodžula"
-msgstr[2] "%1 nanodžula"
-
-#: energy.cpp:150
-msgctxt "energy unit symbol"
-msgid "pJ"
-msgstr "pJ"
-
-#: energy.cpp:151
-msgctxt "unit description in lists"
-msgid "picojoules"
-msgstr "pikodžuli"
-
-#: energy.cpp:152
-msgctxt "unit synonyms for matching user input"
-msgid "picojoule;picojoules;pJ"
-msgstr "pikodžul;pikodžuli;pJ"
-
-#: energy.cpp:153
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 picojoules"
-msgstr "%1 pikodžula"
-
-#: energy.cpp:154
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 picojoule"
-msgid_plural "%1 picojoules"
-msgstr[0] "%1 pikodžul"
-msgstr[1] "%1 pikodžula"
-msgstr[2] "%1 pikodžula"
-
-#: energy.cpp:157
-msgctxt "energy unit symbol"
-msgid "fJ"
-msgstr "fJ"
-
-#: energy.cpp:158
-msgctxt "unit description in lists"
-msgid "femtojoules"
-msgstr "femtodžuli"
-
-#: energy.cpp:159
-msgctxt "unit synonyms for matching user input"
-msgid "femtojoule;femtojoules;fJ"
-msgstr "femtodžul;femtodžuli;fJ"
-
-#: energy.cpp:160
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 femtojoules"
-msgstr "%1 femtodžula"
-
-#: energy.cpp:161
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 femtojoule"
-msgid_plural "%1 femtojoules"
-msgstr[0] "%1 femtodžul"
-msgstr[1] "%1 femtodžula"
-msgstr[2] "%1 femtodžula"
-
-#: energy.cpp:164
-msgctxt "energy unit symbol"
-msgid "aJ"
-msgstr "aJ"
-
-#: energy.cpp:165
-msgctxt "unit description in lists"
-msgid "attojoules"
-msgstr "atodžuli"
-
-#: energy.cpp:166
-msgctxt "unit synonyms for matching user input"
-msgid "attojoule;attojoules;aJ"
-msgstr "atodžul;atodžuli;aJ"
-
-#: energy.cpp:167
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 attojoules"
-msgstr "%1 atodžula"
-
-#: energy.cpp:168
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 attojoule"
-msgid_plural "%1 attojoules"
-msgstr[0] "%1 atodžul"
-msgstr[1] "%1 atodžula"
-msgstr[2] "%1 atodžula"
-
-#: energy.cpp:171
-msgctxt "energy unit symbol"
-msgid "zJ"
-msgstr "zJ"
-
-#: energy.cpp:172
-msgctxt "unit description in lists"
-msgid "zeptojoules"
-msgstr "zeptodžuli"
-
-#: energy.cpp:173
-msgctxt "unit synonyms for matching user input"
-msgid "zeptojoule;zeptojoules;zJ"
-msgstr "zeptodžul;zeptodžuli;zJ"
-
-#: energy.cpp:174
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 zeptojoules"
-msgstr "%1 zeptodžula"
-
-#: energy.cpp:175
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 zeptojoule"
-msgid_plural "%1 zeptojoules"
-msgstr[0] "%1 zeptodžul"
-msgstr[1] "%1 zeptodžula"
-msgstr[2] "%1 zeptodžula"
-
-#: energy.cpp:178
-msgctxt "energy unit symbol"
-msgid "yJ"
-msgstr "yJ"
-
-#: energy.cpp:179
-msgctxt "unit description in lists"
-msgid "yoctojoules"
-msgstr "joktodžuli"
-
-#: energy.cpp:180
-msgctxt "unit synonyms for matching user input"
-msgid "yoctojoule;yoctojoules;yJ"
-msgstr "joktodžul;joktodžuli;yJ"
-
-#: energy.cpp:181
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 yoctojoules"
-msgstr "%1 joktodžula"
-
-#: energy.cpp:182
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 yoctojoule"
-msgid_plural "%1 yoctojoules"
-msgstr[0] "%1 joktodžul"
-msgstr[1] "%1 joktodžula"
-msgstr[2] "%1 joktodžula"
-
-#: energy.cpp:185
-msgctxt "energy unit symbol"
-msgid "GDA"
-msgstr "GDA"
-
-#: energy.cpp:186
-msgctxt "unit description in lists"
-msgid "guideline daily amount"
-msgstr "preporučena dnevna doza"
-
-#: energy.cpp:188
-msgctxt "unit synonyms for matching user input"
-msgid "guideline daily amount;guideline daily amount;GDA"
-msgstr "preporučena dnevna doza;preporučena dnevna doza;GDA"
-
-#: energy.cpp:189
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 guideline daily amount"
-msgstr "%1 preporučenih dnevnih doza"
-
-#: energy.cpp:190
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 guideline daily amount"
-msgid_plural "%1 guideline daily amount"
-msgstr[0] "%1 preporučena dnevna doza"
-msgstr[1] "%1 preporučene dnevne doze"
-msgstr[2] "%1 preporučenih dnevnih doza"
-
-#: energy.cpp:193
-msgctxt "energy unit symbol"
-msgid "eV"
-msgstr "eV"
-
-#: energy.cpp:194
-msgctxt "unit description in lists"
-msgid "electronvolts"
-msgstr "elektronvolti"
-
-#: energy.cpp:195
-msgctxt "unit synonyms for matching user input"
-msgid "electronvolt;electronvolts;eV"
-msgstr "elektronvolt;elektronvolti;eV"
-
-#: energy.cpp:196
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 electronvolts"
-msgstr "%1 elektronvolta"
-
-#: energy.cpp:197
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 electronvolt"
-msgid_plural "%1 electronvolts"
-msgstr[0] "%1 elektronvolt"
-msgstr[1] "%1 elektronvolta"
-msgstr[2] "%1 elektronvolta"
-
-#: energy.cpp:200
-msgctxt "energy unit symbol"
-msgid "J/mol"
-msgstr "J/mol"
-
-#: energy.cpp:201
-msgctxt "unit description in lists"
-msgid "joule per mole"
-msgstr "džul po molu"
-
-#: energy.cpp:202
-msgctxt "unit synonyms for matching user input"
-msgid "joule per mole;joulepermole;joulemol;jmol;j/mol"
-msgstr "džul po molu;džula po molu;džulpomolu;džulmol;jmol;j/mol"
-
-#: energy.cpp:203
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 joules per mole"
-msgstr "%1 džula po molu"
-
-#: energy.cpp:204
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 joule per mole"
-msgid_plural "%1 joules per mole"
-msgstr[0] "%1 džul po molu"
-msgstr[1] "%1 džula po molu"
-msgstr[2] "%1 džula po molu"
-
-#: energy.cpp:207
-msgctxt "energy unit symbol"
-msgid "kJ/mol"
-msgstr "kJ/mol"
-
-#: energy.cpp:208
-msgctxt "unit description in lists"
-msgid "kilojoule per mole"
-msgstr "kilodžul po molu"
-
-#: energy.cpp:209
-msgctxt "unit synonyms for matching user input"
-msgid ""
-"kilojoule per mole;kilojoulepermole;kilojoule per mole;kilojoulemol;kjmol;kj/"
-"mol"
-msgstr ""
-"kilodžul po molu;kilodžula po molu;kilodžulpomolu;kilodžulmol;kjmol;kj/mol"
-
-#: energy.cpp:210
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 kilojoules per mole"
-msgstr "%1 kilodžula po molu"
-
-#: energy.cpp:211
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 kilojoule per mole"
-msgid_plural "%1 kilojoules per mole"
-msgstr[0] "%1 kilodžul po molu"
-msgstr[1] "%1 kilodžula po molu"
-msgstr[2] "%1 kilodžula po molu"
-
-#: energy.cpp:214
-msgctxt "energy unit symbol"
-msgid "Ry"
-msgstr "Ry"
-
-#: energy.cpp:215
-msgctxt "unit description in lists"
-msgid "rydbergs"
-msgstr "rydberzi"
-
-#: energy.cpp:216
-msgctxt "unit synonyms for matching user input"
-msgid "rydberg;rydbergs;Ry"
-msgstr "rydberg;rydberzi;Ry"
-
-#: energy.cpp:217
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 rydbergs"
-msgstr "%1 rydberga"
-
-#: energy.cpp:218
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 rydberg"
-msgid_plural "%1 rydbergs"
-msgstr[0] "%1 rydberg"
-msgstr[1] "%1 rydberga"
-msgstr[2] "%1 rydberga"
-
-#: energy.cpp:221
-msgctxt "energy unit symbol"
-msgid "kcal"
-msgstr "kcal"
-
-#: energy.cpp:222
-msgctxt "unit description in lists"
-msgid "kilocalories"
-msgstr "kilokalorije"
-
-#: energy.cpp:223
-msgctxt "unit synonyms for matching user input"
-msgid "kilocalorie;kilocalories;kcal"
-msgstr "kilokalorija;kilokalorije;kcal"
-
-#: energy.cpp:224
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 kilocalories"
-msgstr "%1 kilokalorija"
-
-#: energy.cpp:225
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 kilocalorie"
-msgid_plural "%1 kilocalories"
-msgstr[0] "%1 kilokalorija"
-msgstr[1] "%1 kilokalorije"
-msgstr[2] "%1 kilokalorija"
-
-#: energy.cpp:228
-msgctxt "energy unit symbol"
-msgid "nm"
-msgstr "nm"
-
-#: energy.cpp:229
-msgctxt "unit description in lists"
-msgid "photon wavelength in nanometers"
-msgstr "valna duljina fotona u nanometrima"
-
-#: energy.cpp:230
-msgctxt "unit synonyms for matching user input"
-msgid "nm;photon wavelength"
-msgstr "nm;valna duljina fotona"
-
-#: energy.cpp:231 length.cpp:140
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 nanometers"
-msgstr "%1 nanometara"
-
-#: energy.cpp:232 length.cpp:141
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 nanometer"
-msgid_plural "%1 nanometers"
-msgstr[0] "%1 nanometar"
-msgstr[1] "%1 nanometra"
-msgstr[2] "%1 nanometara"
-
-#: force.cpp:28
-msgid "Force"
-msgstr "Sila"
-
-#: force.cpp:29
-#, kde-format
-msgctxt "%1 value, %2 unit symbol (force"
-msgid "%1 %2"
-msgstr "%1 %2"
-
-#: force.cpp:32
-msgctxt "force unit symbol"
-msgid "YN"
-msgstr "YN"
-
-#: force.cpp:33
-msgctxt "unit description in lists"
-msgid "yottanewtons"
-msgstr "jotanjutni"
-
-#: force.cpp:34
-msgctxt "unit synonyms for matching user input"
-msgid "yottanewton;yottanewtons;YN"
-msgstr "jotanjutn;jotanjutni;YN"
-
-#: force.cpp:35
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 yottanewtons"
-msgstr "%1 jotanjutna"
-
-#: force.cpp:36
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 yottanewton"
-msgid_plural "%1 yottanewtons"
-msgstr[0] "%1 jotanjutn"
-msgstr[1] "%1 jotanjutna"
-msgstr[2] "%1 jotanjutna"
-
-#: force.cpp:39
-msgctxt "force unit symbol"
-msgid "ZN"
-msgstr "ZN"
-
-#: force.cpp:40
-msgctxt "unit description in lists"
-msgid "zettanewtons"
-msgstr "zetanjutni"
-
-#: force.cpp:41
-msgctxt "unit synonyms for matching user input"
-msgid "zettanewton;zettanewtons;ZN"
-msgstr "zetanjutn;zetanjutni;zetanjutna;ZN"
-
-#: force.cpp:42
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 zettanewtons"
-msgstr "%1 zetanjutna"
-
-#: force.cpp:43
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 zettanewton"
-msgid_plural "%1 zettanewtons"
-msgstr[0] "%1 zetanjutn"
-msgstr[1] "%1 zetanjutna"
-msgstr[2] "%1 zetanjutna"
-
-#: force.cpp:46
-msgctxt "force unit symbol"
-msgid "EN"
-msgstr "EN"
-
-#: force.cpp:47
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "mexican pesos"
-msgctxt "unit description in lists"
-msgid "exanewtons"
-msgstr "meksički pesosi"
-
-#: force.cpp:48
-msgctxt "unit synonyms for matching user input"
-msgid "exanewton;exanewtons;EN"
-msgstr ""
-
-#: force.cpp:49
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 wons"
-msgctxt "amount in units (real)"
-msgid "%1 exanewtons"
-msgstr "%1 wona"
-
-#: force.cpp:50
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 won"
-#| msgid_plural "%1 wons"
-msgctxt "amount in units (integer)"
-msgid "%1 exanewton"
-msgid_plural "%1 exanewtons"
-msgstr[0] "%1 won"
-msgstr[1] "%1 wona"
-msgstr[2] "%1 wona"
-
-#: force.cpp:53
-msgctxt "force unit symbol"
-msgid "PN"
-msgstr "PN"
-
-#: force.cpp:54
-msgctxt "unit description in lists"
-msgid "petanewtons"
-msgstr "petanjutni"
-
-#: force.cpp:55
-msgctxt "unit synonyms for matching user input"
-msgid "petanewton;petanewtons;PN"
-msgstr "petanjutn;petanjutna;PN"
-
-#: force.cpp:56
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 petanewtons"
-msgstr "%1 petanjutna"
-
-#: force.cpp:57
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 petanewton"
-msgid_plural "%1 petanewtons"
-msgstr[0] "%1 petanjutn"
-msgstr[1] "%1 petanjutna"
-msgstr[2] "%1 petanjutna"
-
-#: force.cpp:60
-msgctxt "force unit symbol"
-msgid "TN"
-msgstr "TN"
-
-#: force.cpp:61
-msgctxt "unit description in lists"
-msgid "teranewtons"
-msgstr "teranjutni"
-
-#: force.cpp:62
-msgctxt "unit synonyms for matching user input"
-msgid "teranewton;teranewtons;TN"
-msgstr "teranjutn;teranjutna;TN"
-
-#: force.cpp:63
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 teranewtons"
-msgstr "%1 teranjutna"
-
-#: force.cpp:64
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 teranewton"
-msgid_plural "%1 teranewtons"
-msgstr[0] "%1 teranjutn"
-msgstr[1] "%1 teranjutna"
-msgstr[2] "%1 teranjutna"
-
-#: force.cpp:67
-msgctxt "force unit symbol"
-msgid "GN"
-msgstr "GN"
-
-#: force.cpp:68
-msgctxt "unit description in lists"
-msgid "giganewtons"
-msgstr "giganjutni"
-
-#: force.cpp:69
-msgctxt "unit synonyms for matching user input"
-msgid "giganewton;giganewtons;GN"
-msgstr "giganjutn;giganjutna;GN"
-
-#: force.cpp:70
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 giganewtons"
-msgstr "%1 giganjutna"
-
-#: force.cpp:71
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 giganewton"
-msgid_plural "%1 giganewtons"
-msgstr[0] "%1 giganjutn"
-msgstr[1] "%1 giganjutna"
-msgstr[2] "%1 giganjutna"
-
-#: force.cpp:74
-msgctxt "force unit symbol"
-msgid "MN"
-msgstr "MN"
-
-#: force.cpp:75
-msgctxt "unit description in lists"
-msgid "meganewtons"
-msgstr "meganjutni"
-
-#: force.cpp:76
-msgctxt "unit synonyms for matching user input"
-msgid "meganewton;meganewtons;MN"
-msgstr "meganjutn;meganjutna;MN"
-
-#: force.cpp:77
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 meganewtons"
-msgstr "%1 meganjutna"
-
-#: force.cpp:78
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 meganewton"
-msgid_plural "%1 meganewtons"
-msgstr[0] "%1 meganjutn"
-msgstr[1] "%1 meganjutna"
-msgstr[2] "%1 meganjutna"
-
-#: force.cpp:81
-msgctxt "force unit symbol"
-msgid "kN"
-msgstr "kN"
-
-#: force.cpp:82
-msgctxt "unit description in lists"
-msgid "kilonewtons"
-msgstr "kilonjutni"
-
-#: force.cpp:83
-msgctxt "unit synonyms for matching user input"
-msgid "kilonewton;kilonewtons;kN"
-msgstr "kilonjutn;kilonjutna;kN"
-
-#: force.cpp:84
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 kilonewtons"
-msgstr "%1 kilonjutna"
-
-#: force.cpp:85 mass.cpp:230
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 kilonewton"
-msgid_plural "%1 kilonewtons"
-msgstr[0] "%1 kilonjutn"
-msgstr[1] "%1 kilonjutna"
-msgstr[2] "%1 kilonjutna"
-
-#: force.cpp:88
-msgctxt "force unit symbol"
-msgid "hN"
-msgstr "hN"
-
-#: force.cpp:89
-msgctxt "unit description in lists"
-msgid "hectonewtons"
-msgstr "hektanjutna"
-
-#: force.cpp:90
-msgctxt "unit synonyms for matching user input"
-msgid "hectonewton;hectonewtons;hN"
-msgstr "hektanjutn;hektanjutna;hN"
-
-#: force.cpp:91
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 hectonewtons"
-msgstr "%1 hektanjutna"
-
-#: force.cpp:92
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 hectonewton"
-msgid_plural "%1 hectonewtons"
-msgstr[0] "%1 hektanjutn"
-msgstr[1] "%1 hektanjutna"
-msgstr[2] "%1 hektanjutna"
-
-#: force.cpp:95
-msgctxt "force unit symbol"
-msgid "daN"
-msgstr "daN"
-
-#: force.cpp:96
-msgctxt "unit description in lists"
-msgid "decanewtons"
-msgstr "dekanjutni"
-
-#: force.cpp:97
-msgctxt "unit synonyms for matching user input"
-msgid "decanewton;decanewtons;daN"
-msgstr "dekanjutn;dekanjutna;daN"
-
-#: force.cpp:98
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 decanewtons"
-msgstr "%1 dekanjutna"
-
-#: force.cpp:99
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 decanewton"
-msgid_plural "%1 decanewtons"
-msgstr[0] "%1 dekanjutn"
-msgstr[1] "%1 dekanjutna"
-msgstr[2] "%1 dekanjutna"
-
-#: force.cpp:102
-msgctxt "force unit symbol"
-msgid "N"
-msgstr "N"
-
-#: force.cpp:103 mass.cpp:219
-msgctxt "unit description in lists"
-msgid "newtons"
-msgstr "njutni"
-
-#: force.cpp:104 mass.cpp:220
-msgctxt "unit synonyms for matching user input"
-msgid "newton;newtons;N"
-msgstr "njutn;njutna;N"
-
-#: force.cpp:105 mass.cpp:221
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 newtons"
-msgstr "%1 njutna"
-
-#: force.cpp:106 mass.cpp:222
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 newton"
-msgid_plural "%1 newtons"
-msgstr[0] "%1 njutn"
-msgstr[1] "%1 njutna"
-msgstr[2] "%1 njutni"
-
-#: force.cpp:109
-msgctxt "force unit symbol"
-msgid "dN"
-msgstr "dN"
-
-#: force.cpp:110
-msgctxt "unit description in lists"
-msgid "decinewtons"
-msgstr "decinjutn"
-
-#: force.cpp:111
-msgctxt "unit synonyms for matching user input"
-msgid "decinewton;decinewtons;dN"
-msgstr "decinjutn;decinjutna;dN"
-
-#: force.cpp:112
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 decinewtons"
-msgstr "%1 decinjutna"
-
-#: force.cpp:113
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 decinewton"
-msgid_plural "%1 decinewtons"
-msgstr[0] "%1 decinjutn"
-msgstr[1] "%1 decinjutna"
-msgstr[2] "%1 decinjutna"
-
-#: force.cpp:116
-msgctxt "force unit symbol"
-msgid "cN"
-msgstr "cN"
-
-#: force.cpp:117
-msgctxt "unit description in lists"
-msgid "centinewtons"
-msgstr "centinjutni"
-
-#: force.cpp:118
-msgctxt "unit synonyms for matching user input"
-msgid "centinewton;centinewtons;cN"
-msgstr "centinjutn;centinjutna;cN"
-
-#: force.cpp:119
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 centinewtons"
-msgstr "%1 centinjutna"
-
-#: force.cpp:120
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 centinewton"
-msgid_plural "%1 centinewtons"
-msgstr[0] "%1 centinjutn"
-msgstr[1] "%1 centinjutna"
-msgstr[2] "%1 centinjutna"
-
-#: force.cpp:123
-msgctxt "force unit symbol"
-msgid "mN"
-msgstr "mN"
-
-#: force.cpp:124
-msgctxt "unit description in lists"
-msgid "millinewtons"
-msgstr "milinjutni"
-
-#: force.cpp:125
-msgctxt "unit synonyms for matching user input"
-msgid "millinewton;millinewtons;mN"
-msgstr "milinjutn;milinjutni;milinjutna;mN"
-
-#: force.cpp:126
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 millinewtons"
-msgstr "%1 milinjutna"
-
-#: force.cpp:127
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 millinewton"
-msgid_plural "%1 millinewtons"
-msgstr[0] "%1 milinjutn"
-msgstr[1] "%1 milinjutna"
-msgstr[2] "%1 milinjutna"
-
-#: force.cpp:130
-msgctxt "force unit symbol"
-msgid "µN"
-msgstr "µN"
-
-#: force.cpp:131
-msgctxt "unit description in lists"
-msgid "micronewtons"
-msgstr "mikronjutni"
-
-#: force.cpp:132
-msgctxt "unit synonyms for matching user input"
-msgid "micronewton;micronewtons;µm;uN"
-msgstr "mikronjutn;mikronjutni;mikronjutna;µm;uN"
-
-#: force.cpp:133
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 micronewtons"
-msgstr "%1 mikronjutna"
-
-#: force.cpp:134
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 micronewton"
-msgid_plural "%1 micronewtons"
-msgstr[0] "%1 mikronjutn"
-msgstr[1] "%1 mikronjutna"
-msgstr[2] "%1 mikronjutna"
-
-#: force.cpp:137
-msgctxt "force unit symbol"
-msgid "nN"
-msgstr "nN"
-
-#: force.cpp:138
-msgctxt "unit description in lists"
-msgid "nanonewtons"
-msgstr "nanonjutni"
-
-#: force.cpp:139
-msgctxt "unit synonyms for matching user input"
-msgid "nanonewton;nanonewtons;nN"
-msgstr "nanonjutn;nanonjutni;nanonjutna;nN"
-
-#: force.cpp:140
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 nanonewtons"
-msgstr "%1 nanonjutna"
-
-#: force.cpp:141
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 nanonewton"
-msgid_plural "%1 nanonewtons"
-msgstr[0] "%1 nanonjutn"
-msgstr[1] "%1 nanonjutna"
-msgstr[2] "%1 nanonjutna"
-
-#: force.cpp:144
-msgctxt "force unit symbol"
-msgid "pN"
-msgstr "pN"
-
-#: force.cpp:145
-msgctxt "unit description in lists"
-msgid "piconewtons"
-msgstr "pikonjutni"
-
-#: force.cpp:146
-msgctxt "unit synonyms for matching user input"
-msgid "piconewton;piconewtons;pN"
-msgstr "pikonjutn;pikonjutni;pikonjutna;pN"
-
-#: force.cpp:147
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 piconewtons"
-msgstr "%1 pikonjutna"
-
-#: force.cpp:148
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 piconewton"
-msgid_plural "%1 piconewtons"
-msgstr[0] "%1 pikonjutn"
-msgstr[1] "%1 pikonjutna"
-msgstr[2] "%1 pikonjutna"
-
-#: force.cpp:151
-msgctxt "force unit symbol"
-msgid "fN"
-msgstr "fN"
-
-#: force.cpp:152
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "femtojoules"
-msgctxt "unit description in lists"
-msgid "femtonewtons"
-msgstr "femtodžuli"
-
-#: force.cpp:153
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "femtojoule;femtojoules;fJ"
-msgctxt "unit synonyms for matching user input"
-msgid "femtonewton;femtonewtons;fN"
-msgstr "femtodžul;femtodžuli;fJ"
-
-#: force.cpp:154
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 femtojoules"
-msgctxt "amount in units (real)"
-msgid "%1 femtonewtons"
-msgstr "%1 femtodžula"
-
-#: force.cpp:155
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 femtojoule"
-#| msgid_plural "%1 femtojoules"
-msgctxt "amount in units (integer)"
-msgid "%1 femtonewton"
-msgid_plural "%1 femtonewtons"
-msgstr[0] "%1 femtodžul"
-msgstr[1] "%1 femtodžula"
-msgstr[2] "%1 femtodžula"
-
-#: force.cpp:158
-msgctxt "force unit symbol"
-msgid "aN"
-msgstr "aN"
-
-#: force.cpp:159
-msgctxt "unit description in lists"
-msgid "attonewtons"
-msgstr ""
-
-#: force.cpp:160
-msgctxt "unit synonyms for matching user input"
-msgid "attonewton;attonewtons;aN"
-msgstr ""
-
-#: force.cpp:161
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 attojoules"
-msgctxt "amount in units (real)"
-msgid "%1 attonewtons"
-msgstr "%1 atodžula"
-
-#: force.cpp:162
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 attojoule"
-#| msgid_plural "%1 attojoules"
-msgctxt "amount in units (integer)"
-msgid "%1 attonewton"
-msgid_plural "%1 attonewtons"
-msgstr[0] "%1 atodžul"
-msgstr[1] "%1 atodžula"
-msgstr[2] "%1 atodžula"
-
-#: force.cpp:165
-msgctxt "force unit symbol"
-msgid "zN"
-msgstr "zN"
-
-#: force.cpp:166
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "zeptojoules"
-msgctxt "unit description in lists"
-msgid "zeptonewtons"
-msgstr "zeptodžuli"
-
-#: force.cpp:167
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "zeptojoule;zeptojoules;zJ"
-msgctxt "unit synonyms for matching user input"
-msgid "zeptonewton;zeptonewtons;zN"
-msgstr "zeptodžul;zeptodžuli;zJ"
-
-#: force.cpp:168
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 zeptojoules"
-msgctxt "amount in units (real)"
-msgid "%1 zeptonewtons"
-msgstr "%1 zeptodžula"
-
-#: force.cpp:169
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 zeptojoule"
-#| msgid_plural "%1 zeptojoules"
-msgctxt "amount in units (integer)"
-msgid "%1 zeptonewton"
-msgid_plural "%1 zeptonewtons"
-msgstr[0] "%1 zeptodžul"
-msgstr[1] "%1 zeptodžula"
-msgstr[2] "%1 zeptodžula"
-
-#: force.cpp:172
-msgctxt "force unit symbol"
-msgid "yN"
-msgstr "yN"
-
-#: force.cpp:173
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "yoctojoules"
-msgctxt "unit description in lists"
-msgid "yoctonewtons"
-msgstr "joktodžuli"
-
-#: force.cpp:174
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "yoctojoule;yoctojoules;yJ"
-msgctxt "unit synonyms for matching user input"
-msgid "yoctonewton;yoctonewtons;yN"
-msgstr "joktodžul;joktodžuli;yJ"
-
-#: force.cpp:175
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 yoctojoules"
-msgctxt "amount in units (real)"
-msgid "%1 yoctonewtons"
-msgstr "%1 joktodžula"
-
-#: force.cpp:176
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 yoctojoule"
-#| msgid_plural "%1 yoctojoules"
-msgctxt "amount in units (integer)"
-msgid "%1 yoctonewton"
-msgid_plural "%1 yoctonewtons"
-msgstr[0] "%1 joktodžul"
-msgstr[1] "%1 joktodžula"
-msgstr[2] "%1 joktodžula"
-
-#: force.cpp:181
-msgctxt "force unit symbol"
-msgid "dyn"
-msgstr "dyn"
-
-#: force.cpp:182
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "days"
-msgctxt "unit description in lists"
-msgid "dynes"
-msgstr "dani"
-
-#: force.cpp:183
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "year;years;y"
-msgctxt "unit synonyms for matching user input"
-msgid "dyne;dynes;dyn"
-msgstr "godina;godine;g"
-
-#: force.cpp:184
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 days"
-msgctxt "amount in units (real)"
-msgid "%1 dynes"
-msgstr "%1 dana"
-
-#: force.cpp:185
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 yen"
-#| msgid_plural "%1 yens"
-msgctxt "amount in units (integer)"
-msgid "%1 dyne"
-msgid_plural "%1 dynes"
-msgstr[0] "%1 jen"
-msgstr[1] "%1 jena"
-msgstr[2] "%1 jena"
-
-#: force.cpp:188
-#, fuzzy
-#| msgctxt "fuelefficiency unit symbol"
-#| msgid "kmpl"
-msgctxt "force unit symbol"
-msgid "kp"
-msgstr "kmpl"
-
-#: force.cpp:189
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "kroons"
-msgctxt "unit description in lists"
-msgid "kiloponds"
-msgstr "estonske krune"
-
-#: force.cpp:190
-msgctxt "unit synonyms for matching user input"
-msgid "kilogram-force;kilopond;kiloponds;kp"
-msgstr ""
-
-#: force.cpp:191
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 kroons"
-msgctxt "amount in units (real)"
-msgid "%1 kiloponds"
-msgstr "%1 estonskih kruna"
-
-#: force.cpp:192
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 kroon"
-#| msgid_plural "%1 kroons"
-msgctxt "amount in units (integer)"
-msgid "%1 kilopond"
-msgid_plural "%1 kiloponds"
-msgstr[0] "%1 estonska kruna"
-msgstr[1] "%1 estonske krune"
-msgstr[2] "%1 estonskih kruna"
-
-#: force.cpp:195
-msgctxt "force unit symbol"
-msgid "lbf"
-msgstr "lbf"
-
-#: force.cpp:196
-msgctxt "unit description in lists"
-msgid "pound-force"
-msgstr ""
-
-#: force.cpp:197
-msgctxt "unit synonyms for matching user input"
-msgid "pound-force;lbf"
-msgstr ""
-
-#: force.cpp:198
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 kroon"
-#| msgid_plural "%1 kroons"
-msgctxt "amount in units (real)"
-msgid "%1 pound-force"
-msgstr "%1 estonska kruna"
-
-#: force.cpp:199
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 kroon"
-#| msgid_plural "%1 kroons"
-msgctxt "amount in units (integer)"
-msgid "%1 pound-force"
-msgid_plural "%1 pound-force"
-msgstr[0] "%1 estonska kruna"
-msgstr[1] "%1 estonska kruna"
-msgstr[2] "%1 estonska kruna"
-
-#: force.cpp:202
-msgctxt "force unit symbol"
-msgid "pdl"
-msgstr "pdl"
-
-#: force.cpp:203
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "kunas"
-msgctxt "unit description in lists"
-msgid "poundals"
-msgstr "kuna"
-
-#: force.cpp:204
-msgctxt "unit synonyms for matching user input"
-msgid "poundal;poundals;pdl"
-msgstr ""
-
-#: force.cpp:205
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 kunas"
-msgctxt "amount in units (real)"
-msgid "%1 poundals"
-msgstr "%1 kuna"
-
-#: force.cpp:206
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 kuna"
-#| msgid_plural "%1 kunas"
-msgctxt "amount in units (integer)"
-msgid "%1 poundal"
-msgid_plural "%1 poundals"
-msgstr[0] "%1 kuna"
-msgstr[1] "%1 kune"
-msgstr[2] "%1 kuna"
-
-#: frequency.cpp:28
-msgid "Frequency"
-msgstr "Frekvencija"
-
-#: frequency.cpp:29
-#, kde-format
-msgctxt "%1 value, %2 unit symbol (frequency"
-msgid "%1 %2"
-msgstr "%1 %2"
-
-#: frequency.cpp:32
-msgctxt "frequency unit symbol"
-msgid "YHz"
-msgstr "YHz"
-
-#: frequency.cpp:33
-msgctxt "unit description in lists"
-msgid "yottahertzs"
-msgstr "jotahertzi"
-
-#: frequency.cpp:34
-msgctxt "unit synonyms for matching user input"
-msgid "yottahertz;yottahertzs;YHz"
-msgstr "jotahertz;jotahertzi;jotahertza;YHz"
-
-#: frequency.cpp:35
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 yottahertzs"
-msgstr "%1 jotahertza"
-
-#: frequency.cpp:36
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 yottahertz"
-msgid_plural "%1 yottahertzs"
-msgstr[0] "%1 jotahertz"
-msgstr[1] "%1 jotahertza"
-msgstr[2] "%1 jotahertza"
-
-#: frequency.cpp:39
-msgctxt "frequency unit symbol"
-msgid "ZHz"
-msgstr "ZHz"
-
-#: frequency.cpp:40
-msgctxt "unit description in lists"
-msgid "zettahertzs"
-msgstr "zetahertzi"
-
-#: frequency.cpp:41
-msgctxt "unit synonyms for matching user input"
-msgid "zettahertz;zettahertzs;ZHz"
-msgstr "zetahertz;zetahertzi;zetahertza;ZHz"
-
-#: frequency.cpp:42
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 zettahertzs"
-msgstr "%1 zetahertza"
-
-#: frequency.cpp:43
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 zettahertz"
-msgid_plural "%1 zettahertzs"
-msgstr[0] "%1 zetahertz"
-msgstr[1] "%1 zetahertza"
-msgstr[2] "%1 zetahertza"
-
-#: frequency.cpp:46
-msgctxt "frequency unit symbol"
-msgid "EHz"
-msgstr "EHz"
-
-#: frequency.cpp:47
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "exaliters"
-msgctxt "unit description in lists"
-msgid "exahertzs"
-msgstr "eksalitre"
-
-#: frequency.cpp:48
-msgctxt "unit synonyms for matching user input"
-msgid "exahertz;exahertzs;EHz"
-msgstr "eksahertz;eksahertzi;;eksahertza;EHz"
-
-#: frequency.cpp:49
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 exaliters"
-msgctxt "amount in units (real)"
-msgid "%1 exahertzs"
-msgstr "%1 eksalitara"
-
-#: frequency.cpp:50
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 exaliters"
-msgctxt "amount in units (integer)"
-msgid "%1 exahertz"
-msgid_plural "%1 exahertzs"
-msgstr[0] "%1 eksalitara"
-msgstr[1] "%1 eksalitara"
-msgstr[2] "%1 eksalitara"
-
-#: frequency.cpp:53
-msgctxt "frequency unit symbol"
-msgid "PHz"
-msgstr "PHz"
-
-#: frequency.cpp:54
-msgctxt "unit description in lists"
-msgid "petahertzs"
-msgstr "petahertz"
-
-#: frequency.cpp:55
-msgctxt "unit synonyms for matching user input"
-msgid "petahertz;petahertzs;PHz"
-msgstr "petahertz;petahertzi;petahertza;PHz"
-
-#: frequency.cpp:56
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 petahertzs"
-msgstr "%1 petahertza"
-
-#: frequency.cpp:57
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 petahertz"
-msgid_plural "%1 petahertzs"
-msgstr[0] "%1 petahertz"
-msgstr[1] "%1 petahertza"
-msgstr[2] "%1 petahertza"
-
-#: frequency.cpp:60
-msgctxt "frequency unit symbol"
-msgid "THz"
-msgstr "THz"
-
-#: frequency.cpp:61
-msgctxt "unit description in lists"
-msgid "terahertzs"
-msgstr "terahertzi"
-
-#: frequency.cpp:62
-msgctxt "unit synonyms for matching user input"
-msgid "terahertz;terahertzs;THz"
-msgstr "terahertz;terahertzi;terahertza;THz"
-
-#: frequency.cpp:63
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 terahertzs"
-msgstr "%1 terahertza"
-
-#: frequency.cpp:64
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 terahertz"
-msgid_plural "%1 terahertzs"
-msgstr[0] "%1 terahertz"
-msgstr[1] "%1 terahertza"
-msgstr[2] "%1 terahertza"
-
-#: frequency.cpp:67
-msgctxt "frequency unit symbol"
-msgid "GHz"
-msgstr "GHz"
-
-#: frequency.cpp:68
-msgctxt "unit description in lists"
-msgid "gigahertzs"
-msgstr "gigahertzi"
-
-#: frequency.cpp:69
-msgctxt "unit synonyms for matching user input"
-msgid "gigahertz;gigahertzs;GHz"
-msgstr "gigahertz;gigahertzi;gigahertza;GHz"
-
-#: frequency.cpp:70
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 gigahertzs"
-msgstr "%1 gigahertza"
-
-#: frequency.cpp:71
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 gigahertz"
-msgid_plural "%1 gigahertzs"
-msgstr[0] "%1 gigahertz"
-msgstr[1] "%1 gigahertza"
-msgstr[2] "%1 gigahertza"
-
-#: frequency.cpp:74
-msgctxt "frequency unit symbol"
-msgid "MHz"
-msgstr "MHz"
-
-#: frequency.cpp:75
-msgctxt "unit description in lists"
-msgid "megahertzs"
-msgstr "megahertzi"
-
-#: frequency.cpp:76
-msgctxt "unit synonyms for matching user input"
-msgid "megahertz;megahertzs;MHz"
-msgstr "megahertz;megahertzi;megahertza;MHz"
-
-#: frequency.cpp:77
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 megahertzs"
-msgstr "%1 megaheritza"
-
-#: frequency.cpp:78
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 megahertz"
-msgid_plural "%1 megahertzs"
-msgstr[0] "%1 megahertz"
-msgstr[1] "%1 megahertza"
-msgstr[2] "%1 megahertza"
-
-#: frequency.cpp:81
-msgctxt "frequency unit symbol"
-msgid "kHz"
-msgstr "kHz"
-
-#: frequency.cpp:82
-msgctxt "unit description in lists"
-msgid "kilohertzs"
-msgstr "kilohertzi"
-
-#: frequency.cpp:83
-msgctxt "unit synonyms for matching user input"
-msgid "kilohertz;kilohertzs;kHz"
-msgstr "kilohertz;kilohertzi;kilohertza;kHz"
-
-#: frequency.cpp:84
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 kilohertzs"
-msgstr "%1 kilohertza"
-
-#: frequency.cpp:85
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 kilohertz"
-msgid_plural "%1 kilohertzs"
-msgstr[0] "%1 kilohertz"
-msgstr[1] "%1 kilohertza"
-msgstr[2] "%1 kilohertza"
-
-#: frequency.cpp:88
-msgctxt "frequency unit symbol"
-msgid "hHz"
-msgstr "hHz"
-
-#: frequency.cpp:89
-msgctxt "unit description in lists"
-msgid "hectohertzs"
-msgstr "hektohertzi"
-
-#: frequency.cpp:90
-msgctxt "unit synonyms for matching user input"
-msgid "hectohertz;hectohertzs;hHz"
-msgstr "hektohertz;hektohertzi;hektohertza;hHz"
-
-#: frequency.cpp:91
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 hectohertzs"
-msgstr "%1 hektohertza"
-
-#: frequency.cpp:92
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 hectohertz"
-msgid_plural "%1 hectohertzs"
-msgstr[0] "%1 hektohertz"
-msgstr[1] "%1 hektohertza"
-msgstr[2] "%1 hektohertza"
-
-#: frequency.cpp:95
-msgctxt "frequency unit symbol"
-msgid "daHz"
-msgstr "daHz"
-
-#: frequency.cpp:96
-msgctxt "unit description in lists"
-msgid "decahertzs"
-msgstr "dekahertzi"
-
-#: frequency.cpp:97
-msgctxt "unit synonyms for matching user input"
-msgid "decahertz;decahertzs;daHz"
-msgstr "dekahertz;dekaherzi;dekahertza;daHz"
-
-#: frequency.cpp:98
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 decahertzs"
-msgstr "%1 dekahertza"
-
-#: frequency.cpp:99
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 decahertz"
-msgid_plural "%1 decahertzs"
-msgstr[0] "%1 dekahertz"
-msgstr[1] "%1 dekahertza"
-msgstr[2] "%1 dekahertza"
-
-#: frequency.cpp:102
-msgctxt "frequency unit symbol"
-msgid "Hz"
-msgstr "Hz"
-
-#: frequency.cpp:103
-msgctxt "unit description in lists"
-msgid "hertzs"
-msgstr "hertzi"
-
-#: frequency.cpp:104
-msgctxt "unit synonyms for matching user input"
-msgid "hertz;hertzs;Hz"
-msgstr "hertz;hertzi;hertza;Hz"
-
-#: frequency.cpp:105
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 hertzs"
-msgstr "%1 hertza"
-
-#: frequency.cpp:106
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 hertz"
-msgid_plural "%1 hertzs"
-msgstr[0] "%1 hertz"
-msgstr[1] "%1 hertza"
-msgstr[2] "%1 hertza"
-
-#: frequency.cpp:109
-msgctxt "frequency unit symbol"
-msgid "dHz"
-msgstr "dHz"
-
-#: frequency.cpp:110
-msgctxt "unit description in lists"
-msgid "decihertzs"
-msgstr "decihertz"
-
-#: frequency.cpp:111
-msgctxt "unit synonyms for matching user input"
-msgid "decihertz;decihertzs;dHz"
-msgstr "decihertz;decihertzi;decihertza;dHz"
-
-#: frequency.cpp:112
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 decihertzs"
-msgstr "%1 decihertza"
-
-#: frequency.cpp:113
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 decihertz"
-msgid_plural "%1 decihertzs"
-msgstr[0] "%1 decihertz"
-msgstr[1] "%1 decihertza"
-msgstr[2] "%1 decihertza"
-
-#: frequency.cpp:116
-msgctxt "frequency unit symbol"
-msgid "cHz"
-msgstr "cHz"
-
-#: frequency.cpp:117
-msgctxt "unit description in lists"
-msgid "centihertzs"
-msgstr "centihertzi"
-
-#: frequency.cpp:118
-msgctxt "unit synonyms for matching user input"
-msgid "centihertz;centihertzs;cHz"
-msgstr "centihertz;centihertzi;centihertza;cHz"
-
-#: frequency.cpp:119
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 centihertzs"
-msgstr "%1 centihertza"
-
-#: frequency.cpp:120
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 centihertz"
-msgid_plural "%1 centihertzs"
-msgstr[0] "%1 centihertz"
-msgstr[1] "%1 centihertza"
-msgstr[2] "%1 centihertza"
-
-#: frequency.cpp:123
-msgctxt "frequency unit symbol"
-msgid "mHz"
-msgstr "mHz"
-
-#: frequency.cpp:124
-msgctxt "unit description in lists"
-msgid "millihertzs"
-msgstr "milihertzi"
-
-#: frequency.cpp:125
-msgctxt "unit synonyms for matching user input"
-msgid "millihertz;millihertzs;mHz"
-msgstr "milihertz;milihertzi;milihertza;mHz"
-
-#: frequency.cpp:126
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 millihertzs"
-msgstr "%1 milihertza"
-
-#: frequency.cpp:127
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 millihertz"
-msgid_plural "%1 millihertzs"
-msgstr[0] "%1 milihertz"
-msgstr[1] "%1 milihertza"
-msgstr[2] "%1 milihertza"
-
-#: frequency.cpp:130
-msgctxt "frequency unit symbol"
-msgid "µHz"
-msgstr "µHz"
-
-#: frequency.cpp:131
-msgctxt "unit description in lists"
-msgid "microhertzs"
-msgstr "mikrohertzi"
-
-#: frequency.cpp:132
-msgctxt "unit synonyms for matching user input"
-msgid "microhertz;microhertzs;µHz;uHz"
-msgstr "mikrohertz;mikrohertza;mikrohertzi;µHz;uHz"
-
-#: frequency.cpp:133
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 microhertzs"
-msgstr "%1 mikrohertza"
-
-#: frequency.cpp:134
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 microhertz"
-msgid_plural "%1 microhertzs"
-msgstr[0] "%1 mikrohertz"
-msgstr[1] "%1 mikrohertza"
-msgstr[2] "%1 mikrohertza"
-
-#: frequency.cpp:137
-msgctxt "frequency unit symbol"
-msgid "nHz"
-msgstr "nHz"
-
-#: frequency.cpp:138
-msgctxt "unit description in lists"
-msgid "nanohertzs"
-msgstr "nanohertzi"
-
-#: frequency.cpp:139
-msgctxt "unit synonyms for matching user input"
-msgid "nanohertz;nanohertzs;nHz"
-msgstr "nanohertz;nanohertzi;nanohertza;nHz"
-
-#: frequency.cpp:140
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 nanohertzs"
-msgstr "%1 nanohertza"
-
-#: frequency.cpp:141
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 nanohertz"
-msgid_plural "%1 nanohertzs"
-msgstr[0] "%1 nanohertz"
-msgstr[1] "%1 nanohertza"
-msgstr[2] "%1 nanohertza"
-
-#: frequency.cpp:144
-msgctxt "frequency unit symbol"
-msgid "pHz"
-msgstr "pHz"
-
-#: frequency.cpp:145
-msgctxt "unit description in lists"
-msgid "picohertzs"
-msgstr "pikohertzi"
-
-#: frequency.cpp:146
-msgctxt "unit synonyms for matching user input"
-msgid "picohertz;picohertzs;pHz"
-msgstr "pikohertz;pikohertzi;pikohertza;pHz"
-
-#: frequency.cpp:147
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 picohertzs"
-msgstr "%1 pikohertza"
-
-#: frequency.cpp:148
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 picohertz"
-msgid_plural "%1 picohertzs"
-msgstr[0] "%1 pikohertz"
-msgstr[1] "%1 pikohertza"
-msgstr[2] "%1 pikohertza"
-
-#: frequency.cpp:151
-msgctxt "frequency unit symbol"
-msgid "fHz"
-msgstr "fHz"
-
-#: frequency.cpp:152
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "femtojoules"
-msgctxt "unit description in lists"
-msgid "femtohertzs"
-msgstr "femtodžuli"
-
-#: frequency.cpp:153
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "femtojoule;femtojoules;fJ"
-msgctxt "unit synonyms for matching user input"
-msgid "femtohertz;femtohertzs;fHz"
-msgstr "femtodžul;femtodžuli;fJ"
-
-#: frequency.cpp:154
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 femtojoules"
-msgctxt "amount in units (real)"
-msgid "%1 femtohertzs"
-msgstr "%1 femtodžula"
-
-#: frequency.cpp:155
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 femtojoule"
-#| msgid_plural "%1 femtojoules"
-msgctxt "amount in units (integer)"
-msgid "%1 femtohertz"
-msgid_plural "%1 femtohertzs"
-msgstr[0] "%1 femtodžul"
-msgstr[1] "%1 femtodžula"
-msgstr[2] "%1 femtodžula"
-
-#: frequency.cpp:158
-msgctxt "frequency unit symbol"
-msgid "aHz"
-msgstr "aHz"
-
-#: frequency.cpp:159
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "atmospheres"
-msgctxt "unit description in lists"
-msgid "attohertzs"
-msgstr "atmosfere"
-
-#: frequency.cpp:160
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "atmosphere;atmospheres;atm"
-msgctxt "unit synonyms for matching user input"
-msgid "attohertz;attohertzs;aHz"
-msgstr "atmosfera;atmosfere;atm"
-
-#: frequency.cpp:161
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 attojoules"
-msgctxt "amount in units (real)"
-msgid "%1 attohertzs"
-msgstr "%1 atodžula"
-
-#: frequency.cpp:162
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 attojoule"
-#| msgid_plural "%1 attojoules"
-msgctxt "amount in units (integer)"
-msgid "%1 attohertz"
-msgid_plural "%1 attohertzs"
-msgstr[0] "%1 atodžul"
-msgstr[1] "%1 atodžula"
-msgstr[2] "%1 atodžula"
-
-#: frequency.cpp:165
-msgctxt "frequency unit symbol"
-msgid "zHz"
-msgstr "zHz"
-
-#: frequency.cpp:166
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "zeptojoules"
-msgctxt "unit description in lists"
-msgid "zeptohertzs"
-msgstr "zeptodžuli"
-
-#: frequency.cpp:167
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "zeptojoule;zeptojoules;zJ"
-msgctxt "unit synonyms for matching user input"
-msgid "zeptohertz;zeptohertzs;zHz"
-msgstr "zeptodžul;zeptodžuli;zJ"
-
-#: frequency.cpp:168
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 zeptojoules"
-msgctxt "amount in units (real)"
-msgid "%1 zeptohertzs"
-msgstr "%1 zeptodžula"
-
-#: frequency.cpp:169
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 zeptojoule"
-#| msgid_plural "%1 zeptojoules"
-msgctxt "amount in units (integer)"
-msgid "%1 zeptohertz"
-msgid_plural "%1 zeptohertzs"
-msgstr[0] "%1 zeptodžul"
-msgstr[1] "%1 zeptodžula"
-msgstr[2] "%1 zeptodžula"
-
-#: frequency.cpp:172
-msgctxt "frequency unit symbol"
-msgid "yHz"
-msgstr "yHz"
-
-#: frequency.cpp:173
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "yoctojoules"
-msgctxt "unit description in lists"
-msgid "yoctohertzs"
-msgstr "joktodžuli"
-
-#: frequency.cpp:174
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "yoctojoule;yoctojoules;yJ"
-msgctxt "unit synonyms for matching user input"
-msgid "yoctohertz;yoctohertzs;yHz"
-msgstr "joktodžul;joktodžuli;yJ"
-
-#: frequency.cpp:175
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 yoctojoules"
-msgctxt "amount in units (real)"
-msgid "%1 yoctohertzs"
-msgstr "%1 joktodžula"
-
-#: frequency.cpp:176
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 yoctojoule"
-#| msgid_plural "%1 yoctojoules"
-msgctxt "amount in units (integer)"
-msgid "%1 yoctohertz"
-msgid_plural "%1 yoctohertzs"
-msgstr[0] "%1 joktodžul"
-msgstr[1] "%1 joktodžula"
-msgstr[2] "%1 joktodžula"
-
-#: frequency.cpp:179
-msgctxt "frequency unit symbol"
-msgid "RPM"
-msgstr "RPM"
-
-#: frequency.cpp:180
-msgctxt "unit description in lists"
-msgid "revolutions per minute"
-msgstr "okretaji po minuti"
-
-#: frequency.cpp:182
-msgctxt "unit synonyms for matching user input"
-msgid "revolutions per minute;revolution per minute;RPM"
-msgstr ""
-"okretaja po minuti;okret u minuti;okretaj po minuti;okret po minuti;RPM;OPM"
-
-#: frequency.cpp:183
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 revolutions per minute"
-msgstr "%1 okretaja po minuti"
-
-#: frequency.cpp:184
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 revolution per minute"
-msgid_plural "%1 revolutions per minute"
-msgstr[0] "%1 okretaj po minuti"
-msgstr[1] "%1 okretaja po minuti"
-msgstr[2] "%1 okretaja po minuti"
-
-#: fuel_efficiency.cpp:46
-msgid "Fuel Efficiency"
-msgstr "Iskoristivost goriva"
-
-#: fuel_efficiency.cpp:47
-#, kde-format
-msgctxt "%1 value, %2 unit symbol (fuel efficiency)"
-msgid "%1 %2"
-msgstr "%1 %2"
-
-#: fuel_efficiency.cpp:50
-msgctxt "fuelefficiency unit symbol"
-msgid "l/100 km"
-msgstr "l/100 km"
-
-#: fuel_efficiency.cpp:51
-msgctxt "unit description in lists"
-msgid "liters per 100 kilometers"
-msgstr "litara na 100 kilometara"
-
-#: fuel_efficiency.cpp:52
-msgctxt "unit synonyms for matching user input"
-msgid "liters per 100 kilometers;liters per 100 kilometers;l/100 km;L/100 km"
-msgstr "litara na 100 kilometara;litara na 100 kilometara;l/100 km;L/100 km"
-
-#: fuel_efficiency.cpp:53
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 liters per 100 kilometers"
-msgstr "%1 litara na 100 kilometara"
-
-#: fuel_efficiency.cpp:54
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 liters per 100 kilometers"
-msgid_plural "%1 liters per 100 kilometers"
-msgstr[0] "%1 litra na 100 kilometara"
-msgstr[1] "%1 litre na 100 kilometara"
-msgstr[2] "%1 litara na 100 kilometara"
-
-#: fuel_efficiency.cpp:57
-msgctxt "fuelefficiency unit symbol"
-msgid "mpg"
-msgstr "mpg"
-
-#: fuel_efficiency.cpp:58
-msgctxt "unit description in lists"
-msgid "miles per US gallon"
-msgstr "milje po US galonu"
-
-#: fuel_efficiency.cpp:59
-#, fuzzy
-msgctxt "unit synonyms for matching user input"
-msgid "mile per US gallon;miles per US gallon;mpg"
-msgstr "mile per US gallon;miles per US gallon;mpg"
-
-#: fuel_efficiency.cpp:60
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 miles per US gallon"
-msgstr ""
-
-#: fuel_efficiency.cpp:61
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 mile per US gallon"
-msgid_plural "%1 miles per US gallon"
-msgstr[0] ""
-msgstr[1] ""
-
-#: fuel_efficiency.cpp:64
-msgctxt "fuelefficiency unit symbol"
-msgid "mpg (imperial)"
-msgstr "mpg (imperijalni)"
-
-#: fuel_efficiency.cpp:65
-msgctxt "unit description in lists"
-msgid "miles per imperial gallon"
-msgstr ""
-
-#: fuel_efficiency.cpp:66
-msgctxt "unit synonyms for matching user input"
-msgid "mile per imperial gallon;miles per imperial gallon;mpg (imperial)"
-msgstr ""
-
-#: fuel_efficiency.cpp:67
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 miles per imperial gallon"
-msgstr ""
-
-#: fuel_efficiency.cpp:68
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 mile per imperial gallon"
-msgid_plural "%1 miles per imperial gallon"
-msgstr[0] ""
-msgstr[1] ""
-
-#: fuel_efficiency.cpp:71
-msgctxt "fuelefficiency unit symbol"
-msgid "kmpl"
-msgstr "kmpl"
-
-#: fuel_efficiency.cpp:72
-msgctxt "unit description in lists"
-msgid "kilometers per liter"
-msgstr "kilometri po litri"
-
-#: fuel_efficiency.cpp:73
-msgctxt "unit synonyms for matching user input"
-msgid "kilometer per liter;kilometers per liter;kmpl;km/l"
-msgstr "kilometar po litri;kilometara po litri;kmpl;km/l"
-
-#: fuel_efficiency.cpp:74
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 kilometers per liter"
-msgstr "%1 kilometara po litri"
-
-#: fuel_efficiency.cpp:75
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 kilometer per liter"
-msgid_plural "%1 kilometers per liter"
-msgstr[0] "%1 kilometar po litri"
-msgstr[1] "%1 kilometra po litri"
-msgstr[2] "%1 kilometara po litri"
-
-#: length.cpp:28
-msgid "Length"
-msgstr "Duljina"
-
-#: length.cpp:29
-#, kde-format
-msgctxt "%1 value, %2 unit symbol (length"
-msgid "%1 %2"
-msgstr "%1 %2"
-
-#: length.cpp:32
-msgctxt "length unit symbol"
-msgid "Ym"
-msgstr "Ym"
-
-#: length.cpp:33
-msgctxt "unit description in lists"
-msgid "yottameters"
-msgstr "jotametri"
-
-#: length.cpp:34
-msgctxt "unit synonyms for matching user input"
-msgid "yottameter;yottameters;Ym"
-msgstr "jotametar;jotametri;Ym"
-
-#: length.cpp:35
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 yottameters"
-msgstr ""
-
-#: length.cpp:36
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 yottameter"
-msgid_plural "%1 yottameters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: length.cpp:39
-msgctxt "length unit symbol"
-msgid "Zm"
-msgstr "Zm"
-
-#: length.cpp:40
-msgctxt "unit description in lists"
-msgid "zettameters"
-msgstr ""
-
-#: length.cpp:41
-msgctxt "unit synonyms for matching user input"
-msgid "zettameter;zettameters;Zm"
-msgstr ""
-
-#: length.cpp:42
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 zettameters"
-msgstr ""
-
-#: length.cpp:43
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 zettameter"
-msgid_plural "%1 zettameters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: length.cpp:46
-msgctxt "length unit symbol"
-msgid "Em"
-msgstr "Em"
-
-#: length.cpp:47
-msgctxt "unit description in lists"
-msgid "exameters"
-msgstr ""
-
-#: length.cpp:48
-msgctxt "unit synonyms for matching user input"
-msgid "exameter;exameters;Em"
-msgstr ""
-
-#: length.cpp:49
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 exameters"
-msgstr ""
-
-#: length.cpp:50
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 exameter"
-msgid_plural "%1 exameters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: length.cpp:53
-msgctxt "length unit symbol"
-msgid "Pm"
-msgstr "Pm"
-
-#: length.cpp:54
-msgctxt "unit description in lists"
-msgid "petameters"
-msgstr ""
-
-#: length.cpp:55
-msgctxt "unit synonyms for matching user input"
-msgid "petameter;petameters;Pm"
-msgstr ""
-
-#: length.cpp:56
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 petameters"
-msgstr ""
-
-#: length.cpp:57
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 petameter"
-msgid_plural "%1 petameters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: length.cpp:60
-msgctxt "length unit symbol"
-msgid "Tm"
-msgstr "Tm"
-
-#: length.cpp:61
-msgctxt "unit description in lists"
-msgid "terameters"
-msgstr ""
-
-#: length.cpp:62
-msgctxt "unit synonyms for matching user input"
-msgid "terameter;terameters;Tm"
-msgstr ""
-
-#: length.cpp:63
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 terameters"
-msgstr ""
-
-#: length.cpp:64
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 terameter"
-msgid_plural "%1 terameters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: length.cpp:67
-msgctxt "length unit symbol"
-msgid "Gm"
-msgstr "Gm"
-
-#: length.cpp:68
-msgctxt "unit description in lists"
-msgid "gigameters"
-msgstr "gigametri"
-
-#: length.cpp:69
-msgctxt "unit synonyms for matching user input"
-msgid "gigameter;gigameters;Gm"
-msgstr ""
-
-#: length.cpp:70
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 gigameters"
-msgstr "%1 gigametara"
-
-#: length.cpp:71
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 gigameter"
-msgid_plural "%1 gigameters"
-msgstr[0] ""
-msgstr[1] "gigametri"
-msgstr[2] "gigametri"
-
-#: length.cpp:74
-msgctxt "length unit symbol"
-msgid "Mm"
-msgstr "Mm"
-
-#: length.cpp:75
-msgctxt "unit description in lists"
-msgid "megameters"
-msgstr ""
-
-#: length.cpp:76
-msgctxt "unit synonyms for matching user input"
-msgid "megameter;megameters;Mm"
-msgstr ""
-
-#: length.cpp:77
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 megameters"
-msgstr ""
-
-#: length.cpp:78
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 megameter"
-msgid_plural "%1 megameters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: length.cpp:81
-msgctxt "length unit symbol"
-msgid "km"
-msgstr "km"
-
-#: length.cpp:82
-msgctxt "unit description in lists"
-msgid "kilometers"
-msgstr "kilometri"
-
-#: length.cpp:83
-msgctxt "unit synonyms for matching user input"
-msgid "kilometer;kilometers;km"
-msgstr "kilometar;kilometara;km"
-
-#: length.cpp:84
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 kilometers"
-msgstr "%1 kilometara"
-
-#: length.cpp:85
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 kilometer"
-msgid_plural "%1 kilometers"
-msgstr[0] "%1 kilometar"
-msgstr[1] "%1 kilometra"
-msgstr[2] "%1 kilometara"
-
-#: length.cpp:88
-msgctxt "length unit symbol"
-msgid "hm"
-msgstr "hm"
-
-#: length.cpp:89
-msgctxt "unit description in lists"
-msgid "hectometers"
-msgstr "hektometri"
-
-#: length.cpp:90
-msgctxt "unit synonyms for matching user input"
-msgid "hectometer;hectometers;hm"
-msgstr "hektometar;hektometara;hm"
-
-#: length.cpp:91
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 hectometers"
-msgstr "%1 hektometara"
-
-#: length.cpp:92
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 hectometer"
-msgid_plural "%1 hectometers"
-msgstr[0] ""
-msgstr[1] "hektometri"
-msgstr[2] "hektometri"
-
-#: length.cpp:95
-msgctxt "length unit symbol"
-msgid "dam"
-msgstr "dam"
-
-#: length.cpp:96
-msgctxt "unit description in lists"
-msgid "decameters"
-msgstr ""
-
-#: length.cpp:97
-msgctxt "unit synonyms for matching user input"
-msgid "decameter;decameters;dam"
-msgstr ""
-
-#: length.cpp:98
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 decameters"
-msgstr ""
-
-#: length.cpp:99
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 decameter"
-msgid_plural "%1 decameters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: length.cpp:102
-msgctxt "length unit symbol"
-msgid "m"
-msgstr "m"
-
-#: length.cpp:103
-msgctxt "unit description in lists"
-msgid "meters"
-msgstr "metri"
-
-#: length.cpp:104
-msgctxt "unit synonyms for matching user input"
-msgid "meter;meters;m"
-msgstr "metar;metri;metra;metara;m"
-
-#: length.cpp:105
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 meters"
-msgstr "%1 metara"
-
-#: length.cpp:106
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 meter"
-msgid_plural "%1 meters"
-msgstr[0] "%1 metar"
-msgstr[1] "%1 metra"
-msgstr[2] "%1 metara"
-
-#: length.cpp:109
-msgctxt "length unit symbol"
-msgid "dm"
-msgstr "dm"
-
-#: length.cpp:110
-msgctxt "unit description in lists"
-msgid "decimeters"
-msgstr "decimetri"
-
-#: length.cpp:111
-msgctxt "unit synonyms for matching user input"
-msgid "decimeter;decimeters;dm"
-msgstr "decimetar;decimetra;decimetara;decimetri;dm"
-
-#: length.cpp:112
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 decimeters"
-msgstr "%1 decimetara"
-
-#: length.cpp:113
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 decimeter"
-msgid_plural "%1 decimeters"
-msgstr[0] "%1 decimetar"
-msgstr[1] "%1 decimetra"
-msgstr[2] "%1 decimetara"
-
-#: length.cpp:116
-msgctxt "length unit symbol"
-msgid "cm"
-msgstr "cm"
-
-#: length.cpp:117
-msgctxt "unit description in lists"
-msgid "centimeters"
-msgstr "centimetri"
-
-#: length.cpp:118
-msgctxt "unit synonyms for matching user input"
-msgid "centimeter;centimeters;cm"
-msgstr "centimetar;centimetra;centimetri;centimetara;cm"
-
-#: length.cpp:119
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 centimeters"
-msgstr "%1 centimetara"
-
-#: length.cpp:120
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 centimeter"
-msgid_plural "%1 centimeters"
-msgstr[0] "%1 centimetar"
-msgstr[1] "%1 centimetra"
-msgstr[2] "%1 centimetara"
-
-#: length.cpp:123
-msgctxt "length unit symbol"
-msgid "mm"
-msgstr "mm"
-
-#: length.cpp:124
-msgctxt "unit description in lists"
-msgid "millimeters"
-msgstr "milimetri"
-
-#: length.cpp:125
-msgctxt "unit synonyms for matching user input"
-msgid "millimeter;millimeters;mm"
-msgstr "milimetar;milimetra;milimetri;milimetara;mm"
-
-#: length.cpp:126
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 millimeters"
-msgstr "%1 milimetara"
-
-#: length.cpp:127
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 millimeter"
-msgid_plural "%1 millimeters"
-msgstr[0] "%1 milimetar"
-msgstr[1] "%1 milimetra"
-msgstr[2] "%1 milimetara"
-
-#: length.cpp:130
-msgctxt "length unit symbol"
-msgid "µm"
-msgstr "µm"
-
-#: length.cpp:131
-msgctxt "unit description in lists"
-msgid "micrometers"
-msgstr "mikrometri"
-
-#: length.cpp:132
-msgctxt "unit synonyms for matching user input"
-msgid "micrometer;micrometers;µm;um"
-msgstr "mikrometar;mikrometra;mikrometri;mikrometara;µm;um"
-
-#: length.cpp:133
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 micrometers"
-msgstr "%1 mikrometara"
-
-#: length.cpp:134
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 micrometer"
-msgid_plural "%1 micrometers"
-msgstr[0] "%1 mikrometar"
-msgstr[1] "%1 mikrometra"
-msgstr[2] "%1 mikrometara"
-
-#: length.cpp:137
-msgctxt "length unit symbol"
-msgid "nm"
-msgstr "nm"
-
-#: length.cpp:138
-msgctxt "unit description in lists"
-msgid "nanometers"
-msgstr "nanometri"
-
-#: length.cpp:139
-msgctxt "unit synonyms for matching user input"
-msgid "nanometer;nanometers;nm"
-msgstr "nanometar;nanometra;nanometri;nanometara;nm"
-
-#: length.cpp:144
-msgctxt "length unit symbol"
-msgid "Å"
-msgstr "Å"
-
-#: length.cpp:145
-msgctxt "unit description in lists"
-msgid "Ångström"
-msgstr "Ångström"
-
-#: length.cpp:146
-msgctxt "unit synonyms for matching user input"
-msgid ""
-"Ångström;Ångstrom;Angström;Angstrom;Ångströms;Ångstroms;Angströms;Angstroms;Å"
-msgstr ""
-
-#: length.cpp:147
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 Ångströms"
-msgstr ""
-
-#: length.cpp:148
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 Ångström"
-msgid_plural "%1 Ångströms"
-msgstr[0] ""
-msgstr[1] ""
-msgstr[2] ""
-
-#: length.cpp:151
-msgctxt "length unit symbol"
-msgid "pm"
-msgstr "pm"
-
-#: length.cpp:152
-msgctxt "unit description in lists"
-msgid "picometers"
-msgstr "pikometri"
-
-#: length.cpp:153
-msgctxt "unit synonyms for matching user input"
-msgid "picometer;picometers;pm"
-msgstr "pikometar;pikometra;pikometri;pikometara;pm"
-
-#: length.cpp:154
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 picometers"
-msgstr "%1 pikometara"
-
-#: length.cpp:155
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 picometer"
-msgid_plural "%1 picometers"
-msgstr[0] "%1 pikometar"
-msgstr[1] "%1 pikometra"
-msgstr[2] "%1 pikometara"
-
-#: length.cpp:158
-msgctxt "length unit symbol"
-msgid "fm"
-msgstr "fm"
-
-#: length.cpp:159
-msgctxt "unit description in lists"
-msgid "femtometers"
-msgstr ""
-
-#: length.cpp:160
-msgctxt "unit synonyms for matching user input"
-msgid "femtometer;femtometers;fm"
-msgstr ""
-
-#: length.cpp:161
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 femtometers"
-msgstr ""
-
-#: length.cpp:162
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 femtometer"
-msgid_plural "%1 femtometers"
-msgstr[0] ""
-msgstr[1] ""
-
-#: length.cpp:165
-msgctxt "length unit symbol"
-msgid "am"
-msgstr "am"
-
-#: length.cpp:166
-msgctxt "unit description in lists"
-msgid "attometers"
-msgstr ""
-
-#: length.cpp:167
-msgctxt "unit synonyms for matching user input"
-msgid "attometer;attometers;am"
-msgstr ""
-
-#: length.cpp:168
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 attometers"
-msgstr ""
-
-#: length.cpp:169
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 attometer"
-msgid_plural "%1 attometers"
-msgstr[0] ""
-msgstr[1] ""
-
-#: length.cpp:172
-msgctxt "length unit symbol"
-msgid "zm"
-msgstr "zm"
-
-#: length.cpp:173
-msgctxt "unit description in lists"
-msgid "zeptometers"
-msgstr ""
-
-#: length.cpp:174
-msgctxt "unit synonyms for matching user input"
-msgid "zeptometer;zeptometers;zm"
-msgstr ""
-
-#: length.cpp:175
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 zeptometers"
-msgstr ""
-
-#: length.cpp:176
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 zeptometer"
-msgid_plural "%1 zeptometers"
-msgstr[0] ""
-msgstr[1] ""
-
-#: length.cpp:179
-msgctxt "length unit symbol"
-msgid "ym"
-msgstr "ym"
-
-#: length.cpp:180
-msgctxt "unit description in lists"
-msgid "yoctometers"
-msgstr "joktometri"
-
-#: length.cpp:181
-msgctxt "unit synonyms for matching user input"
-msgid "yoctometer;yoctometers;ym"
-msgstr "joktometar;joktometri;ym"
-
-#: length.cpp:182
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 yoctometers"
-msgstr "%1 joktometara"
-
-#: length.cpp:183
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 yoctometer"
-msgid_plural "%1 yoctometers"
-msgstr[0] "%1 joktometar"
-msgstr[1] "%1 joktometra"
-msgstr[2] "%1 joktometara"
-
-#: length.cpp:186
-msgctxt "length unit symbol"
-msgid "in"
-msgstr "in"
-
-#: length.cpp:187
-msgctxt "unit description in lists"
-msgid "inches"
-msgstr "inči"
-
-#: length.cpp:188
-msgctxt "unit synonyms for matching user input"
-msgid "inch;inches;in;\""
-msgstr "inč;inča;inči;inčevi;inčeva;in;\""
-
-#: length.cpp:189
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 inches"
-msgstr "%1 inča"
-
-#: length.cpp:190
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 inch"
-msgid_plural "%1 inches"
-msgstr[0] "%1 inč"
-msgstr[1] "%1 inča"
-msgstr[2] "%1 inča"
-
-#: length.cpp:193
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "hours"
-msgctxt "length unit symbol"
-msgid "thou"
-msgstr "sati"
-
-#: length.cpp:194
-msgctxt "unit description in lists"
-msgid "thousandths of an inch"
-msgstr ""
-
-#: length.cpp:195
-msgctxt "unit synonyms for matching user input"
-msgid "thou;mil;point;thousandth of an inch;thousandths of an inch"
-msgstr ""
-
-#: length.cpp:196
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 pounds per cubic inch"
-msgctxt "amount in units (real)"
-msgid "%1 thousandths of an inch"
-msgstr "%1 funti po kubičnom inču"
-
-#: length.cpp:197
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 thousandth of an inch"
-msgid_plural "%1 thousandths of an inch"
-msgstr[0] ""
-msgstr[1] ""
-msgstr[2] ""
-
-#: length.cpp:200
-msgctxt "length unit symbol"
-msgid "ft"
-msgstr "ft"
-
-#: length.cpp:201
-msgctxt "unit description in lists"
-msgid "feet"
-msgstr ""
-
-#: length.cpp:202
-msgctxt "unit synonyms for matching user input"
-msgid "foot;feet;ft"
-msgstr ""
-
-#: length.cpp:203
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 feet"
-msgstr ""
-
-#: length.cpp:204
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 foot"
-msgid_plural "%1 feet"
-msgstr[0] ""
-msgstr[1] ""
-
-#: length.cpp:207
-msgctxt "length unit symbol"
-msgid "yd"
-msgstr "yd"
-
-#: length.cpp:208
-msgctxt "unit description in lists"
-msgid "yards"
-msgstr "jardi"
-
-#: length.cpp:209
-msgctxt "unit synonyms for matching user input"
-msgid "yard;yards;yd"
-msgstr "yard;jard;jardi;jarda;yd"
-
-#: length.cpp:210
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 yards"
-msgstr "%1 jarda"
-
-#: length.cpp:211
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 yard"
-msgid_plural "%1 yards"
-msgstr[0] "%1 jard"
-msgstr[1] "%1 jarda"
-msgstr[2] "%1 jarda"
-
-#: length.cpp:214
-msgctxt "length unit symbol"
-msgid "mi"
-msgstr "mi"
-
-#: length.cpp:215
-msgctxt "unit description in lists"
-msgid "miles"
-msgstr "milje"
-
-#: length.cpp:216
-msgctxt "unit synonyms for matching user input"
-msgid "mile;miles;mi"
-msgstr "milja;milje;milji;mi"
-
-#: length.cpp:217
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 miles"
-msgstr "%1 milja"
-
-#: length.cpp:218
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 mile"
-msgid_plural "%1 miles"
-msgstr[0] "%1 milja"
-msgstr[1] "%1 milje"
-msgstr[2] "%1 milja"
-
-#: length.cpp:221
-msgctxt "length unit symbol"
-msgid "nmi"
-msgstr "nmi"
-
-#: length.cpp:222
-msgctxt "unit description in lists"
-msgid "nautical miles"
-msgstr "nautičke milje"
-
-#: length.cpp:223
-msgctxt "unit synonyms for matching user input"
-msgid "nautical mile;nautical miles;nmi"
-msgstr "nautička milja;nautičke milje;nmi"
-
-#: length.cpp:224
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 nautical miles"
-msgstr ""
-
-#: length.cpp:225
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 nautical mile"
-msgid_plural "%1 nautical miles"
-msgstr[0] ""
-msgstr[1] ""
-
-#: length.cpp:228
-msgctxt "length unit symbol"
-msgid "ly"
-msgstr "ly"
-
-#: length.cpp:229
-msgctxt "unit description in lists"
-msgid "light-years"
-msgstr ""
-
-#: length.cpp:231
-msgctxt "unit synonyms for matching user input"
-msgid "light-year;light-years;ly;lightyear;lightyears"
-msgstr ""
-
-#: length.cpp:232
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 light-years"
-msgstr ""
-
-#: length.cpp:233
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 light-year"
-msgid_plural "%1 light-years"
-msgstr[0] ""
-msgstr[1] ""
-
-#: length.cpp:236
-msgctxt "length unit symbol"
-msgid "pc"
-msgstr "pc"
-
-#: length.cpp:237
-msgctxt "unit description in lists"
-msgid "parsecs"
-msgstr ""
-
-#: length.cpp:238
-msgctxt "unit synonyms for matching user input"
-msgid "parsec;parsecs;pc"
-msgstr ""
-
-#: length.cpp:239
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 parsecs"
-msgstr ""
-
-#: length.cpp:240
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 parsec"
-msgid_plural "%1 parsecs"
-msgstr[0] ""
-msgstr[1] ""
-
-#: length.cpp:243
-msgctxt "length unit symbol"
-msgid "au"
-msgstr "au"
-
-#: length.cpp:244
-msgctxt "unit description in lists"
-msgid "astronomical units"
-msgstr ""
-
-#: length.cpp:245
-msgctxt "unit synonyms for matching user input"
-msgid "astronomical unit;astronomical units;au"
-msgstr ""
-
-#: length.cpp:246
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 astronomical units"
-msgstr ""
-
-#: length.cpp:247
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 astronomical unit"
-msgid_plural "%1 astronomical units"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:29
-msgid "Mass"
-msgstr "Masa"
-
-#: mass.cpp:30
-#, kde-format
-msgctxt "%1 value, %2 unit symbol (mass)"
-msgid "%1 %2"
-msgstr "%1 %2"
-
-#: mass.cpp:33
-msgctxt "mass unit symbol"
-msgid "Yg"
-msgstr "Yg"
-
-#: mass.cpp:34
-msgctxt "unit description in lists"
-msgid "yottagrams"
-msgstr ""
-
-#: mass.cpp:35
-msgctxt "unit synonyms for matching user input"
-msgid "yottagram;yottagrams;Yg"
-msgstr ""
-
-#: mass.cpp:36
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 yottagrams"
-msgstr ""
-
-#: mass.cpp:37
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 yottagram"
-msgid_plural "%1 yottagrams"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:40
-msgctxt "mass unit symbol"
-msgid "Zg"
-msgstr "Zg"
-
-#: mass.cpp:41
-msgctxt "unit description in lists"
-msgid "zettagrams"
-msgstr ""
-
-#: mass.cpp:42
-msgctxt "unit synonyms for matching user input"
-msgid "zettagram;zettagrams;Zg"
-msgstr ""
-
-#: mass.cpp:43
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 zettagrams"
-msgstr ""
-
-#: mass.cpp:44
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 zettagram"
-msgid_plural "%1 zettagrams"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:47
-msgctxt "mass unit symbol"
-msgid "Eg"
-msgstr "Eg"
-
-#: mass.cpp:48
-msgctxt "unit description in lists"
-msgid "exagrams"
-msgstr ""
-
-#: mass.cpp:49
-msgctxt "unit synonyms for matching user input"
-msgid "exagram;exagrams;Eg"
-msgstr ""
-
-#: mass.cpp:50
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 exagrams"
-msgstr ""
-
-#: mass.cpp:51
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 exagram"
-msgid_plural "%1 exagrams"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:54
-msgctxt "mass unit symbol"
-msgid "Pg"
-msgstr "Pg"
-
-#: mass.cpp:55
-msgctxt "unit description in lists"
-msgid "petagrams"
-msgstr ""
-
-#: mass.cpp:56
-msgctxt "unit synonyms for matching user input"
-msgid "petagram;petagrams;Pg"
-msgstr ""
-
-#: mass.cpp:57
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 petagrams"
-msgstr ""
-
-#: mass.cpp:58
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 petagram"
-msgid_plural "%1 petagrams"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:61
-msgctxt "mass unit symbol"
-msgid "Tg"
-msgstr "Tg"
-
-#: mass.cpp:62
-msgctxt "unit description in lists"
-msgid "teragrams"
-msgstr ""
-
-#: mass.cpp:63
-msgctxt "unit synonyms for matching user input"
-msgid "teragram;teragrams;Tg"
-msgstr ""
-
-#: mass.cpp:64
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 teragrams"
-msgstr ""
-
-#: mass.cpp:65
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 teragram"
-msgid_plural "%1 teragrams"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:68
-msgctxt "mass unit symbol"
-msgid "Gg"
-msgstr "Gg"
-
-#: mass.cpp:69
-msgctxt "unit description in lists"
-msgid "gigagrams"
-msgstr ""
-
-#: mass.cpp:70
-msgctxt "unit synonyms for matching user input"
-msgid "gigagram;gigagrams;Gg"
-msgstr ""
-
-#: mass.cpp:71
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 gigagrams"
-msgstr ""
-
-#: mass.cpp:72
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 gigagram"
-msgid_plural "%1 gigagrams"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:75
-msgctxt "mass unit symbol"
-msgid "Mg"
-msgstr "Mg"
-
-#: mass.cpp:76
-msgctxt "unit description in lists"
-msgid "megagrams"
-msgstr ""
-
-#: mass.cpp:77
-msgctxt "unit synonyms for matching user input"
-msgid "megagram;megagrams;Mg"
-msgstr ""
-
-#: mass.cpp:78
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 megagrams"
-msgstr ""
-
-#: mass.cpp:79
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 megagram"
-msgid_plural "%1 megagrams"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:82
-msgctxt "mass unit symbol"
-msgid "kg"
-msgstr "kg"
-
-#: mass.cpp:83
-msgctxt "unit description in lists"
-msgid "kilograms"
-msgstr ""
-
-#: mass.cpp:84
-msgctxt "unit synonyms for matching user input"
-msgid "kilogram;kilograms;kg"
-msgstr ""
-
-#: mass.cpp:85
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 kilograms"
-msgstr ""
-
-#: mass.cpp:86
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 kilogram"
-msgid_plural "%1 kilograms"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:89
-msgctxt "mass unit symbol"
-msgid "hg"
-msgstr "hg"
-
-#: mass.cpp:90
-msgctxt "unit description in lists"
-msgid "hectograms"
-msgstr ""
-
-#: mass.cpp:91
-msgctxt "unit synonyms for matching user input"
-msgid "hectogram;hectograms;hg"
-msgstr ""
-
-#: mass.cpp:92
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 hectograms"
-msgstr ""
-
-#: mass.cpp:93
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 hectogram"
-msgid_plural "%1 hectograms"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:96
-msgctxt "mass unit symbol"
-msgid "dag"
-msgstr "dag"
-
-#: mass.cpp:97
-msgctxt "unit description in lists"
-msgid "decagrams"
-msgstr ""
-
-#: mass.cpp:98
-msgctxt "unit synonyms for matching user input"
-msgid "decagram;decagrams;dag"
-msgstr ""
-
-#: mass.cpp:99
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 decagrams"
-msgstr ""
-
-#: mass.cpp:100
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 decagram"
-msgid_plural "%1 decagrams"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:103
-msgctxt "mass unit symbol"
-msgid "g"
-msgstr "g"
-
-#: mass.cpp:104
-msgctxt "unit description in lists"
-msgid "grams"
-msgstr ""
-
-#: mass.cpp:105
-msgctxt "unit synonyms for matching user input"
-msgid "gram;grams;g"
-msgstr ""
-
-#: mass.cpp:106
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 grams"
-msgstr ""
-
-#: mass.cpp:107
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 gram"
-msgid_plural "%1 grams"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:110
-msgctxt "mass unit symbol"
-msgid "dg"
-msgstr "dg"
-
-#: mass.cpp:111
-msgctxt "unit description in lists"
-msgid "decigrams"
-msgstr ""
-
-#: mass.cpp:112
-msgctxt "unit synonyms for matching user input"
-msgid "decigram;decigrams;dg"
-msgstr ""
-
-#: mass.cpp:113
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 decigrams"
-msgstr ""
-
-#: mass.cpp:114
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 decigram"
-msgid_plural "%1 decigrams"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:117
-msgctxt "mass unit symbol"
-msgid "cg"
-msgstr "cg"
-
-#: mass.cpp:118
-msgctxt "unit description in lists"
-msgid "centigrams"
-msgstr ""
-
-#: mass.cpp:119
-msgctxt "unit synonyms for matching user input"
-msgid "centigram;centigrams;cg"
-msgstr ""
-
-#: mass.cpp:120
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 centigrams"
-msgstr ""
-
-#: mass.cpp:121
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 centigram"
-msgid_plural "%1 centigrams"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:124
-msgctxt "mass unit symbol"
-msgid "mg"
-msgstr "mg"
-
-#: mass.cpp:125
-msgctxt "unit description in lists"
-msgid "milligrams"
-msgstr ""
-
-#: mass.cpp:126
-msgctxt "unit synonyms for matching user input"
-msgid "milligram;milligrams;mg"
-msgstr ""
-
-#: mass.cpp:127
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 milligrams"
-msgstr ""
-
-#: mass.cpp:128
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 milligram"
-msgid_plural "%1 milligrams"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:131
-msgctxt "mass unit symbol"
-msgid "µg"
-msgstr "µg"
-
-#: mass.cpp:132
-msgctxt "unit description in lists"
-msgid "micrograms"
-msgstr ""
-
-#: mass.cpp:133
-msgctxt "unit synonyms for matching user input"
-msgid "microgram;micrograms;µg;ug"
-msgstr ""
-
-#: mass.cpp:134
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 micrograms"
-msgstr ""
-
-#: mass.cpp:135
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 microgram"
-msgid_plural "%1 micrograms"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:138
-msgctxt "mass unit symbol"
-msgid "ng"
-msgstr "ng"
-
-#: mass.cpp:139
-msgctxt "unit description in lists"
-msgid "nanograms"
-msgstr ""
-
-#: mass.cpp:140
-msgctxt "unit synonyms for matching user input"
-msgid "nanogram;nanograms;ng"
-msgstr ""
-
-#: mass.cpp:141
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 nanograms"
-msgstr ""
-
-#: mass.cpp:142
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 nanogram"
-msgid_plural "%1 nanograms"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:145
-msgctxt "mass unit symbol"
-msgid "pg"
-msgstr "pg"
-
-#: mass.cpp:146
-msgctxt "unit description in lists"
-msgid "picograms"
-msgstr ""
-
-#: mass.cpp:147
-msgctxt "unit synonyms for matching user input"
-msgid "picogram;picograms;pg"
-msgstr ""
-
-#: mass.cpp:148
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 picograms"
-msgstr ""
-
-#: mass.cpp:149
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 picogram"
-msgid_plural "%1 picograms"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:152
-msgctxt "mass unit symbol"
-msgid "fg"
-msgstr "fg"
-
-#: mass.cpp:153
-msgctxt "unit description in lists"
-msgid "femtograms"
-msgstr ""
-
-#: mass.cpp:154
-msgctxt "unit synonyms for matching user input"
-msgid "femtogram;femtograms;fg"
-msgstr ""
-
-#: mass.cpp:155
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 femtograms"
-msgstr ""
-
-#: mass.cpp:156
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 femtogram"
-msgid_plural "%1 femtograms"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:159
-msgctxt "mass unit symbol"
-msgid "ag"
-msgstr "ag"
-
-#: mass.cpp:160
-msgctxt "unit description in lists"
-msgid "attograms"
-msgstr ""
-
-#: mass.cpp:161
-msgctxt "unit synonyms for matching user input"
-msgid "attogram;attograms;ag"
-msgstr ""
-
-#: mass.cpp:162
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 attograms"
-msgstr ""
-
-#: mass.cpp:163
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 attogram"
-msgid_plural "%1 attograms"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:166
-msgctxt "mass unit symbol"
-msgid "zg"
-msgstr "zg"
-
-#: mass.cpp:167
-msgctxt "unit description in lists"
-msgid "zeptograms"
-msgstr ""
-
-#: mass.cpp:168
-msgctxt "unit synonyms for matching user input"
-msgid "zeptogram;zeptograms;zg"
-msgstr ""
-
-#: mass.cpp:169
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 zeptograms"
-msgstr ""
-
-#: mass.cpp:170
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 zeptogram"
-msgid_plural "%1 zeptograms"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:173
-msgctxt "mass unit symbol"
-msgid "yg"
-msgstr "yg"
-
-#: mass.cpp:174
-msgctxt "unit description in lists"
-msgid "yoctograms"
-msgstr ""
-
-#: mass.cpp:175
-msgctxt "unit synonyms for matching user input"
-msgid "yoctogram;yoctograms;yg"
-msgstr ""
-
-#: mass.cpp:176
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 yoctograms"
-msgstr ""
-
-#: mass.cpp:177
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 yoctogram"
-msgid_plural "%1 yoctograms"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:180
-msgctxt "mass unit symbol"
-msgid "t"
-msgstr "t"
-
-#: mass.cpp:181
-msgctxt "unit description in lists"
-msgid "tons"
-msgstr ""
-
-#: mass.cpp:182
-msgctxt "unit synonyms for matching user input"
-msgid "ton;tons;t;tonne"
-msgstr ""
-
-#: mass.cpp:183
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 tons"
-msgstr ""
-
-#: mass.cpp:184
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 ton"
-msgid_plural "%1 tons"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:188
-msgctxt "mass unit symbol"
-msgid "CD"
-msgstr "CD"
-
-#: mass.cpp:189
-msgctxt "unit description in lists"
-msgid "carats"
-msgstr ""
-
-#: mass.cpp:190
-msgctxt "unit synonyms for matching user input"
-msgid "carat;carats;CD"
-msgstr ""
-
-#: mass.cpp:191
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 carats"
-msgstr ""
-
-#: mass.cpp:192
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 carat"
-msgid_plural "%1 carats"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:196
-msgctxt "mass unit symbol"
-msgid "lb"
-msgstr "lb"
-
-#: mass.cpp:197
-msgctxt "unit description in lists"
-msgid "pounds"
-msgstr ""
-
-#: mass.cpp:198
-msgctxt "unit synonyms for matching user input"
-msgid "pound;pounds;lb"
-msgstr ""
-
-#: mass.cpp:199
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 pounds"
-msgstr ""
-
-#: mass.cpp:200
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 pound"
-msgid_plural "%1 pounds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:204
-msgctxt "mass unit symbol"
-msgid "oz"
-msgstr "oz"
-
-#: mass.cpp:205
-msgctxt "unit description in lists"
-msgid "ounces"
-msgstr ""
-
-#: mass.cpp:206
-msgctxt "unit synonyms for matching user input"
-msgid "ounce;ounces;oz"
-msgstr ""
-
-#: mass.cpp:207
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 ounces"
-msgstr ""
-
-#: mass.cpp:208
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 ounce"
-msgid_plural "%1 ounces"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:211
-msgctxt "mass unit symbol"
-msgid "t oz"
-msgstr ""
-
-#: mass.cpp:212
-msgctxt "unit description in lists"
-msgid "troy ounces"
-msgstr ""
-
-#: mass.cpp:213
-msgctxt "unit synonyms for matching user input"
-msgid "troy ounce;troy ounces;t oz"
-msgstr ""
-
-#: mass.cpp:214
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 troy ounces"
-msgstr ""
-
-#: mass.cpp:215
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 troy ounce"
-msgid_plural "%1 troy ounces"
-msgstr[0] ""
-msgstr[1] ""
-
-#: mass.cpp:218
-msgctxt "mass unit symbol"
-msgid "N"
-msgstr "N"
-
-#: mass.cpp:226
-msgctxt "mass unit symbol"
-msgid "kN"
-msgstr "kN"
-
-#: mass.cpp:227
-msgctxt "unit description in lists"
-msgid "kilonewton"
-msgstr ""
-
-#: mass.cpp:228
-msgctxt "unit synonyms for matching user input"
-msgid "kilonewton;kilonewton;kN"
-msgstr ""
-
-#: mass.cpp:229
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 kilonewton"
-msgstr ""
-
-#: power.cpp:28
-msgid "Power"
-msgstr "Snaga"
-
-#: power.cpp:29
-#, kde-format
-msgctxt "%1 value, %2 unit symbol (power)"
-msgid "%1 %2"
-msgstr "%1 %2"
-
-#: power.cpp:32
-msgctxt "power unit symbol"
-msgid "YW"
-msgstr "YW"
-
-#: power.cpp:33
-msgctxt "unit description in lists"
-msgid "yottawatts"
-msgstr ""
-
-#: power.cpp:34
-msgctxt "unit synonyms for matching user input"
-msgid "yottawatt;yottawatts;YW"
-msgstr ""
-
-#: power.cpp:35
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 yottawatts"
-msgstr ""
-
-#: power.cpp:36
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 yottawatt"
-msgid_plural "%1 yottawatts"
-msgstr[0] ""
-msgstr[1] ""
-
-#: power.cpp:39
-msgctxt "power unit symbol"
-msgid "ZW"
-msgstr "ZW"
-
-#: power.cpp:40
-msgctxt "unit description in lists"
-msgid "zettawatts"
-msgstr ""
-
-#: power.cpp:41
-msgctxt "unit synonyms for matching user input"
-msgid "zettawatt;zettawatts;ZW"
-msgstr ""
-
-#: power.cpp:42
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 zettawatts"
-msgstr ""
-
-#: power.cpp:43
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 zettawatt"
-msgid_plural "%1 zettawatts"
-msgstr[0] ""
-msgstr[1] ""
-
-#: power.cpp:46
-msgctxt "power unit symbol"
-msgid "EW"
-msgstr "EW"
-
-#: power.cpp:47
-msgctxt "unit description in lists"
-msgid "exawatts"
-msgstr ""
-
-#: power.cpp:48
-msgctxt "unit synonyms for matching user input"
-msgid "exawatt;exawatts;EW"
-msgstr ""
-
-#: power.cpp:49
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 exawatts"
-msgstr ""
-
-#: power.cpp:50
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 exawatt"
-msgid_plural "%1 exawatts"
-msgstr[0] ""
-msgstr[1] ""
-
-#: power.cpp:53
-msgctxt "power unit symbol"
-msgid "PW"
-msgstr "PW"
-
-#: power.cpp:54
-msgctxt "unit description in lists"
-msgid "petawatts"
-msgstr ""
-
-#: power.cpp:55
-msgctxt "unit synonyms for matching user input"
-msgid "petawatt;petawatts;PW"
-msgstr ""
-
-#: power.cpp:56
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 petawatts"
-msgstr ""
-
-#: power.cpp:57
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 petawatt"
-msgid_plural "%1 petawatts"
-msgstr[0] ""
-msgstr[1] ""
-
-#: power.cpp:60
-msgctxt "power unit symbol"
-msgid "TW"
-msgstr "TW"
-
-#: power.cpp:61
-msgctxt "unit description in lists"
-msgid "terawatts"
-msgstr ""
-
-#: power.cpp:62
-msgctxt "unit synonyms for matching user input"
-msgid "terawatt;terawatts;TW"
-msgstr ""
-
-#: power.cpp:63
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 terawatts"
-msgstr ""
-
-#: power.cpp:64
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 terawatt"
-msgid_plural "%1 terawatts"
-msgstr[0] ""
-msgstr[1] ""
-
-#: power.cpp:67
-msgctxt "power unit symbol"
-msgid "GW"
-msgstr "GW"
-
-#: power.cpp:68
-msgctxt "unit description in lists"
-msgid "gigawatts"
-msgstr ""
-
-#: power.cpp:69
-msgctxt "unit synonyms for matching user input"
-msgid "gigawatt;gigawatts;GW"
-msgstr ""
-
-#: power.cpp:70
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 gigawatts"
-msgstr ""
-
-#: power.cpp:71
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 gigawatt"
-msgid_plural "%1 gigawatts"
-msgstr[0] ""
-msgstr[1] ""
-
-#: power.cpp:74
-msgctxt "power unit symbol"
-msgid "MW"
-msgstr "MW"
-
-#: power.cpp:75
-msgctxt "unit description in lists"
-msgid "megawatts"
-msgstr ""
-
-#: power.cpp:76
-msgctxt "unit synonyms for matching user input"
-msgid "megawatt;megawatts;MW"
-msgstr ""
-
-#: power.cpp:77
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 megawatts"
-msgstr ""
-
-#: power.cpp:78
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 megawatt"
-msgid_plural "%1 megawatts"
-msgstr[0] ""
-msgstr[1] ""
-
-#: power.cpp:81
-msgctxt "power unit symbol"
-msgid "kW"
-msgstr "kW"
-
-#: power.cpp:82
-msgctxt "unit description in lists"
-msgid "kilowatts"
-msgstr ""
-
-#: power.cpp:83
-msgctxt "unit synonyms for matching user input"
-msgid "kilowatt;kilowatts;kW"
-msgstr ""
-
-#: power.cpp:84
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 kilowatts"
-msgstr ""
-
-#: power.cpp:85
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 kilowatt"
-msgid_plural "%1 kilowatts"
-msgstr[0] ""
-msgstr[1] ""
-
-#: power.cpp:88
-msgctxt "power unit symbol"
-msgid "hW"
-msgstr "hW"
-
-#: power.cpp:89
-msgctxt "unit description in lists"
-msgid "hectowatts"
-msgstr ""
-
-#: power.cpp:90
-msgctxt "unit synonyms for matching user input"
-msgid "hectowatt;hectowatts;hW"
-msgstr ""
-
-#: power.cpp:91
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 hectowatts"
-msgstr ""
-
-#: power.cpp:92
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 hectowatt"
-msgid_plural "%1 hectowatts"
-msgstr[0] ""
-msgstr[1] ""
-
-#: power.cpp:95
-msgctxt "power unit symbol"
-msgid "daW"
-msgstr "daW"
-
-#: power.cpp:96
-msgctxt "unit description in lists"
-msgid "decawatts"
-msgstr ""
-
-#: power.cpp:97
-msgctxt "unit synonyms for matching user input"
-msgid "decawatt;decawatts;daW"
-msgstr ""
-
-#: power.cpp:98
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 decawatts"
-msgstr ""
-
-#: power.cpp:99
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 decawatt"
-msgid_plural "%1 decawatts"
-msgstr[0] ""
-msgstr[1] ""
-
-#: power.cpp:102
-msgctxt "power unit symbol"
-msgid "W"
-msgstr "W"
-
-#: power.cpp:103
-msgctxt "unit description in lists"
-msgid "watts"
-msgstr ""
-
-#: power.cpp:104
-msgctxt "unit synonyms for matching user input"
-msgid "watt;watts;W"
-msgstr ""
-
-#: power.cpp:105
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 watts"
-msgstr ""
-
-#: power.cpp:106
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 watt"
-msgid_plural "%1 watts"
-msgstr[0] ""
-msgstr[1] ""
-
-#: power.cpp:109
-msgctxt "power unit symbol"
-msgid "dW"
-msgstr "dW"
-
-#: power.cpp:110
-msgctxt "unit description in lists"
-msgid "deciwatts"
-msgstr ""
-
-#: power.cpp:111
-msgctxt "unit synonyms for matching user input"
-msgid "deciwatt;deciwatts;dW"
-msgstr ""
-
-#: power.cpp:112
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 deciwatts"
-msgstr ""
-
-#: power.cpp:113
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 deciwatt"
-msgid_plural "%1 deciwatts"
-msgstr[0] ""
-msgstr[1] ""
-
-#: power.cpp:116
-msgctxt "power unit symbol"
-msgid "cW"
-msgstr "cW"
-
-#: power.cpp:117
-msgctxt "unit description in lists"
-msgid "centiwatts"
-msgstr ""
-
-#: power.cpp:118
-msgctxt "unit synonyms for matching user input"
-msgid "centiwatt;centiwatts;cW"
-msgstr ""
-
-#: power.cpp:119
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 centiwatts"
-msgstr ""
-
-#: power.cpp:120
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 centiwatt"
-msgid_plural "%1 centiwatts"
-msgstr[0] ""
-msgstr[1] ""
-
-#: power.cpp:123
-msgctxt "power unit symbol"
-msgid "mW"
-msgstr "mW"
-
-#: power.cpp:124
-msgctxt "unit description in lists"
-msgid "milliwatts"
-msgstr ""
-
-#: power.cpp:125
-msgctxt "unit synonyms for matching user input"
-msgid "milliwatt;milliwatts;mW"
-msgstr ""
-
-#: power.cpp:126
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 milliwatts"
-msgstr ""
-
-#: power.cpp:127
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 milliwatt"
-msgid_plural "%1 milliwatts"
-msgstr[0] ""
-msgstr[1] ""
-
-#: power.cpp:130
-msgctxt "power unit symbol"
-msgid "µW"
-msgstr "µW"
-
-#: power.cpp:131
-msgctxt "unit description in lists"
-msgid "microwatts"
-msgstr ""
-
-#: power.cpp:132
-msgctxt "unit synonyms for matching user input"
-msgid "microwatt;microwatts;µW;uW"
-msgstr ""
-
-#: power.cpp:133
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 microwatts"
-msgstr ""
-
-#: power.cpp:134
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 microwatt"
-msgid_plural "%1 microwatts"
-msgstr[0] ""
-msgstr[1] ""
-
-#: power.cpp:137
-msgctxt "power unit symbol"
-msgid "nW"
-msgstr "nW"
-
-#: power.cpp:138
-msgctxt "unit description in lists"
-msgid "nanowatts"
-msgstr ""
-
-#: power.cpp:139
-msgctxt "unit synonyms for matching user input"
-msgid "nanowatt;nanowatts;nW"
-msgstr ""
-
-#: power.cpp:140
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 nanowatts"
-msgstr ""
-
-#: power.cpp:141
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 nanowatt"
-msgid_plural "%1 nanowatts"
-msgstr[0] ""
-msgstr[1] ""
-
-#: power.cpp:144
-msgctxt "power unit symbol"
-msgid "pW"
-msgstr "pW"
-
-#: power.cpp:145
-msgctxt "unit description in lists"
-msgid "picowatts"
-msgstr ""
-
-#: power.cpp:146
-msgctxt "unit synonyms for matching user input"
-msgid "picowatt;picowatts;pW"
-msgstr ""
-
-#: power.cpp:147
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 picowatts"
-msgstr ""
-
-#: power.cpp:148
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 picowatt"
-msgid_plural "%1 picowatts"
-msgstr[0] ""
-msgstr[1] ""
-
-#: power.cpp:151
-msgctxt "power unit symbol"
-msgid "fW"
-msgstr "fW"
-
-#: power.cpp:152
-msgctxt "unit description in lists"
-msgid "femtowatts"
-msgstr ""
-
-#: power.cpp:153
-msgctxt "unit synonyms for matching user input"
-msgid "femtowatt;femtowatts;fW"
-msgstr ""
-
-#: power.cpp:154
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 femtowatts"
-msgstr ""
-
-#: power.cpp:155
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 femtowatt"
-msgid_plural "%1 femtowatts"
-msgstr[0] ""
-msgstr[1] ""
-
-#: power.cpp:158
-msgctxt "power unit symbol"
-msgid "aW"
-msgstr "aW"
-
-#: power.cpp:159
-msgctxt "unit description in lists"
-msgid "attowatts"
-msgstr ""
-
-#: power.cpp:160
-msgctxt "unit synonyms for matching user input"
-msgid "attowatt;attowatts;aW"
-msgstr ""
-
-#: power.cpp:161
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 attowatts"
-msgstr ""
-
-#: power.cpp:162
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 attowatt"
-msgid_plural "%1 attowatts"
-msgstr[0] ""
-msgstr[1] ""
-
-#: power.cpp:165
-msgctxt "power unit symbol"
-msgid "zW"
-msgstr "zW"
-
-#: power.cpp:166
-msgctxt "unit description in lists"
-msgid "zeptowatts"
-msgstr ""
-
-#: power.cpp:167
-msgctxt "unit synonyms for matching user input"
-msgid "zeptowatt;zeptowatts;zW"
-msgstr ""
-
-#: power.cpp:168
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 zeptowatts"
-msgstr ""
-
-#: power.cpp:169
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 zeptowatt"
-msgid_plural "%1 zeptowatts"
-msgstr[0] ""
-msgstr[1] ""
-
-#: power.cpp:172
-msgctxt "power unit symbol"
-msgid "yW"
-msgstr "yW"
-
-#: power.cpp:173
-msgctxt "unit description in lists"
-msgid "yoctowatts"
-msgstr ""
-
-#: power.cpp:174
-msgctxt "unit synonyms for matching user input"
-msgid "yoctowatt;yoctowatts;yW"
-msgstr ""
-
-#: power.cpp:175
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 yoctowatts"
-msgstr ""
-
-#: power.cpp:176
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 yoctowatt"
-msgid_plural "%1 yoctowatts"
-msgstr[0] ""
-msgstr[1] ""
-
-#: power.cpp:179
-msgctxt "power unit symbol"
-msgid "hp"
-msgstr "hp"
-
-#: power.cpp:180
-msgctxt "unit description in lists"
-msgid "horsepowers"
-msgstr ""
-
-#: power.cpp:181
-msgctxt "unit synonyms for matching user input"
-msgid "horsepower;horsepowers;hp"
-msgstr ""
-
-#: power.cpp:182
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 horsepowers"
-msgstr ""
-
-#: power.cpp:183
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 horsepower"
-msgid_plural "%1 horsepowers"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:28
-msgid "Pressure"
-msgstr "Pritisak"
-
-#: pressure.cpp:29
-#, kde-format
-msgctxt "%1 value, %2 unit symbol (pressure)"
-msgid "%1 %2"
-msgstr "%1 %2"
-
-#: pressure.cpp:32
-msgctxt "pressure unit symbol"
-msgid "YPa"
-msgstr "YPa"
-
-#: pressure.cpp:33
-msgctxt "unit description in lists"
-msgid "yottapascals"
-msgstr ""
-
-#: pressure.cpp:34
-msgctxt "unit synonyms for matching user input"
-msgid "yottapascal;yottapascals;YPa"
-msgstr ""
-
-#: pressure.cpp:35
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 yottapascals"
-msgstr ""
-
-#: pressure.cpp:36
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 yottapascal"
-msgid_plural "%1 yottapascals"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:39
-msgctxt "pressure unit symbol"
-msgid "ZPa"
-msgstr "ZPa"
-
-#: pressure.cpp:40
-msgctxt "unit description in lists"
-msgid "zettapascals"
-msgstr ""
-
-#: pressure.cpp:41
-msgctxt "unit synonyms for matching user input"
-msgid "zettapascal;zettapascals;ZPa"
-msgstr ""
-
-#: pressure.cpp:42
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 zettapascals"
-msgstr ""
-
-#: pressure.cpp:43
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 zettapascal"
-msgid_plural "%1 zettapascals"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:46
-msgctxt "pressure unit symbol"
-msgid "EPa"
-msgstr "EPa"
-
-#: pressure.cpp:47
-msgctxt "unit description in lists"
-msgid "exapascals"
-msgstr ""
-
-#: pressure.cpp:48
-msgctxt "unit synonyms for matching user input"
-msgid "exapascal;exapascals;EPa"
-msgstr ""
-
-#: pressure.cpp:49
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 exapascals"
-msgstr ""
-
-#: pressure.cpp:50
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 exapascal"
-msgid_plural "%1 exapascals"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:53
-msgctxt "pressure unit symbol"
-msgid "PPa"
-msgstr "PPa"
-
-#: pressure.cpp:54
-msgctxt "unit description in lists"
-msgid "petapascals"
-msgstr ""
-
-#: pressure.cpp:55
-msgctxt "unit synonyms for matching user input"
-msgid "petapascal;petapascals;PPa"
-msgstr ""
-
-#: pressure.cpp:56
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 petapascals"
-msgstr ""
-
-#: pressure.cpp:57
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 petapascal"
-msgid_plural "%1 petapascals"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:60
-msgctxt "pressure unit symbol"
-msgid "TPa"
-msgstr "TPa"
-
-#: pressure.cpp:61
-msgctxt "unit description in lists"
-msgid "terapascals"
-msgstr ""
-
-#: pressure.cpp:62
-msgctxt "unit synonyms for matching user input"
-msgid "terapascal;terapascals;TPa"
-msgstr ""
-
-#: pressure.cpp:63
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 terapascals"
-msgstr ""
-
-#: pressure.cpp:64
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 terapascal"
-msgid_plural "%1 terapascals"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:67
-msgctxt "pressure unit symbol"
-msgid "GPa"
-msgstr "GPa"
-
-#: pressure.cpp:68
-msgctxt "unit description in lists"
-msgid "gigapascals"
-msgstr ""
-
-#: pressure.cpp:69
-msgctxt "unit synonyms for matching user input"
-msgid "gigapascal;gigapascals;GPa"
-msgstr ""
-
-#: pressure.cpp:70
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 gigapascals"
-msgstr ""
-
-#: pressure.cpp:71
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 gigapascal"
-msgid_plural "%1 gigapascals"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:74
-msgctxt "pressure unit symbol"
-msgid "MPa"
-msgstr "MPa"
-
-#: pressure.cpp:75
-msgctxt "unit description in lists"
-msgid "megapascals"
-msgstr ""
-
-#: pressure.cpp:76
-msgctxt "unit synonyms for matching user input"
-msgid "megapascal;megapascals;MPa"
-msgstr ""
-
-#: pressure.cpp:77
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 megapascals"
-msgstr ""
-
-#: pressure.cpp:78
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 megapascal"
-msgid_plural "%1 megapascals"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:81
-msgctxt "pressure unit symbol"
-msgid "kPa"
-msgstr "kPa"
-
-#: pressure.cpp:82
-msgctxt "unit description in lists"
-msgid "kilopascals"
-msgstr ""
-
-#: pressure.cpp:83
-msgctxt "unit synonyms for matching user input"
-msgid "kilopascal;kilopascals;kPa"
-msgstr ""
-
-#: pressure.cpp:84
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 kilopascals"
-msgstr ""
-
-#: pressure.cpp:85
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 kilopascal"
-msgid_plural "%1 kilopascals"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:88
-msgctxt "pressure unit symbol"
-msgid "hPa"
-msgstr "hPa"
-
-#: pressure.cpp:89
-msgctxt "unit description in lists"
-msgid "hectopascals"
-msgstr ""
-
-#: pressure.cpp:90
-msgctxt "unit synonyms for matching user input"
-msgid "hectopascal;hectopascals;hPa"
-msgstr ""
-
-#: pressure.cpp:91
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 hectopascals"
-msgstr ""
-
-#: pressure.cpp:92
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 hectopascal"
-msgid_plural "%1 hectopascals"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:95
-msgctxt "pressure unit symbol"
-msgid "daPa"
-msgstr "daPa"
-
-#: pressure.cpp:96
-msgctxt "unit description in lists"
-msgid "decapascals"
-msgstr ""
-
-#: pressure.cpp:97
-msgctxt "unit synonyms for matching user input"
-msgid "decapascal;decapascals;daPa"
-msgstr ""
-
-#: pressure.cpp:98
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 decapascals"
-msgstr ""
-
-#: pressure.cpp:99
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 decapascal"
-msgid_plural "%1 decapascals"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:102
-msgctxt "pressure unit symbol"
-msgid "Pa"
-msgstr "Pa"
-
-#: pressure.cpp:103
-msgctxt "unit description in lists"
-msgid "pascals"
-msgstr ""
-
-#: pressure.cpp:104
-msgctxt "unit synonyms for matching user input"
-msgid "pascal;pascals;Pa"
-msgstr ""
-
-#: pressure.cpp:105
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 pascals"
-msgstr ""
-
-#: pressure.cpp:106
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 pascal"
-msgid_plural "%1 pascals"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:109
-msgctxt "pressure unit symbol"
-msgid "dPa"
-msgstr "dPa"
-
-#: pressure.cpp:110
-msgctxt "unit description in lists"
-msgid "decipascals"
-msgstr ""
-
-#: pressure.cpp:111
-msgctxt "unit synonyms for matching user input"
-msgid "decipascal;decipascals;dPa"
-msgstr ""
-
-#: pressure.cpp:112
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 decipascals"
-msgstr ""
-
-#: pressure.cpp:113
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 decipascal"
-msgid_plural "%1 decipascals"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:116
-msgctxt "pressure unit symbol"
-msgid "cPa"
-msgstr "cPa"
-
-#: pressure.cpp:117
-msgctxt "unit description in lists"
-msgid "centipascals"
-msgstr ""
-
-#: pressure.cpp:118
-msgctxt "unit synonyms for matching user input"
-msgid "centipascal;centipascals;cPa"
-msgstr ""
-
-#: pressure.cpp:119
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 centipascals"
-msgstr ""
-
-#: pressure.cpp:120
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 centipascal"
-msgid_plural "%1 centipascals"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:123
-msgctxt "pressure unit symbol"
-msgid "mPa"
-msgstr "mPa"
-
-#: pressure.cpp:124
-msgctxt "unit description in lists"
-msgid "millipascals"
-msgstr ""
-
-#: pressure.cpp:125
-msgctxt "unit synonyms for matching user input"
-msgid "millipascal;millipascals;mPa"
-msgstr ""
-
-#: pressure.cpp:126
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 millipascals"
-msgstr ""
-
-#: pressure.cpp:127
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 millipascal"
-msgid_plural "%1 millipascals"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:130
-msgctxt "pressure unit symbol"
-msgid "µPa"
-msgstr "µPa"
-
-#: pressure.cpp:131
-msgctxt "unit description in lists"
-msgid "micropascals"
-msgstr ""
-
-#: pressure.cpp:132
-msgctxt "unit synonyms for matching user input"
-msgid "micropascal;micropascals;µPa;uPa"
-msgstr ""
-
-#: pressure.cpp:133
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 micropascals"
-msgstr ""
-
-#: pressure.cpp:134
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 micropascal"
-msgid_plural "%1 micropascals"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:137
-msgctxt "pressure unit symbol"
-msgid "nPa"
-msgstr "nPa"
-
-#: pressure.cpp:138
-msgctxt "unit description in lists"
-msgid "nanopascals"
-msgstr ""
-
-#: pressure.cpp:139
-msgctxt "unit synonyms for matching user input"
-msgid "nanopascal;nanopascals;nPa"
-msgstr ""
-
-#: pressure.cpp:140
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 nanopascals"
-msgstr ""
-
-#: pressure.cpp:141
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 nanopascal"
-msgid_plural "%1 nanopascals"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:144
-msgctxt "pressure unit symbol"
-msgid "pPa"
-msgstr "pPa"
-
-#: pressure.cpp:145
-msgctxt "unit description in lists"
-msgid "picopascals"
-msgstr ""
-
-#: pressure.cpp:146
-msgctxt "unit synonyms for matching user input"
-msgid "picopascal;picopascals;pPa"
-msgstr ""
-
-#: pressure.cpp:147
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 picopascals"
-msgstr ""
-
-#: pressure.cpp:148
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 picopascal"
-msgid_plural "%1 picopascals"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:151
-msgctxt "pressure unit symbol"
-msgid "fPa"
-msgstr "fPa"
-
-#: pressure.cpp:152
-msgctxt "unit description in lists"
-msgid "femtopascals"
-msgstr ""
-
-#: pressure.cpp:153
-msgctxt "unit synonyms for matching user input"
-msgid "femtopascal;femtopascals;fPa"
-msgstr ""
-
-#: pressure.cpp:154
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 femtopascals"
-msgstr ""
-
-#: pressure.cpp:155
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 femtopascal"
-msgid_plural "%1 femtopascals"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:158
-msgctxt "pressure unit symbol"
-msgid "aPa"
-msgstr "aPa"
-
-#: pressure.cpp:159
-msgctxt "unit description in lists"
-msgid "attopascals"
-msgstr ""
-
-#: pressure.cpp:160
-msgctxt "unit synonyms for matching user input"
-msgid "attopascal;attopascals;aPa"
-msgstr ""
-
-#: pressure.cpp:161
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 attopascals"
-msgstr ""
-
-#: pressure.cpp:162
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 attopascal"
-msgid_plural "%1 attopascals"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:165
-msgctxt "pressure unit symbol"
-msgid "zPa"
-msgstr "zPa"
-
-#: pressure.cpp:166
-msgctxt "unit description in lists"
-msgid "zeptopascals"
-msgstr ""
-
-#: pressure.cpp:167
-msgctxt "unit synonyms for matching user input"
-msgid "zeptopascal;zeptopascals;zPa"
-msgstr ""
-
-#: pressure.cpp:168
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 zeptopascals"
-msgstr ""
-
-#: pressure.cpp:169
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 zeptopascal"
-msgid_plural "%1 zeptopascals"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:172
-msgctxt "pressure unit symbol"
-msgid "yPa"
-msgstr "yPa"
-
-#: pressure.cpp:173
-msgctxt "unit description in lists"
-msgid "yoctopascals"
-msgstr ""
-
-#: pressure.cpp:174
-msgctxt "unit synonyms for matching user input"
-msgid "yoctopascal;yoctopascals;yPa"
-msgstr ""
-
-#: pressure.cpp:175
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 yoctopascals"
-msgstr ""
-
-#: pressure.cpp:176
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 yoctopascal"
-msgid_plural "%1 yoctopascals"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:179
-msgctxt "pressure unit symbol"
-msgid "bar"
-msgstr "bar"
-
-#: pressure.cpp:180
-msgctxt "unit description in lists"
-msgid "bars"
-msgstr "bari"
-
-#: pressure.cpp:181
-msgctxt "unit synonyms for matching user input"
-msgid "bar;bars;bar"
-msgstr ""
-
-#: pressure.cpp:182
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 bars"
-msgstr ""
-
-#: pressure.cpp:183
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 bar"
-msgid_plural "%1 bars"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:186
-msgctxt "pressure unit symbol"
-msgid "mbar"
-msgstr "mbar"
-
-#: pressure.cpp:187
-msgctxt "unit description in lists"
-msgid "millibars"
-msgstr "millibari"
-
-#: pressure.cpp:188
-msgctxt "unit synonyms for matching user input"
-msgid "millibar;millibars;mbar;mb"
-msgstr ""
-
-#: pressure.cpp:189
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 millibars"
-msgstr ""
-
-#: pressure.cpp:190
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 millibar"
-msgid_plural "%1 millibars"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:193
-msgctxt "pressure unit symbol"
-msgid "dbar"
-msgstr "dbar"
-
-#: pressure.cpp:194
-msgctxt "unit description in lists"
-msgid "decibars"
-msgstr "decibari"
-
-#: pressure.cpp:195
-msgctxt "unit synonyms for matching user input"
-msgid "decibar;decibars;dbar"
-msgstr ""
-
-#: pressure.cpp:196
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 decibars"
-msgstr ""
-
-#: pressure.cpp:197
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 decibar"
-msgid_plural "%1 decibars"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:200
-#, fuzzy
-#| msgctxt "pressure unit symbol"
-#| msgid "torr"
-msgctxt "pressure unit symbol"
-msgid "Torr"
-msgstr "torr"
-
-#: pressure.cpp:201
-#, fuzzy
-#| msgctxt "pressure unit symbol"
-#| msgid "torr"
-msgctxt "unit description in lists"
-msgid "Torr"
-msgstr "torr"
-
-#: pressure.cpp:202
-#, fuzzy
-#| msgctxt "pressure unit symbol"
-#| msgid "torr"
-msgctxt "unit synonyms for matching user input"
-msgid "Torr"
-msgstr "torr"
-
-#: pressure.cpp:203
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 tolar"
-#| msgid_plural "%1 tolars"
-msgctxt "amount in units (real)"
-msgid "%1 torr"
-msgstr "%1 tolar"
-
-#: pressure.cpp:204
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 torr"
-msgid_plural "%1 torr"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:207
-msgctxt "pressure unit symbol"
-msgid "at"
-msgstr "at"
-
-#: pressure.cpp:208
-msgctxt "unit description in lists"
-msgid "technical atmospheres"
-msgstr ""
-
-#: pressure.cpp:210
-msgctxt "unit synonyms for matching user input"
-msgid "technical atmosphere;technical atmospheres;at"
-msgstr ""
-
-#: pressure.cpp:211
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 technical atmospheres"
-msgstr ""
-
-#: pressure.cpp:212
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 technical atmosphere"
-msgid_plural "%1 technical atmospheres"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:215
-msgctxt "pressure unit symbol"
-msgid "atm"
-msgstr "atm"
-
-#: pressure.cpp:216
-msgctxt "unit description in lists"
-msgid "atmospheres"
-msgstr "atmosfere"
-
-#: pressure.cpp:217
-msgctxt "unit synonyms for matching user input"
-msgid "atmosphere;atmospheres;atm"
-msgstr "atmosfera;atmosfere;atm"
-
-#: pressure.cpp:218
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 atmospheres"
-msgstr ""
-
-#: pressure.cpp:219
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 atmosphere"
-msgid_plural "%1 atmospheres"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:222
-msgctxt "pressure unit symbol"
-msgid "psi"
-msgstr "psi"
-
-#: pressure.cpp:223
-msgctxt "unit description in lists"
-msgid "pound-force per square inch"
-msgstr ""
-
-#: pressure.cpp:225
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "ounce per cubic inch;ounces per cubic inch;oz/in³"
-msgctxt "unit synonyms for matching user input"
-msgid "pound-force per square inch;pound-force per square inches;psi"
-msgstr "unca po kubičnom inču;unci po kubičnom inču;oz/in³"
-
-#: pressure.cpp:226
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 ounce per cubic inch"
-#| msgid_plural "%1 ounces per cubic inch"
-msgctxt "amount in units (real)"
-msgid "%1 pound-force per square inches"
-msgstr "%1 unca po kubičnom inču"
-
-#: pressure.cpp:228
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 pound-force per square inch"
-msgid_plural "%1 pound-force per square inch"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:232
-msgctxt "pressure unit symbol"
-msgid "inHg"
-msgstr "inHg"
-
-#: pressure.cpp:233
-msgctxt "unit description in lists"
-msgid "inches of mercury"
-msgstr ""
-
-#: pressure.cpp:235
-msgctxt "unit synonyms for matching user input"
-msgid "inch of mercury;inches of mercury;inHg;in\""
-msgstr ""
-
-#: pressure.cpp:236
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 inches of mercury"
-msgstr ""
-
-#: pressure.cpp:237
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 inches of mercury"
-msgid_plural "%1 inches of mercury"
-msgstr[0] ""
-msgstr[1] ""
-
-#: pressure.cpp:241
-#, fuzzy
-#| msgctxt "length unit symbol"
-#| msgid "mm"
-msgctxt "pressure unit symbol"
-msgid "mmHg"
-msgstr "mm"
-
-#: pressure.cpp:242
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "millimeters"
-msgctxt "unit description in lists"
-msgid "millimeters of mercury"
-msgstr "milimetri"
-
-#: pressure.cpp:244
-msgctxt "unit synonyms for matching user input"
-msgid "millimeter of mercury;millimeters of mercury;mmHg"
-msgstr ""
-
-#: pressure.cpp:245
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 mile per hour"
-#| msgid_plural "%1 miles per hour"
-msgctxt "amount in units (real)"
-msgid "%1 millimeters of mercury"
-msgstr "%1 milja na sat"
-
-#: pressure.cpp:246
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 mile per hour"
-#| msgid_plural "%1 miles per hour"
-msgctxt "amount in units (integer)"
-msgid "%1 millimeters of mercury"
-msgid_plural "%1 millimeters of mercury"
-msgstr[0] "%1 milja na sat"
-msgstr[1] "%1 milje na sat"
-msgstr[2] "%1 milja na sat"
-
-#: temperature.cpp:65
-msgid "Temperature"
-msgstr "Temperatura"
-
-#: temperature.cpp:66
-#, kde-format
-msgctxt "%1 value, %2 unit symbol (temperature)"
-msgid "%1 %2"
-msgstr "%1 %2"
-
-#: temperature.cpp:69
-msgctxt "temperature unit symbol"
-msgid "K"
-msgstr "K"
-
-#: temperature.cpp:70
-msgctxt "unit description in lists"
-msgid "kelvins"
-msgstr "kelvini"
-
-#: temperature.cpp:71
-msgctxt "unit synonyms for matching user input"
-msgid "kelvin;kelvins;K"
-msgstr "kelvin;kelvina;K"
-
-#: temperature.cpp:72
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 kelvins"
-msgstr "%1 kelvina"
-
-#: temperature.cpp:73
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 kelvin"
-msgid_plural "%1 kelvins"
-msgstr[0] "%1 kelvin"
-msgstr[1] "%1 kelvina"
-msgstr[2] "%1 kelvina"
-
-#: temperature.cpp:76
-msgctxt "temperature unit symbol"
-msgid "°C"
-msgstr "°C"
-
-#: temperature.cpp:77
-msgctxt "unit description in lists"
-msgid "Celsius"
-msgstr ""
-
-#: temperature.cpp:78
-msgctxt "unit synonyms for matching user input"
-msgid "Celsius;°C;C"
-msgstr ""
-
-#: temperature.cpp:79
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 degrees Celsius"
-msgstr ""
-
-#: temperature.cpp:80
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 degree Celsius"
-msgid_plural "%1 degrees Celsius"
-msgstr[0] ""
-msgstr[1] ""
-msgstr[2] ""
-
-#: temperature.cpp:83
-msgctxt "temperature unit symbol"
-msgid "°F"
-msgstr "°F"
-
-#: temperature.cpp:84
-msgctxt "unit description in lists"
-msgid "Fahrenheit"
-msgstr ""
-
-#: temperature.cpp:85
-msgctxt "unit synonyms for matching user input"
-msgid "Fahrenheit;°F;F"
-msgstr ""
-
-#: temperature.cpp:86
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 degrees Fahrenheit"
-msgstr ""
-
-#: temperature.cpp:87
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 degree Fahrenheit"
-msgid_plural "%1 degrees Fahrenheit"
-msgstr[0] ""
-msgstr[1] ""
-msgstr[2] ""
-
-#: temperature.cpp:90
-msgctxt "temperature unit symbol"
-msgid "R"
-msgstr "°R"
-
-#: temperature.cpp:91
-#, fuzzy
-#| msgctxt "amount in units (real)"
-#| msgid "%1 miles"
-msgctxt "unit description in lists"
-msgid "Rankine"
-msgstr "%1 milje"
-
-#: temperature.cpp:92
-msgctxt "unit synonyms for matching user input"
-msgid "Rankine;°R;R;Ra"
-msgstr ""
-
-#: temperature.cpp:93
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 miles"
-msgctxt "amount in units (real)"
-msgid "%1 Rankine"
-msgstr "%1 milje"
-
-#: temperature.cpp:94
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 Rankine"
-msgid_plural "%1 Rankine"
-msgstr[0] ""
-msgstr[1] ""
-msgstr[2] ""
-
-#: temperature.cpp:97
-msgctxt "temperature unit symbol"
-msgid "°De"
-msgstr "°De"
-
-#: temperature.cpp:98
-msgctxt "unit description in lists"
-msgid "Delisle"
-msgstr ""
-
-#: temperature.cpp:99
-msgctxt "unit synonyms for matching user input"
-msgid "Delisle;°De;De"
-msgstr ""
-
-#: temperature.cpp:100
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 degrees Delisle"
-msgstr ""
-
-#: temperature.cpp:101
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 degree Delisle"
-msgid_plural "%1 degrees Delisle"
-msgstr[0] ""
-msgstr[1] ""
-msgstr[2] ""
-
-#: temperature.cpp:104
-msgctxt "temperature unit symbol"
-msgid "°N"
-msgstr "°N"
-
-#: temperature.cpp:105
-msgctxt "unit description in lists"
-msgid "Newton"
-msgstr ""
-
-#: temperature.cpp:106
-msgctxt "unit synonyms for matching user input"
-msgid "Newton;°N;N"
-msgstr ""
-
-#: temperature.cpp:107
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 degrees Newton"
-msgstr ""
-
-#: temperature.cpp:108
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 degree Newton"
-msgid_plural "%1 degrees Newton"
-msgstr[0] ""
-msgstr[1] ""
-msgstr[2] ""
-
-#: temperature.cpp:111
-msgctxt "temperature unit symbol"
-msgid "°Ré"
-msgstr "°Ré"
-
-#: temperature.cpp:112
-msgctxt "unit description in lists"
-msgid "Réaumur"
-msgstr ""
-
-#: temperature.cpp:113
-msgctxt "unit synonyms for matching user input"
-msgid "Réaumur;°Ré;Ré;Reaumur;°Re;Re"
-msgstr ""
-
-#: temperature.cpp:114
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 degrees Réaumur"
-msgstr ""
-
-#: temperature.cpp:115
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 degree Réaumur"
-msgid_plural "%1 degrees Réaumur"
-msgstr[0] ""
-msgstr[1] ""
-msgstr[2] ""
-
-#: temperature.cpp:118
-msgctxt "temperature unit symbol"
-msgid "°Rø"
-msgstr "°Rø"
-
-#: temperature.cpp:119
-msgctxt "unit description in lists"
-msgid "Rømer"
-msgstr ""
-
-#: temperature.cpp:120
-msgctxt "unit synonyms for matching user input"
-msgid "Rømer;°Rø;Rø;Romer;°Ro;Ro"
-msgstr ""
-
-#: temperature.cpp:121
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 degrees Rømer"
-msgstr ""
-
-#: temperature.cpp:122
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 degree Rømer"
-msgid_plural "%1 degrees Rømer"
-msgstr[0] ""
-msgstr[1] ""
-msgstr[2] ""
-
-#: timeunit.cpp:28
-msgid "Time"
-msgstr "Vrijeme"
-
-#: timeunit.cpp:29
-#, kde-format
-msgctxt "%1 value, %2 unit symbol (time)"
-msgid "%1 %2"
-msgstr " %1 %2"
-
-#: timeunit.cpp:32
-msgctxt "time unit symbol"
-msgid "Ys"
-msgstr "Ys"
-
-#: timeunit.cpp:33
-msgctxt "unit description in lists"
-msgid "yottaseconds"
-msgstr ""
-
-#: timeunit.cpp:34
-msgctxt "unit synonyms for matching user input"
-msgid "yottasecond;yottaseconds;Ys"
-msgstr ""
-
-#: timeunit.cpp:35
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 yottaseconds"
-msgstr ""
-
-#: timeunit.cpp:36
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 yottasecond"
-msgid_plural "%1 yottaseconds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:39
-msgctxt "time unit symbol"
-msgid "Zs"
-msgstr "Zs"
-
-#: timeunit.cpp:40
-msgctxt "unit description in lists"
-msgid "zettaseconds"
-msgstr ""
-
-#: timeunit.cpp:41
-msgctxt "unit synonyms for matching user input"
-msgid "zettasecond;zettaseconds;Zs"
-msgstr ""
-
-#: timeunit.cpp:42
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 zettaseconds"
-msgstr ""
-
-#: timeunit.cpp:43
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 zettasecond"
-msgid_plural "%1 zettaseconds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:46
-msgctxt "time unit symbol"
-msgid "Es"
-msgstr "Es"
-
-#: timeunit.cpp:47
-msgctxt "unit description in lists"
-msgid "exaseconds"
-msgstr ""
-
-#: timeunit.cpp:48
-msgctxt "unit synonyms for matching user input"
-msgid "exasecond;exaseconds;Es"
-msgstr ""
-
-#: timeunit.cpp:49
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 exaseconds"
-msgstr ""
-
-#: timeunit.cpp:50
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 exasecond"
-msgid_plural "%1 exaseconds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:53
-msgctxt "time unit symbol"
-msgid "Ps"
-msgstr "Ps"
-
-#: timeunit.cpp:54
-msgctxt "unit description in lists"
-msgid "petaseconds"
-msgstr ""
-
-#: timeunit.cpp:55
-msgctxt "unit synonyms for matching user input"
-msgid "petasecond;petaseconds;Ps"
-msgstr ""
-
-#: timeunit.cpp:56
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 petaseconds"
-msgstr ""
-
-#: timeunit.cpp:57
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 petasecond"
-msgid_plural "%1 petaseconds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:60
-msgctxt "time unit symbol"
-msgid "Ts"
-msgstr "Ts"
-
-#: timeunit.cpp:61
-msgctxt "unit description in lists"
-msgid "teraseconds"
-msgstr ""
-
-#: timeunit.cpp:62
-msgctxt "unit synonyms for matching user input"
-msgid "terasecond;teraseconds;Ts"
-msgstr ""
-
-#: timeunit.cpp:63
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 teraseconds"
-msgstr ""
-
-#: timeunit.cpp:64
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 terasecond"
-msgid_plural "%1 teraseconds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:67
-msgctxt "time unit symbol"
-msgid "Gs"
-msgstr "Gs"
-
-#: timeunit.cpp:68
-msgctxt "unit description in lists"
-msgid "gigaseconds"
-msgstr ""
-
-#: timeunit.cpp:69
-msgctxt "unit synonyms for matching user input"
-msgid "gigasecond;gigaseconds;Gs"
-msgstr ""
-
-#: timeunit.cpp:70
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 gigaseconds"
-msgstr ""
-
-#: timeunit.cpp:71
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 gigasecond"
-msgid_plural "%1 gigaseconds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:74
-msgctxt "time unit symbol"
-msgid "Ms"
-msgstr "Ms"
-
-#: timeunit.cpp:75
-msgctxt "unit description in lists"
-msgid "megaseconds"
-msgstr ""
-
-#: timeunit.cpp:76
-msgctxt "unit synonyms for matching user input"
-msgid "megasecond;megaseconds;Ms"
-msgstr ""
-
-#: timeunit.cpp:77
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 megaseconds"
-msgstr ""
-
-#: timeunit.cpp:78
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 megasecond"
-msgid_plural "%1 megaseconds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:81
-msgctxt "time unit symbol"
-msgid "ks"
-msgstr "ks"
-
-#: timeunit.cpp:82
-msgctxt "unit description in lists"
-msgid "kiloseconds"
-msgstr ""
-
-#: timeunit.cpp:83
-msgctxt "unit synonyms for matching user input"
-msgid "kilosecond;kiloseconds;ks"
-msgstr ""
-
-#: timeunit.cpp:84
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 kiloseconds"
-msgstr ""
-
-#: timeunit.cpp:85
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 kilosecond"
-msgid_plural "%1 kiloseconds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:88
-msgctxt "time unit symbol"
-msgid "hs"
-msgstr "hs"
-
-#: timeunit.cpp:89
-msgctxt "unit description in lists"
-msgid "hectoseconds"
-msgstr ""
-
-#: timeunit.cpp:90
-msgctxt "unit synonyms for matching user input"
-msgid "hectosecond;hectoseconds;hs"
-msgstr ""
-
-#: timeunit.cpp:91
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 hectoseconds"
-msgstr ""
-
-#: timeunit.cpp:92
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 hectosecond"
-msgid_plural "%1 hectoseconds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:95
-msgctxt "time unit symbol"
-msgid "das"
-msgstr "das"
-
-#: timeunit.cpp:96
-msgctxt "unit description in lists"
-msgid "decaseconds"
-msgstr ""
-
-#: timeunit.cpp:97
-msgctxt "unit synonyms for matching user input"
-msgid "decasecond;decaseconds;das"
-msgstr ""
-
-#: timeunit.cpp:98
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 decaseconds"
-msgstr ""
-
-#: timeunit.cpp:99
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 decasecond"
-msgid_plural "%1 decaseconds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:102
-msgctxt "time unit symbol"
-msgid "s"
-msgstr "s"
-
-#: timeunit.cpp:103
-msgctxt "unit description in lists"
-msgid "seconds"
-msgstr "sekunde"
-
-#: timeunit.cpp:104
-msgctxt "unit synonyms for matching user input"
-msgid "second;seconds;s"
-msgstr "sekunda;sekunde;s"
-
-#: timeunit.cpp:105
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 seconds"
-msgstr ""
-
-#: timeunit.cpp:106
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 second"
-msgid_plural "%1 seconds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:109
-msgctxt "time unit symbol"
-msgid "ds"
-msgstr "ds"
-
-#: timeunit.cpp:110
-msgctxt "unit description in lists"
-msgid "deciseconds"
-msgstr ""
-
-#: timeunit.cpp:111
-msgctxt "unit synonyms for matching user input"
-msgid "decisecond;deciseconds;ds"
-msgstr ""
-
-#: timeunit.cpp:112
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 deciseconds"
-msgstr ""
-
-#: timeunit.cpp:113
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 decisecond"
-msgid_plural "%1 deciseconds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:116
-msgctxt "time unit symbol"
-msgid "cs"
-msgstr "cs"
-
-#: timeunit.cpp:117
-msgctxt "unit description in lists"
-msgid "centiseconds"
-msgstr ""
-
-#: timeunit.cpp:118
-msgctxt "unit synonyms for matching user input"
-msgid "centisecond;centiseconds;cs"
-msgstr ""
-
-#: timeunit.cpp:119
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 centiseconds"
-msgstr ""
-
-#: timeunit.cpp:120
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 centisecond"
-msgid_plural "%1 centiseconds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:123
-msgctxt "time unit symbol"
-msgid "ms"
-msgstr "ms"
-
-#: timeunit.cpp:124
-msgctxt "unit description in lists"
-msgid "milliseconds"
-msgstr "milisekunde"
-
-#: timeunit.cpp:125
-msgctxt "unit synonyms for matching user input"
-msgid "millisecond;milliseconds;ms"
-msgstr "milisekunda;milisekunde;ms"
-
-#: timeunit.cpp:126
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 milliseconds"
-msgstr ""
-
-#: timeunit.cpp:127
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 millisecond"
-msgid_plural "%1 milliseconds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:130
-msgctxt "time unit symbol"
-msgid "µs"
-msgstr "µs"
-
-#: timeunit.cpp:131
-msgctxt "unit description in lists"
-msgid "microseconds"
-msgstr ""
-
-#: timeunit.cpp:132
-msgctxt "unit synonyms for matching user input"
-msgid "microsecond;microseconds;µs;us"
-msgstr ""
-
-#: timeunit.cpp:133
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 microseconds"
-msgstr ""
-
-#: timeunit.cpp:134
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 microsecond"
-msgid_plural "%1 microseconds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:137
-msgctxt "time unit symbol"
-msgid "ns"
-msgstr "ns"
-
-#: timeunit.cpp:138
-msgctxt "unit description in lists"
-msgid "nanoseconds"
-msgstr ""
-
-#: timeunit.cpp:139
-msgctxt "unit synonyms for matching user input"
-msgid "nanosecond;nanoseconds;ns"
-msgstr ""
-
-#: timeunit.cpp:140
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 nanoseconds"
-msgstr ""
-
-#: timeunit.cpp:141
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 nanosecond"
-msgid_plural "%1 nanoseconds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:144
-msgctxt "time unit symbol"
-msgid "ps"
-msgstr "ps"
-
-#: timeunit.cpp:145
-msgctxt "unit description in lists"
-msgid "picoseconds"
-msgstr ""
-
-#: timeunit.cpp:146
-msgctxt "unit synonyms for matching user input"
-msgid "picosecond;picoseconds;ps"
-msgstr ""
-
-#: timeunit.cpp:147
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 picoseconds"
-msgstr ""
-
-#: timeunit.cpp:148
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 picosecond"
-msgid_plural "%1 picoseconds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:151
-msgctxt "time unit symbol"
-msgid "fs"
-msgstr "fs"
-
-#: timeunit.cpp:152
-msgctxt "unit description in lists"
-msgid "femtoseconds"
-msgstr ""
-
-#: timeunit.cpp:153
-msgctxt "unit synonyms for matching user input"
-msgid "femtosecond;femtoseconds;fs"
-msgstr ""
-
-#: timeunit.cpp:154
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 femtoseconds"
-msgstr ""
-
-#: timeunit.cpp:155
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 femtosecond"
-msgid_plural "%1 femtoseconds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:158
-msgctxt "time unit symbol"
-msgid "as"
-msgstr "as"
-
-#: timeunit.cpp:159
-msgctxt "unit description in lists"
-msgid "attoseconds"
-msgstr ""
-
-#: timeunit.cpp:160
-msgctxt "unit synonyms for matching user input"
-msgid "attosecond;attoseconds;as"
-msgstr ""
-
-#: timeunit.cpp:161
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 attoseconds"
-msgstr ""
-
-#: timeunit.cpp:162
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 attosecond"
-msgid_plural "%1 attoseconds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:165
-msgctxt "time unit symbol"
-msgid "zs"
-msgstr "zs"
-
-#: timeunit.cpp:166
-msgctxt "unit description in lists"
-msgid "zeptoseconds"
-msgstr ""
-
-#: timeunit.cpp:167
-msgctxt "unit synonyms for matching user input"
-msgid "zeptosecond;zeptoseconds;zs"
-msgstr ""
-
-#: timeunit.cpp:168
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 zeptoseconds"
-msgstr ""
-
-#: timeunit.cpp:169
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 zeptosecond"
-msgid_plural "%1 zeptoseconds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:172
-msgctxt "time unit symbol"
-msgid "ys"
-msgstr "ys"
-
-#: timeunit.cpp:173
-msgctxt "unit description in lists"
-msgid "yoctoseconds"
-msgstr ""
-
-#: timeunit.cpp:174
-msgctxt "unit synonyms for matching user input"
-msgid "yoctosecond;yoctoseconds;ys"
-msgstr ""
-
-#: timeunit.cpp:175
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 yoctoseconds"
-msgstr ""
-
-#: timeunit.cpp:176
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 yoctosecond"
-msgid_plural "%1 yoctoseconds"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:179
-msgctxt "time unit symbol"
-msgid "min"
-msgstr "min"
-
-#: timeunit.cpp:180
-msgctxt "unit description in lists"
-msgid "minutes"
-msgstr "minute"
-
-#: timeunit.cpp:181
-msgctxt "unit synonyms for matching user input"
-msgid "minute;minutes;min"
-msgstr "minuta;minute;min"
-
-#: timeunit.cpp:182
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 minutes"
-msgstr ""
-
-#: timeunit.cpp:183
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 minute"
-msgid_plural "%1 minutes"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:186
-msgctxt "time unit symbol"
-msgid "h"
-msgstr ""
-
-#: timeunit.cpp:187
-msgctxt "unit description in lists"
-msgid "hours"
-msgstr "sati"
-
-#: timeunit.cpp:188
-msgctxt "unit synonyms for matching user input"
-msgid "hour;hours;h"
-msgstr ""
-
-#: timeunit.cpp:189
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 hours"
-msgstr ""
-
-#: timeunit.cpp:190
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 hour"
-msgid_plural "%1 hours"
-msgstr[0] "%1 sat"
-msgstr[1] "%1 sata"
-msgstr[2] "%1 sati"
-
-#: timeunit.cpp:193
-msgctxt "time unit symbol"
-msgid "d"
-msgstr "d"
-
-#: timeunit.cpp:194
-msgctxt "unit description in lists"
-msgid "days"
-msgstr "dani"
-
-#: timeunit.cpp:195
-msgctxt "unit synonyms for matching user input"
-msgid "day;days;d"
-msgstr ""
-
-#: timeunit.cpp:196
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 days"
-msgstr "%1 dana"
-
-#: timeunit.cpp:197
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 day"
-msgid_plural "%1 days"
-msgstr[0] "%1 dan"
-msgstr[1] "%1 dana"
-msgstr[2] "%1 dana"
-
-#: timeunit.cpp:200
-msgctxt "time unit symbol"
-msgid "w"
-msgstr "t"
-
-#: timeunit.cpp:201
-msgctxt "unit description in lists"
-msgid "weeks"
-msgstr "tjedana"
-
-#: timeunit.cpp:202
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "week;weeks;"
-msgctxt "unit synonyms for matching user input"
-msgid "week;weeks"
-msgstr "tjedan;tjedni;tjedana"
-
-#: timeunit.cpp:203
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 weeks"
-msgstr ""
-
-#: timeunit.cpp:204
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 week"
-msgid_plural "%1 weeks"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:207
-msgctxt "time unit symbol"
-msgid "a"
-msgstr "a"
-
-#: timeunit.cpp:208
-#, fuzzy
-#| msgctxt "unit description in lists"
-#| msgid "australian dollars"
-msgctxt "unit description in lists"
-msgid "Julian years"
-msgstr "australski dolari"
-
-#: timeunit.cpp:209
-msgctxt "unit synonyms for matching user input"
-msgid "Julian year;Julian years;a"
-msgstr ""
-
-#: timeunit.cpp:210
-#, fuzzy, kde-format
-#| msgctxt "amount in units (real)"
-#| msgid "%1 australian dollars"
-msgctxt "amount in units (real)"
-msgid "%1 Julian years"
-msgstr "%1 australskih dolara"
-
-#: timeunit.cpp:211
-#, fuzzy, kde-format
-#| msgctxt "amount in units (integer)"
-#| msgid "%1 australian dollar"
-#| msgid_plural "%1 australian dollars"
-msgctxt "amount in units (integer)"
-msgid "%1 Julian year"
-msgid_plural "%1 Julian years"
-msgstr[0] "%1 australski dolar"
-msgstr[1] "%1 australska dolara"
-msgstr[2] "%1 australskih dolara"
-
-#: timeunit.cpp:214
-msgctxt "time unit symbol"
-msgid "lpy"
-msgstr "lpy"
-
-#: timeunit.cpp:215
-msgctxt "unit description in lists"
-msgid "leap years"
-msgstr ""
-
-#: timeunit.cpp:216
-#, fuzzy
-#| msgctxt "unit synonyms for matching user input"
-#| msgid "year;years;y"
-msgctxt "unit synonyms for matching user input"
-msgid "leap year;leap years"
-msgstr "godina;godine;g"
-
-#: timeunit.cpp:217
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 leap years"
-msgstr ""
-
-#: timeunit.cpp:218
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 leap year"
-msgid_plural "%1 leap years"
-msgstr[0] ""
-msgstr[1] ""
-
-#: timeunit.cpp:222
-msgctxt "time unit symbol"
-msgid "y"
-msgstr "g"
-
-#: timeunit.cpp:223
-msgctxt "unit description in lists"
-msgid "year"
-msgstr "godina"
-
-#: timeunit.cpp:224
-msgctxt "unit synonyms for matching user input"
-msgid "year;years;y"
-msgstr "godina;godine;g"
-
-#: timeunit.cpp:225
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 year"
-msgstr ""
-
-#: timeunit.cpp:226
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 year"
-msgid_plural "%1 years"
-msgstr[0] ""
-msgstr[1] ""
-
-#: velocity.cpp:35
-msgid "Speed"
-msgstr ""
-
-#: velocity.cpp:36
-#, kde-format
-msgctxt "%1 value, %2 unit symbol (velocity)"
-msgid "%1 %2"
-msgstr "%1 %2"
-
-#: velocity.cpp:39
-msgctxt "velocity unit symbol"
-msgid "m/s"
-msgstr "m/s"
-
-#: velocity.cpp:40
-msgctxt "unit description in lists"
-msgid "meters per second"
-msgstr ""
-
-#: velocity.cpp:41
-msgctxt "unit synonyms for matching user input"
-msgid "meter per second;meters per second;m/s;ms"
-msgstr ""
-
-#: velocity.cpp:42
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 meters per second"
-msgstr ""
-
-#: velocity.cpp:43
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 meter per second"
-msgid_plural "%1 meters per second"
-msgstr[0] ""
-msgstr[1] ""
-
-#: velocity.cpp:46
-msgctxt "velocity unit symbol"
-msgid "km/h"
-msgstr ""
-
-#: velocity.cpp:47
-msgctxt "unit description in lists"
-msgid "kilometers per hour"
-msgstr "kilometara na sat"
-
-#: velocity.cpp:49
-msgctxt "unit synonyms for matching user input"
-msgid "kilometer per hour;kilometers per hour;km/h;kmh"
-msgstr "kilometar na sat;kilometara na sat;km/h;kmh"
-
-#: velocity.cpp:50
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 kilometers per hour"
-msgstr "%1 kilometara na sat"
-
-#: velocity.cpp:51
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 kilometer per hour"
-msgid_plural "%1 kilometers per hour"
-msgstr[0] "%1 kilometar na sat"
-msgstr[1] "%1 kilometra na sat"
-msgstr[2] "%1 kilometara na sat"
-
-#: velocity.cpp:54
-msgctxt "velocity unit symbol"
-msgid "mph"
-msgstr "mph"
-
-#: velocity.cpp:55
-msgctxt "unit description in lists"
-msgid "miles per hour"
-msgstr "milja na sat"
-
-#: velocity.cpp:56
-msgctxt "unit synonyms for matching user input"
-msgid "mile per hour;miles per hour;mph"
-msgstr "milja na sat;milja na sat;mph"
-
-#: velocity.cpp:57
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 miles per hour"
-msgstr "%1 milja na sat"
-
-#: velocity.cpp:58
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 mile per hour"
-msgid_plural "%1 miles per hour"
-msgstr[0] "%1 milja na sat"
-msgstr[1] "%1 milje na sat"
-msgstr[2] "%1 milja na sat"
-
-#: velocity.cpp:61
-msgctxt "velocity unit symbol"
-msgid "ft/s"
-msgstr "ft/s"
-
-#: velocity.cpp:62
-msgctxt "unit description in lists"
-msgid "feet per second"
-msgstr "stopa u sekundi"
-
-#: velocity.cpp:64
-msgctxt "unit synonyms for matching user input"
-msgid "foot per second;feet per second;ft/s;ft/sec;fps"
-msgstr ""
-
-#: velocity.cpp:65
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 feet per second"
-msgstr ""
-
-#: velocity.cpp:66
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 foot per second"
-msgid_plural "%1 feet per second"
-msgstr[0] ""
-msgstr[1] "stopa u sekundi"
-msgstr[2] "stopa u sekundi"
-
-#: velocity.cpp:69
-msgctxt "velocity unit symbol"
-msgid "in/s"
-msgstr "in/s"
-
-#: velocity.cpp:70
-msgctxt "unit description in lists"
-msgid "inches per second"
-msgstr ""
-
-#: velocity.cpp:72
-msgctxt "unit synonyms for matching user input"
-msgid "inch per second;inches per second;in/s;in/sec;ips"
-msgstr ""
-
-#: velocity.cpp:73
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 inches per second"
-msgstr ""
-
-#: velocity.cpp:74
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 inch per second"
-msgid_plural "%1 inches per second"
-msgstr[0] ""
-msgstr[1] ""
-
-#: velocity.cpp:77
-msgctxt "velocity unit symbol"
-msgid "kt"
-msgstr "kt"
-
-#: velocity.cpp:78
-msgctxt "unit description in lists"
-msgid "knots"
-msgstr ""
-
-#: velocity.cpp:79
-msgctxt "unit synonyms for matching user input"
-msgid "knot;knots;kt;nautical miles per hour"
-msgstr ""
-
-#: velocity.cpp:80
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 knots"
-msgstr ""
-
-#: velocity.cpp:81
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 knot"
-msgid_plural "%1 knots"
-msgstr[0] ""
-msgstr[1] ""
-
-#: velocity.cpp:85
-msgctxt "velocity unit symbol"
-msgid "Ma"
-msgstr "Ma"
-
-#: velocity.cpp:86
-#, fuzzy
-#| msgctxt "velocity unit symbol"
-#| msgid "Ma"
-msgctxt "unit description in lists"
-msgid "Mach"
-msgstr "Ma"
-
-#: velocity.cpp:87
-msgctxt "unit synonyms for matching user input"
-msgid "mach;machs;Ma;speed of sound"
-msgstr ""
-
-#: velocity.cpp:88
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "Mach %1"
-msgstr "Mah %1"
-
-#: velocity.cpp:89
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "Mach %1"
-msgid_plural "Mach %1"
-msgstr[0] ""
-msgstr[1] ""
-msgstr[2] ""
-
-#: velocity.cpp:92
-msgctxt "velocity unit symbol"
-msgid "c"
-msgstr "c"
-
-#: velocity.cpp:93
-msgctxt "unit description in lists"
-msgid "speed of light"
-msgstr ""
-
-#: velocity.cpp:94
-msgctxt "unit synonyms for matching user input"
-msgid "speed of light;c"
-msgstr ""
-
-#: velocity.cpp:95
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 speed of light"
-msgstr ""
-
-#: velocity.cpp:96
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 speed of light"
-msgid_plural "%1 speed of light"
-msgstr[0] ""
-msgstr[1] ""
-
-#: velocity.cpp:100
-msgctxt "velocity unit symbol"
-msgid "bft"
-msgstr "bft"
-
-#: velocity.cpp:101
-msgctxt "unit description in lists"
-msgid "Beaufort"
-msgstr ""
-
-#: velocity.cpp:102
-msgctxt "unit synonyms for matching user input"
-msgid "Beaufort;Bft"
-msgstr ""
-
-#: velocity.cpp:103
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 on the Beaufort scale"
-msgstr ""
-
-#: velocity.cpp:104
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 on the Beaufort scale"
-msgid_plural "%1 on the Beaufort scale"
-msgstr[0] ""
-msgstr[1] ""
-msgstr[2] ""
-
-#: volume.cpp:28
-msgid "Volume"
-msgstr "Obujam"
-
-#: volume.cpp:29
-#, kde-format
-msgctxt "%1 value, %2 unit symbol (volume)"
-msgid "%1 %2"
-msgstr "%1 %2"
-
-#: volume.cpp:32
-msgctxt "volume unit symbol"
-msgid "Ym³"
-msgstr "Ym³"
-
-#: volume.cpp:33
-msgctxt "unit description in lists"
-msgid "cubic yottameters"
-msgstr ""
-
-#: volume.cpp:35
-msgctxt "unit synonyms for matching user input"
-msgid "cubic yottameter;cubic yottameters;Ym³;Ym/-3;Ym^3;Ym3"
-msgstr ""
-
-#: volume.cpp:36
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic yottameters"
-msgstr ""
-
-#: volume.cpp:37
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic yottameter"
-msgid_plural "%1 cubic yottameters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:40
-msgctxt "volume unit symbol"
-msgid "Zm³"
-msgstr "Zm³"
-
-#: volume.cpp:41
-msgctxt "unit description in lists"
-msgid "cubic zettameters"
-msgstr ""
-
-#: volume.cpp:43
-msgctxt "unit synonyms for matching user input"
-msgid "cubic zettameter;cubic zettameters;Zm³;Zm/-3;Zm^3;Zm3"
-msgstr ""
-
-#: volume.cpp:44
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic zettameters"
-msgstr ""
-
-#: volume.cpp:45
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic zettameter"
-msgid_plural "%1 cubic zettameters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:48
-msgctxt "volume unit symbol"
-msgid "Em³"
-msgstr "Em³"
-
-#: volume.cpp:49
-msgctxt "unit description in lists"
-msgid "cubic exameters"
-msgstr ""
-
-#: volume.cpp:51
-msgctxt "unit synonyms for matching user input"
-msgid "cubic exameter;cubic exameters;Em³;Em/-3;Em^3;Em3"
-msgstr ""
-
-#: volume.cpp:52
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic exameters"
-msgstr ""
-
-#: volume.cpp:53
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic exameter"
-msgid_plural "%1 cubic exameters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:56
-msgctxt "volume unit symbol"
-msgid "Pm³"
-msgstr "Pm³"
-
-#: volume.cpp:57
-msgctxt "unit description in lists"
-msgid "cubic petameters"
-msgstr ""
-
-#: volume.cpp:59
-msgctxt "unit synonyms for matching user input"
-msgid "cubic petameter;cubic petameters;Pm³;Pm/-3;Pm^3;Pm3"
-msgstr ""
-
-#: volume.cpp:60
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic petameters"
-msgstr ""
-
-#: volume.cpp:61
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic petameter"
-msgid_plural "%1 cubic petameters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:64
-msgctxt "volume unit symbol"
-msgid "Tm³"
-msgstr "Tm³"
-
-#: volume.cpp:65
-msgctxt "unit description in lists"
-msgid "cubic terameters"
-msgstr ""
-
-#: volume.cpp:67
-msgctxt "unit synonyms for matching user input"
-msgid "cubic terameter;cubic terameters;Tm³;Tm/-3;Tm^3;Tm3"
-msgstr ""
-
-#: volume.cpp:68
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic terameters"
-msgstr ""
-
-#: volume.cpp:69
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic terameter"
-msgid_plural "%1 cubic terameters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:72
-msgctxt "volume unit symbol"
-msgid "Gm³"
-msgstr "Gm³"
-
-#: volume.cpp:73
-msgctxt "unit description in lists"
-msgid "cubic gigameters"
-msgstr ""
-
-#: volume.cpp:75
-msgctxt "unit synonyms for matching user input"
-msgid "cubic gigameter;cubic gigameters;Gm³;Gm/-3;Gm^3;Gm3"
-msgstr ""
-
-#: volume.cpp:76
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic gigameters"
-msgstr ""
-
-#: volume.cpp:77
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic gigameter"
-msgid_plural "%1 cubic gigameters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:80
-msgctxt "volume unit symbol"
-msgid "Mm³"
-msgstr "Mm³"
-
-#: volume.cpp:81
-msgctxt "unit description in lists"
-msgid "cubic megameters"
-msgstr ""
-
-#: volume.cpp:83
-msgctxt "unit synonyms for matching user input"
-msgid "cubic megameter;cubic megameters;Mm³;Mm/-3;Mm^3;Mm3"
-msgstr ""
-
-#: volume.cpp:84
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic megameters"
-msgstr ""
-
-#: volume.cpp:85
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic megameter"
-msgid_plural "%1 cubic megameters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:88
-msgctxt "volume unit symbol"
-msgid "km³"
-msgstr "km³"
-
-#: volume.cpp:89
-msgctxt "unit description in lists"
-msgid "cubic kilometers"
-msgstr "kubični kilometri"
-
-#: volume.cpp:91
-msgctxt "unit synonyms for matching user input"
-msgid "cubic kilometer;cubic kilometers;km³;km/-3;km^3;km3"
-msgstr ""
-"kubični kilometar;kilometar kubični;kubični kilometri;kilometri kubični;km³;"
-"km/-3;km^3;km3"
-
-#: volume.cpp:92
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic kilometers"
-msgstr "%1 kubičnih kilometara"
-
-#: volume.cpp:93
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic kilometer"
-msgid_plural "%1 cubic kilometers"
-msgstr[0] "%1 kubični kilometar"
-msgstr[1] "%1 kubična kilometra"
-msgstr[2] "%1 kubičnih kilometara"
-
-#: volume.cpp:96
-msgctxt "volume unit symbol"
-msgid "hm³"
-msgstr "hm³"
-
-#: volume.cpp:97
-msgctxt "unit description in lists"
-msgid "cubic hectometers"
-msgstr ""
-
-#: volume.cpp:99
-msgctxt "unit synonyms for matching user input"
-msgid "cubic hectometer;cubic hectometers;hm³;hm/-3;hm^3;hm3"
-msgstr ""
-
-#: volume.cpp:100
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic hectometers"
-msgstr ""
-
-#: volume.cpp:101
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic hectometer"
-msgid_plural "%1 cubic hectometers"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:104
-msgctxt "volume unit symbol"
-msgid "dam³"
-msgstr "dam³"
-
-#: volume.cpp:105
-msgctxt "unit description in lists"
-msgid "cubic decameters"
-msgstr ""
-
-#: volume.cpp:107
-msgctxt "unit synonyms for matching user input"
-msgid "cubic decameter;cubic decameters;dam³;dam/-3;dam^3;dam3"
-msgstr ""
-
-#: volume.cpp:108
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic decameters"
-msgstr ""
-
-#: volume.cpp:109
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic decameter"
-msgid_plural "%1 cubic decameters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:112
-msgctxt "volume unit symbol"
-msgid "m³"
-msgstr "m³"
-
-#: volume.cpp:113
-msgctxt "unit description in lists"
-msgid "cubic meters"
-msgstr ""
-
-#: volume.cpp:115
-msgctxt "unit synonyms for matching user input"
-msgid "cubic meter;cubic meters;m³;m/-3;m^3;m3"
-msgstr ""
-
-#: volume.cpp:116
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic meters"
-msgstr ""
-
-#: volume.cpp:117
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic meter"
-msgid_plural "%1 cubic meters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:120
-msgctxt "volume unit symbol"
-msgid "dm³"
-msgstr "dm³"
-
-#: volume.cpp:121
-msgctxt "unit description in lists"
-msgid "cubic decimeters"
-msgstr ""
-
-#: volume.cpp:123
-msgctxt "unit synonyms for matching user input"
-msgid "cubic decimeter;cubic decimeters;dm³;dm/-3;dm^3;dm3"
-msgstr ""
-
-#: volume.cpp:124
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic decimeters"
-msgstr ""
-
-#: volume.cpp:125
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic decimeter"
-msgid_plural "%1 cubic decimeters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:128
-msgctxt "volume unit symbol"
-msgid "cm³"
-msgstr "cm³"
-
-#: volume.cpp:129
-msgctxt "unit description in lists"
-msgid "cubic centimeters"
-msgstr ""
-
-#: volume.cpp:131
-msgctxt "unit synonyms for matching user input"
-msgid "cubic centimeter;cubic centimeters;cm³;cm/-3;cm^3;cm3"
-msgstr ""
-
-#: volume.cpp:132
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic centimeters"
-msgstr ""
-
-#: volume.cpp:133
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic centimeter"
-msgid_plural "%1 cubic centimeters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:136
-msgctxt "volume unit symbol"
-msgid "mm³"
-msgstr "mm³"
-
-#: volume.cpp:137
-msgctxt "unit description in lists"
-msgid "cubic millimeters"
-msgstr ""
-
-#: volume.cpp:139
-msgctxt "unit synonyms for matching user input"
-msgid "cubic millimeter;cubic millimeters;mm³;mm/-3;mm^3;mm3"
-msgstr ""
-
-#: volume.cpp:140
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic millimeters"
-msgstr ""
-
-#: volume.cpp:141
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic millimeter"
-msgid_plural "%1 cubic millimeters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:144
-msgctxt "volume unit symbol"
-msgid "µm³"
-msgstr "µm³"
-
-#: volume.cpp:145
-msgctxt "unit description in lists"
-msgid "cubic micrometers"
-msgstr ""
-
-#: volume.cpp:147
-msgctxt "unit synonyms for matching user input"
-msgid "cubic micrometer;cubic micrometers;µm³;um³;µm/-3;µm^3;µm3"
-msgstr ""
-
-#: volume.cpp:148
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic micrometers"
-msgstr ""
-
-#: volume.cpp:149
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic micrometer"
-msgid_plural "%1 cubic micrometers"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:152
-msgctxt "volume unit symbol"
-msgid "nm³"
-msgstr "nm³"
-
-#: volume.cpp:153
-msgctxt "unit description in lists"
-msgid "cubic nanometers"
-msgstr ""
-
-#: volume.cpp:155
-msgctxt "unit synonyms for matching user input"
-msgid "cubic nanometer;cubic nanometers;nm³;nm/-3;nm^3;nm3"
-msgstr ""
-
-#: volume.cpp:156
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic nanometers"
-msgstr ""
-
-#: volume.cpp:157
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic nanometer"
-msgid_plural "%1 cubic nanometers"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:160
-msgctxt "volume unit symbol"
-msgid "pm³"
-msgstr "pm³"
-
-#: volume.cpp:161
-msgctxt "unit description in lists"
-msgid "cubic picometers"
-msgstr ""
-
-#: volume.cpp:163
-msgctxt "unit synonyms for matching user input"
-msgid "cubic picometer;cubic picometers;pm³;pm/-3;pm^3;pm3"
-msgstr ""
-
-#: volume.cpp:164
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic picometers"
-msgstr ""
-
-#: volume.cpp:165
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic picometer"
-msgid_plural "%1 cubic picometers"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:168
-msgctxt "volume unit symbol"
-msgid "fm³"
-msgstr "fm³"
-
-#: volume.cpp:169
-msgctxt "unit description in lists"
-msgid "cubic femtometers"
-msgstr ""
-
-#: volume.cpp:171
-msgctxt "unit synonyms for matching user input"
-msgid "cubic femtometer;cubic femtometers;fm³;fm/-3;fm^3;fm3"
-msgstr ""
-
-#: volume.cpp:172
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic femtometers"
-msgstr ""
-
-#: volume.cpp:173
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic femtometer"
-msgid_plural "%1 cubic femtometers"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:176
-msgctxt "volume unit symbol"
-msgid "am³"
-msgstr "am³"
-
-#: volume.cpp:177
-msgctxt "unit description in lists"
-msgid "cubic attometers"
-msgstr ""
-
-#: volume.cpp:179
-msgctxt "unit synonyms for matching user input"
-msgid "cubic attometer;cubic attometers;am³;am/-3;am^3;am3"
-msgstr ""
-
-#: volume.cpp:180
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic attometers"
-msgstr ""
-
-#: volume.cpp:181
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic attometer"
-msgid_plural "%1 cubic attometers"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:184
-msgctxt "volume unit symbol"
-msgid "zm³"
-msgstr "zm³"
-
-#: volume.cpp:185
-msgctxt "unit description in lists"
-msgid "cubic zeptometers"
-msgstr ""
-
-#: volume.cpp:187
-msgctxt "unit synonyms for matching user input"
-msgid "cubic zeptometer;cubic zeptometers;zm³;zm/-3;zm^3;zm3"
-msgstr ""
-
-#: volume.cpp:188
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic zeptometers"
-msgstr ""
-
-#: volume.cpp:189
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic zeptometer"
-msgid_plural "%1 cubic zeptometers"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:192
-msgctxt "volume unit symbol"
-msgid "ym³"
-msgstr "ym³"
-
-#: volume.cpp:193
-msgctxt "unit description in lists"
-msgid "cubic yoctometers"
-msgstr ""
-
-#: volume.cpp:195
-msgctxt "unit synonyms for matching user input"
-msgid "cubic yoctometer;cubic yoctometers;ym³;ym/-3;ym^3;ym3"
-msgstr ""
-
-#: volume.cpp:196
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic yoctometers"
-msgstr ""
-
-#: volume.cpp:197
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic yoctometer"
-msgid_plural "%1 cubic yoctometers"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:200
-msgctxt "volume unit symbol"
-msgid "Yl"
-msgstr "Yl"
-
-#: volume.cpp:201
-msgctxt "unit description in lists"
-msgid "yottaliters"
-msgstr "jotalitre"
-
-#: volume.cpp:202
-msgctxt "unit synonyms for matching user input"
-msgid "yottaliter;yottaliters;Yl"
-msgstr ""
-
-#: volume.cpp:203
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 yottaliters"
-msgstr "%1 jotalitara"
-
-#: volume.cpp:204
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 yottaliter"
-msgid_plural "%1 yottaliters"
-msgstr[0] ""
-msgstr[1] "jotalitre"
-msgstr[2] "jotalitre"
-
-#: volume.cpp:207
-msgctxt "volume unit symbol"
-msgid "Zl"
-msgstr "Zl"
-
-#: volume.cpp:208
-msgctxt "unit description in lists"
-msgid "zettaliters"
-msgstr "zetaleitre"
-
-#: volume.cpp:209
-msgctxt "unit synonyms for matching user input"
-msgid "zettaliter;zettaliters;Zl"
-msgstr ""
-
-#: volume.cpp:210
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 zettaliters"
-msgstr "%1 zetalitara"
-
-#: volume.cpp:211
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 zettaliter"
-msgid_plural "%1 zettaliters"
-msgstr[0] ""
-msgstr[1] "zetaleitre"
-msgstr[2] "zetaleitre"
-
-#: volume.cpp:214
-msgctxt "volume unit symbol"
-msgid "El"
-msgstr "El"
-
-#: volume.cpp:215
-msgctxt "unit description in lists"
-msgid "exaliters"
-msgstr "eksalitre"
-
-#: volume.cpp:216
-msgctxt "unit synonyms for matching user input"
-msgid "exaliter;exaliters;El"
-msgstr ""
-
-#: volume.cpp:217
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 exaliters"
-msgstr "%1 eksalitara"
-
-#: volume.cpp:218
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 exaliter"
-msgid_plural "%1 exaliters"
-msgstr[0] ""
-msgstr[1] "eksalitre"
-msgstr[2] "eksalitre"
-
-#: volume.cpp:221
-msgctxt "volume unit symbol"
-msgid "Pl"
-msgstr "Pl"
-
-#: volume.cpp:222
-msgctxt "unit description in lists"
-msgid "petaliters"
-msgstr "petalitre"
-
-#: volume.cpp:223
-msgctxt "unit synonyms for matching user input"
-msgid "petaliter;petaliters;Pl"
-msgstr ""
-
-#: volume.cpp:224
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 petaliters"
-msgstr "%1 petalitara"
-
-#: volume.cpp:225
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 petaliter"
-msgid_plural "%1 petaliters"
-msgstr[0] ""
-msgstr[1] "petalitre"
-msgstr[2] "petalitre"
-
-#: volume.cpp:228
-msgctxt "volume unit symbol"
-msgid "Tl"
-msgstr "Tl"
-
-#: volume.cpp:229
-msgctxt "unit description in lists"
-msgid "teraliters"
-msgstr "teralitre"
-
-#: volume.cpp:230
-msgctxt "unit synonyms for matching user input"
-msgid "teraliter;teraliters;Tl"
-msgstr ""
-
-#: volume.cpp:231
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 teraliters"
-msgstr "%1 teralitara"
-
-#: volume.cpp:232
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 teraliter"
-msgid_plural "%1 teraliters"
-msgstr[0] ""
-msgstr[1] "teralitre"
-msgstr[2] "teralitre"
-
-#: volume.cpp:235
-msgctxt "volume unit symbol"
-msgid "Gl"
-msgstr "Gl"
-
-#: volume.cpp:236
-msgctxt "unit description in lists"
-msgid "gigaliters"
-msgstr "gigalitre"
-
-#: volume.cpp:237
-msgctxt "unit synonyms for matching user input"
-msgid "gigaliter;gigaliters;Gl"
-msgstr ""
-
-#: volume.cpp:238
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 gigaliters"
-msgstr "%1 gigalitara"
-
-#: volume.cpp:239
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 gigaliter"
-msgid_plural "%1 gigaliters"
-msgstr[0] ""
-msgstr[1] "gigalitre"
-msgstr[2] "gigalitre"
-
-#: volume.cpp:242
-msgctxt "volume unit symbol"
-msgid "Ml"
-msgstr "Ml"
-
-#: volume.cpp:243
-msgctxt "unit description in lists"
-msgid "megaliters"
-msgstr "megalitre"
-
-#: volume.cpp:244
-msgctxt "unit synonyms for matching user input"
-msgid "megaliter;megaliters;Ml"
-msgstr ""
-
-#: volume.cpp:245
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 megaliters"
-msgstr "%1 megalitara"
-
-#: volume.cpp:246
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 megaliter"
-msgid_plural "%1 megaliters"
-msgstr[0] ""
-msgstr[1] "megalitre"
-msgstr[2] "megalitre"
-
-#: volume.cpp:249
-msgctxt "volume unit symbol"
-msgid "kl"
-msgstr "kl"
-
-#: volume.cpp:250
-msgctxt "unit description in lists"
-msgid "kiloliters"
-msgstr "kilolitre"
-
-#: volume.cpp:251
-msgctxt "unit synonyms for matching user input"
-msgid "kiloliter;kiloliters;kl"
-msgstr ""
-
-#: volume.cpp:252
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 kiloliters"
-msgstr "%1 kilolitara"
-
-#: volume.cpp:253
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 kiloliter"
-msgid_plural "%1 kiloliters"
-msgstr[0] ""
-msgstr[1] "kilolitre"
-msgstr[2] "kilolitre"
-
-#: volume.cpp:256
-msgctxt "volume unit symbol"
-msgid "hl"
-msgstr "hl"
-
-#: volume.cpp:257
-msgctxt "unit description in lists"
-msgid "hectoliters"
-msgstr "hektolitre"
-
-#: volume.cpp:258
-msgctxt "unit synonyms for matching user input"
-msgid "hectoliter;hectoliters;hl"
-msgstr "hektolitra;hektolitre;hl"
-
-#: volume.cpp:259
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 hectoliters"
-msgstr "%1 hektolitara"
-
-#: volume.cpp:260
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 hectoliter"
-msgid_plural "%1 hectoliters"
-msgstr[0] "%1 hektolitra"
-msgstr[1] "%1 hektolitre"
-msgstr[2] "%1 hektolitara"
-
-#: volume.cpp:263
-msgctxt "volume unit symbol"
-msgid "dal"
-msgstr "dal"
-
-#: volume.cpp:264
-msgctxt "unit description in lists"
-msgid "decaliters"
-msgstr ""
-
-#: volume.cpp:265
-msgctxt "unit synonyms for matching user input"
-msgid "decaliter;decaliters;dal"
-msgstr ""
-
-#: volume.cpp:266
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 decaliters"
-msgstr ""
-
-#: volume.cpp:267
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 decaliter"
-msgid_plural "%1 decaliters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:270
-msgctxt "volume unit symbol"
-msgid "l"
-msgstr "l"
-
-#: volume.cpp:271
-msgctxt "unit description in lists"
-msgid "liters"
-msgstr "litre"
-
-#: volume.cpp:272
-msgctxt "unit synonyms for matching user input"
-msgid "liter;liters;l"
-msgstr "litra;litre;l"
-
-#: volume.cpp:273
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 liters"
-msgstr "%1 litara"
-
-#: volume.cpp:274
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 liter"
-msgid_plural "%1 liters"
-msgstr[0] "%1 litra"
-msgstr[1] "%1 litre"
-msgstr[2] "%1 litara"
-
-#: volume.cpp:277
-msgctxt "volume unit symbol"
-msgid "dl"
-msgstr "dl"
-
-#: volume.cpp:278
-msgctxt "unit description in lists"
-msgid "deciliters"
-msgstr "decilitre"
-
-#: volume.cpp:279
-msgctxt "unit synonyms for matching user input"
-msgid "deciliter;deciliters;dl"
-msgstr ""
-
-#: volume.cpp:280
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 deciliters"
-msgstr "%1 decilitara"
-
-#: volume.cpp:281
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 deciliter"
-msgid_plural "%1 deciliters"
-msgstr[0] ""
-msgstr[1] "decilitre"
-msgstr[2] "decilitre"
-
-#: volume.cpp:284
-msgctxt "volume unit symbol"
-msgid "cl"
-msgstr "cl"
-
-#: volume.cpp:285
-msgctxt "unit description in lists"
-msgid "centiliters"
-msgstr "centilitre"
-
-#: volume.cpp:286
-msgctxt "unit synonyms for matching user input"
-msgid "centiliter;centiliters;cl"
-msgstr ""
-
-#: volume.cpp:287
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 centiliters"
-msgstr "%1 centilitara"
-
-#: volume.cpp:288
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 centiliter"
-msgid_plural "%1 centiliters"
-msgstr[0] ""
-msgstr[1] "centilitre"
-msgstr[2] "centilitre"
-
-#: volume.cpp:291
-msgctxt "volume unit symbol"
-msgid "ml"
-msgstr "ml"
-
-#: volume.cpp:292
-msgctxt "unit description in lists"
-msgid "milliliters"
-msgstr "mililitre"
-
-#: volume.cpp:293
-msgctxt "unit synonyms for matching user input"
-msgid "milliliter;milliliters;ml"
-msgstr ""
-
-#: volume.cpp:294
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 milliliters"
-msgstr "%1 mililitara"
-
-#: volume.cpp:295
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 milliliter"
-msgid_plural "%1 milliliters"
-msgstr[0] ""
-msgstr[1] "mililitre"
-msgstr[2] "mililitre"
-
-#: volume.cpp:298
-msgctxt "volume unit symbol"
-msgid "µl"
-msgstr "µl"
-
-#: volume.cpp:299
-msgctxt "unit description in lists"
-msgid "microliters"
-msgstr "mikrolitre"
-
-#: volume.cpp:300
-msgctxt "unit synonyms for matching user input"
-msgid "microliter;microliters;µl;ul"
-msgstr ""
-
-#: volume.cpp:301
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 microliters"
-msgstr "%1 mikrolitara"
-
-#: volume.cpp:302
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 microliter"
-msgid_plural "%1 microliters"
-msgstr[0] ""
-msgstr[1] "mikrolitre"
-msgstr[2] "mikrolitre"
-
-#: volume.cpp:305
-msgctxt "volume unit symbol"
-msgid "nl"
-msgstr "nl"
-
-#: volume.cpp:306
-msgctxt "unit description in lists"
-msgid "nanoliters"
-msgstr "nanolitre"
-
-#: volume.cpp:307
-msgctxt "unit synonyms for matching user input"
-msgid "nanoliter;nanoliters;nl"
-msgstr ""
-
-#: volume.cpp:308
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 nanoliters"
-msgstr "%1 nanolitara"
-
-#: volume.cpp:309
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 nanoliter"
-msgid_plural "%1 nanoliters"
-msgstr[0] ""
-msgstr[1] "nanolitre"
-msgstr[2] "nanolitre"
-
-#: volume.cpp:312
-msgctxt "volume unit symbol"
-msgid "pl"
-msgstr "pl"
-
-#: volume.cpp:313
-msgctxt "unit description in lists"
-msgid "picoliters"
-msgstr "pikolitre"
-
-#: volume.cpp:314
-msgctxt "unit synonyms for matching user input"
-msgid "picoliter;picoliters;pl"
-msgstr ""
-
-#: volume.cpp:315
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 picoliters"
-msgstr "%1 pikolitara"
-
-#: volume.cpp:316
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 picoliter"
-msgid_plural "%1 picoliters"
-msgstr[0] ""
-msgstr[1] "pikolitre"
-msgstr[2] "pikolitre"
-
-#: volume.cpp:319
-msgctxt "volume unit symbol"
-msgid "fl"
-msgstr "fl"
-
-#: volume.cpp:320
-msgctxt "unit description in lists"
-msgid "femtoliters"
-msgstr ""
-
-#: volume.cpp:321
-msgctxt "unit synonyms for matching user input"
-msgid "femtoliter;femtoliters;fl"
-msgstr ""
-
-#: volume.cpp:322
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 femtoliters"
-msgstr ""
-
-#: volume.cpp:323
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 femtoliter"
-msgid_plural "%1 femtoliters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:326
-msgctxt "volume unit symbol"
-msgid "al"
-msgstr "al"
-
-#: volume.cpp:327
-msgctxt "unit description in lists"
-msgid "attoliters"
-msgstr ""
-
-#: volume.cpp:328
-msgctxt "unit synonyms for matching user input"
-msgid "attoliter;attoliters;al"
-msgstr ""
-
-#: volume.cpp:329
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 attoliters"
-msgstr ""
-
-#: volume.cpp:330
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 attoliter"
-msgid_plural "%1 attoliters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:333
-msgctxt "volume unit symbol"
-msgid "zl"
-msgstr "zl"
-
-#: volume.cpp:334
-msgctxt "unit description in lists"
-msgid "zeptoliters"
-msgstr ""
-
-#: volume.cpp:335
-msgctxt "unit synonyms for matching user input"
-msgid "zeptoliter;zeptoliters;zl"
-msgstr ""
-
-#: volume.cpp:336
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 zeptoliters"
-msgstr ""
-
-#: volume.cpp:337
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 zeptoliter"
-msgid_plural "%1 zeptoliters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:340
-msgctxt "volume unit symbol"
-msgid "yl"
-msgstr "yl"
-
-#: volume.cpp:341
-msgctxt "unit description in lists"
-msgid "yoctoliters"
-msgstr ""
-
-#: volume.cpp:342
-msgctxt "unit synonyms for matching user input"
-msgid "yoctoliter;yoctoliters;yl"
-msgstr ""
-
-#: volume.cpp:343
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 yoctoliters"
-msgstr ""
-
-#: volume.cpp:344
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 yoctoliter"
-msgid_plural "%1 yoctoliters"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:347
-msgctxt "volume unit symbol"
-msgid "ft³"
-msgstr "ft³"
-
-#: volume.cpp:348
-msgctxt "unit description in lists"
-msgid "cubic feet"
-msgstr ""
-
-#: volume.cpp:350
-msgctxt "unit synonyms for matching user input"
-msgid "cubic foot;cubic feet;ft³;cubic ft;cu foot;cu ft;cu feet;feet³"
-msgstr ""
-
-#: volume.cpp:351
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic feet"
-msgstr ""
-
-#: volume.cpp:352
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic foot"
-msgid_plural "%1 cubic feet"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:355
-msgctxt "volume unit symbol"
-msgid "in³"
-msgstr "in³"
-
-#: volume.cpp:356
-msgctxt "unit description in lists"
-msgid "cubic inches"
-msgstr ""
-
-#: volume.cpp:358
-msgctxt "unit synonyms for matching user input"
-msgid ""
-"cubic inch;cubic inches;in³;cubic inch;cubic in;cu inches;cu inch;cu in;inch³"
-msgstr ""
-
-#: volume.cpp:359
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic inches"
-msgstr ""
-
-#: volume.cpp:360
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic inch"
-msgid_plural "%1 cubic inches"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:363
-msgctxt "volume unit symbol"
-msgid "mi³"
-msgstr "mi³"
-
-#: volume.cpp:364
-msgctxt "unit description in lists"
-msgid "cubic miles"
-msgstr "kubične milje"
-
-#: volume.cpp:366
-msgctxt "unit synonyms for matching user input"
-msgid ""
-"cubic mile;cubic miles;mi³;cubic mile;cubic mi;cu miles;cu mile;cu mi;mile³"
-msgstr ""
-"kubična milja;kubične milje;mi³;kubična milja;kubična mi;ku milje;ku milja;"
-"ku mi;milja³"
-
-#: volume.cpp:367
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cubic miles"
-msgstr "%1 kubična milja"
-
-#: volume.cpp:368
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cubic mile"
-msgid_plural "%1 cubic miles"
-msgstr[0] "%1 kubična milja"
-msgstr[1] "%1 kubične milje"
-msgstr[2] "%1 kubičnih milja"
-
-#: volume.cpp:371
-msgctxt "volume unit symbol"
-msgid "fl.oz."
-msgstr "fl.oz."
-
-#: volume.cpp:372
-msgctxt "unit description in lists"
-msgid "fluid ounces"
-msgstr ""
-
-#: volume.cpp:374
-msgctxt "unit synonyms for matching user input"
-msgid ""
-"fluid ounce;fluid ounces;fl.oz.;oz.fl.;oz. fl.;fl. oz.;fl oz;fluid ounce"
-msgstr ""
-
-#: volume.cpp:375
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 fluid ounces"
-msgstr ""
-
-#: volume.cpp:376
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 fluid ounce"
-msgid_plural "%1 fluid ounces"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:379
-msgctxt "volume unit symbol"
-msgid "cp"
-msgstr "cp"
-
-#: volume.cpp:380
-msgctxt "unit description in lists"
-msgid "cups"
-msgstr ""
-
-#: volume.cpp:381
-msgctxt "unit synonyms for matching user input"
-msgid "cup;cups;cp"
-msgstr ""
-
-#: volume.cpp:382
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 cups"
-msgstr ""
-
-#: volume.cpp:383
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 cup"
-msgid_plural "%1 cups"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:386
-msgctxt "volume unit symbol"
-msgid "gal"
-msgstr "gal"
-
-#: volume.cpp:387
-msgctxt "unit description in lists"
-msgid "gallons (U.S. liquid)"
-msgstr ""
-
-#: volume.cpp:389
-msgctxt "unit synonyms for matching user input"
-msgid "gallon (U.S. liquid);gallons (U.S. liquid);gal;gallon;gallons"
-msgstr ""
-
-#: volume.cpp:390
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 gallons (U.S. liquid)"
-msgstr ""
-
-#: volume.cpp:391
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 gallon (U.S. liquid)"
-msgid_plural "%1 gallons (U.S. liquid)"
-msgstr[0] ""
-msgstr[1] ""
-
-#: volume.cpp:394
-msgctxt "volume unit symbol"
-msgid "pt"
-msgstr "pt"
-
-#: volume.cpp:395
-msgctxt "unit description in lists"
-msgid "pints (imperial)"
-msgstr ""
-
-#: volume.cpp:397
-msgctxt "unit synonyms for matching user input"
-msgid "pint (imperial);pints (imperial);pt;pint;pints;p"
-msgstr ""
-
-#: volume.cpp:398
-#, kde-format
-msgctxt "amount in units (real)"
-msgid "%1 pints (imperial)"
-msgstr ""
-
-#: volume.cpp:399
-#, kde-format
-msgctxt "amount in units (integer)"
-msgid "%1 pint (imperial)"
-msgid_plural "%1 pints (imperial)"
-msgstr[0] ""
-msgstr[1] ""
-
-#~ msgid "Velocity"
-#~ msgstr "brzina"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "EUR"
-#~ msgstr "EUR"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "euro;euros;EUR;eur;€"
-#~ msgstr "euro;euri;EUR;eur;€;evri,evro"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "ATS"
-#~ msgstr "ATS"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "schillings"
-#~ msgstr "šilizi"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "BEF"
-#~ msgstr "BEF"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "belgian francs"
-#~ msgstr "belgijski franci"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "franc;francs;BEF;bef;belgium"
-#~ msgstr "frank;franci;BEF;bef;belgijska"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "NLG"
-#~ msgstr "NLG"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "guilder;guilders;NLG;nlg;netherlands"
-#~ msgstr "gulden;guldeni;NLG;nlg;nizozemski"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "FIM"
-#~ msgstr "FIM"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "FRF"
-#~ msgstr "FRF"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "franc;francs;FRF;frf;france"
-#~ msgstr "frank;franci;FRF;frf;francuska"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "DEM"
-#~ msgstr "DEM"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "marks"
-#~ msgstr "marke"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "mark;marks;DEM;dem;germany"
-#~ msgstr "marka;marke;DEM;dem;njemačka"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "IEP"
-#~ msgstr "IEP"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "irish pounds"
-#~ msgstr "irska funta"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "ITL"
-#~ msgstr "ITL"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "lira;liras;ITL;itl;italy"
-#~ msgstr "lira;lire;ITL;itl;talijanska"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 italian liras"
-#~ msgstr "%1 talijanskih lira"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "LUF"
-#~ msgstr "LUF"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "luxembourgish francs"
-#~ msgstr "luksemburški franci"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "franc;francs;LUF;luf;luxembourg"
-#~ msgstr "frank;franci;LUF;luf;luksemburški"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "PTE"
-#~ msgstr "PTE"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "escudo;escudos;PTE;pte;portugal"
-#~ msgstr "eskudo;eskudoi;PTE;pte;portugalska"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "ESP"
-#~ msgstr "ESP"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "pesetas"
-#~ msgstr "pesete"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "GRD"
-#~ msgstr "GRD"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "drachmas"
-#~ msgstr "drahme"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "SIT"
-#~ msgstr "SIT"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "tolars"
-#~ msgstr "tolari"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "CYP"
-#~ msgstr "CYP"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "cypriot pounds"
-#~ msgstr "ciparske funte"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "MTL"
-#~ msgstr "MTL"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "maltese lira;maltese liras;MTL;mtl;malta"
-#~ msgstr "malteška lira;malteške lire;MTL;mtl;malteška"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 maltese liras"
-#~ msgstr "%1 malteških lira"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "SKK"
-#~ msgstr "SKK"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "slovak korunas"
-#~ msgstr "slovačke krune"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "USD"
-#~ msgstr "USD"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "united states dollars"
-#~ msgstr "američki dolari"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "JPY"
-#~ msgstr "JPY"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "yen;yens;JPY;jpy;japan;¥"
-#~ msgstr "jen;jeni;JPY;jpy;japanska;¥"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 yens"
-#~ msgstr "%1 jena"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "levs"
-#~ msgstr "levi"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "lev;levs;BGN;bgn;bulgaria"
-#~ msgstr "lev;levi;BGN;bgn;bugarska"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "CZK"
-#~ msgstr "CZK"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "czech korunas"
-#~ msgstr "češke krune"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "DKK"
-#~ msgstr "DKK"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "danish krones"
-#~ msgstr "danske krune"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 danish krones"
-#~ msgstr "%1 danskih kruna"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "EEK"
-#~ msgstr "EEK"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "GBP"
-#~ msgstr "GBP"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "pounds sterling"
-#~ msgstr "britanske funte"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "HUF"
-#~ msgstr "HUF"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "forint;forints;HUF;huf;hungary"
-#~ msgstr "forinta;forinte;HUF;huf;mađarska"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 forints"
-#~ msgstr "%1 forinti"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "LTL"
-#~ msgstr "LTL"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "litass"
-#~ msgstr "litasi"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 litass"
-#~ msgstr "%1 litasa"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "LVL"
-#~ msgstr "LVL"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "latss"
-#~ msgstr "latsi"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "lats;latss;LVL;lvl;latvia"
-#~ msgstr "lats;latsi;LVL;lvl;latvijska"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 latss"
-#~ msgstr "%1 latsa"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "zlotys"
-#~ msgstr "zloti"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "RON"
-#~ msgstr "RON"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "leus"
-#~ msgstr "leui"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "leu;leus;RON;ron;romania"
-#~ msgstr "leu;leui;RON;ron;rumunjska"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 leus"
-#~ msgstr "%1 leua"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "SEK"
-#~ msgstr "SEK"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "kronas"
-#~ msgstr "švedske krune"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "krona;kronas;SEK;sek;sweden"
-#~ msgstr "švedska kruna;švedske krune;SEK;sek;švedska;krona"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 kronas"
-#~ msgstr "%1 švedskih kruna"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "CHF"
-#~ msgstr "CHF"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "swiss francs"
-#~ msgstr "švicarski franci"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "franc;francs;CHF;chf;switzerland"
-#~ msgstr "švicarski franak;švicarski franci;CHF;chf;švicarska"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "NOK"
-#~ msgstr "NOK"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "norwegian krones"
-#~ msgstr "norveške krune"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 norwegian krones"
-#~ msgstr "%1 norveških kruna"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "HRK"
-#~ msgstr "HRK"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "kuna;kunas;HRK;hrk;croatia"
-#~ msgstr "kuna;kuna;HRK;hrk;hrvatski"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "RUB"
-#~ msgstr "RUB"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "roubles"
-#~ msgstr "rublji"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "TRY"
-#~ msgstr "TRY"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "turkish liras"
-#~ msgstr "turske lire"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "lira;liras;TRY;try;turkey"
-#~ msgstr "lira;lire;TRY;try;turska"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 turkish liras"
-#~ msgstr "%1 turskih lira"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "AUD"
-#~ msgstr "AUD"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "BRL"
-#~ msgstr "BRL"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "real;reals;BRL;brasilia"
-#~ msgstr "real;reali;BRL;brazilski"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "CAD"
-#~ msgstr "CAD"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "canadian dollars"
-#~ msgstr "kanadski dolari"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "CNY"
-#~ msgstr "CNY"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "yuan;yuans;CNY;china"
-#~ msgstr "yuan;yuani;CNY;kineska"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 yuans"
-#~ msgstr "%1 yuana"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "HKD"
-#~ msgstr "HKD"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "hong kong dollars"
-#~ msgstr "hongkonški dolari"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "IDR"
-#~ msgstr "IDR"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "rupiah;rupiahs;IDR;idr;indonesia"
-#~ msgstr "rupi;rupiji;IDR;idr;indonezijska"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "INR"
-#~ msgstr "INR"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "rupee;rupees;INR;inr;india"
-#~ msgstr "indijski rupi;indijski rupiji;INR;inr;indijska"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "KRW"
-#~ msgstr "KRW"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "won;wons;KRW;krw;south korea"
-#~ msgstr "won;woni;KRW;krw;južnokorejska"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "MYR"
-#~ msgstr "MYR"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "ringgit;ringgits;MYR;myr;malaysia"
-#~ msgstr "ringgit;ringgiti;MYR;myr;malezijska"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 ringgits"
-#~ msgstr "%1 ringgita"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "NZD"
-#~ msgstr "NZD"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "new zealand dollars"
-#~ msgstr "novozelandski dolari"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "philippine pesos"
-#~ msgstr "filipinski pesosi"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "SGD"
-#~ msgstr "SGD"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "singapore dollars"
-#~ msgstr "singapurski dolari"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "baht;bahts;THB;thb;thailand"
-#~ msgstr "baht;bahti;THB;thb;tajlandska"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 bahts"
-#~ msgstr "%1 bahti"
-
-#~ msgctxt "currency unit symbol"
-#~ msgid "ZAR"
-#~ msgstr "ZAR"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "rand;rands;ZAR;zar;south africa"
-#~ msgstr "rand;randi;ZAR;zar;južnoafrička"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 rands"
-#~ msgstr "%1 randi"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "torrs"
-#~ msgstr "torri"
-
-#~ msgctxt "density unit symbol"
-#~ msgid "YKg/m³"
-#~ msgstr "YKg/m³"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "yottakilograms per cubic meter"
-#~ msgstr "jotakilograma po kubičnom metru"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "yottakilogram per cubic meter;yottakilograms per cubic meter;YKg/m³"
-#~ msgstr ""
-#~ "jotakilogram po kubičnom metru;jotakilograma po kubičnom metru;YKg/m³"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 yottakilograms per cubic meter"
-#~ msgstr "%1 jotakilograma po kubičnom metru"
-
-#~ msgctxt "amount in units (integer)"
-#~ msgid "%1 yottakilogram per cubic meter"
-#~ msgid_plural "%1 yottakilograms per cubic meter"
-#~ msgstr[0] "%1 jotakilogram po kubičnom metru"
-#~ msgstr[1] "%1 jotakilograma po kubičnom metru"
-#~ msgstr[2] "%1 jotakilograma po kubičnom metru"
-
-#~ msgctxt "density unit symbol"
-#~ msgid "ZKg/m³"
-#~ msgstr "ZKg/m³"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "zettakilograms per cubic meter"
-#~ msgstr "zetakilograma po kubičnom metru"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "zettakilogram per cubic meter;zettakilograms per cubic meter;ZKg/m³"
-#~ msgstr ""
-#~ "zetakilogram po kubičnom metru;zetakilograma po kubičnom metru;ZKg/m³"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 zettakilograms per cubic meter"
-#~ msgstr "%1 zetakilograma po kubičnom metru"
-
-#~ msgctxt "amount in units (integer)"
-#~ msgid "%1 zettakilogram per cubic meter"
-#~ msgid_plural "%1 zettakilograms per cubic meter"
-#~ msgstr[0] "%1 zetakilogram po kubičnom metru"
-#~ msgstr[1] "%1 zetakilograma po kubičnom metru"
-#~ msgstr[2] "%1 zetakilograma po kubičnom metru"
-
-#~ msgctxt "density unit symbol"
-#~ msgid "EKg/m³"
-#~ msgstr "EKg/m³"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "exakilograms per cubic meter"
-#~ msgstr "eksakilograma po kubičnom metru"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "exakilogram per cubic meter;exakilograms per cubic meter;EKg/m³"
-#~ msgstr ""
-#~ "eksakilogram po kubičnom metru;eksakilograma po kubičnom metru;EKg/m³"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 exakilograms per cubic meter"
-#~ msgstr "%1 eksakilograma po kubičnom metru"
-
-#~ msgctxt "amount in units (integer)"
-#~ msgid "%1 exakilogram per cubic meter"
-#~ msgid_plural "%1 exakilograms per cubic meter"
-#~ msgstr[0] "%1 eksakilogram po kubičnom metru"
-#~ msgstr[1] "%1 eksakilograma po kubičnom metru"
-#~ msgstr[2] "%1 eksakilograma po kubičnom metru"
-
-#~ msgctxt "density unit symbol"
-#~ msgid "PKg/m³"
-#~ msgstr "PKg/m³"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "petakilograms per cubic meter"
-#~ msgstr "petakilograma po kubičnom metru"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "petakilogram per cubic meter;petakilograms per cubic meter;PKg/m³"
-#~ msgstr ""
-#~ "petakilogram po kubičnom metru;petakilograma po kubičnom metru;PKg/m³"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 petakilograms per cubic meter"
-#~ msgstr "%1 petakilograma po kubičnom metru"
-
-#~ msgctxt "amount in units (integer)"
-#~ msgid "%1 petakilogram per cubic meter"
-#~ msgid_plural "%1 petakilograms per cubic meter"
-#~ msgstr[0] "%1 petakilogram po kubičnom metru"
-#~ msgstr[1] "%1 petakilograma po kubičnom metru"
-#~ msgstr[2] "%1 petakilograma po kubičnom metru"
-
-#~ msgctxt "density unit symbol"
-#~ msgid "TKg/m³"
-#~ msgstr "TKg/m³"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "terakilograms per cubic meter"
-#~ msgstr "terakilograma po kubičnom metru"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "terakilogram per cubic meter;terakilograms per cubic meter;TKg/m³"
-#~ msgstr ""
-#~ "terakilogram po kubičnom metru;terakilograma po kubičnom metru;TKg/m³"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 terakilograms per cubic meter"
-#~ msgstr "%1 terakilograma po kubičnom metru"
-
-#~ msgctxt "amount in units (integer)"
-#~ msgid "%1 terakilogram per cubic meter"
-#~ msgid_plural "%1 terakilograms per cubic meter"
-#~ msgstr[0] "%1 terakilogram po kubičnom metru"
-#~ msgstr[1] "%1 terakilograma po kubičnom metru"
-#~ msgstr[2] "%1 terakilograma po kubičnom metru"
-
-#~ msgctxt "density unit symbol"
-#~ msgid "GKg/m³"
-#~ msgstr "GKg/m³"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "gigakilograms per cubic meter"
-#~ msgstr "gigakilograma po kubičnom metru"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "gigakilogram per cubic meter;gigakilograms per cubic meter;GKg/m³"
-#~ msgstr ""
-#~ "gigakilogram po kubičnom metru;gigakilograma po kubičnom metru;GKg/m³"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 gigakilograms per cubic meter"
-#~ msgstr "%1 gigakilograma po kubičnom metru"
-
-#~ msgctxt "amount in units (integer)"
-#~ msgid "%1 gigakilogram per cubic meter"
-#~ msgid_plural "%1 gigakilograms per cubic meter"
-#~ msgstr[0] "%1 gigakilogram po kubičnom metru"
-#~ msgstr[1] "%1 gigakilograma po kubičnom metru"
-#~ msgstr[2] "%1 gigakilograma po kubičnom metru"
-
-#~ msgctxt "density unit symbol"
-#~ msgid "MKg/m³"
-#~ msgstr "MKg/m³"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "megakilograms per cubic meter"
-#~ msgstr "megakilograma po kubičnom metru"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "megakilogram per cubic meter;megakilograms per cubic meter;MKg/m³"
-#~ msgstr ""
-#~ "megakilogram po kubičnom metru;megakilograma po kubičnom metru;MKg/m³"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 megakilograms per cubic meter"
-#~ msgstr "%1 megakilograma po kubičnom metru"
-
-#~ msgctxt "amount in units (integer)"
-#~ msgid "%1 megakilogram per cubic meter"
-#~ msgid_plural "%1 megakilograms per cubic meter"
-#~ msgstr[0] "%1 megakilogram po kubičnom metru"
-#~ msgstr[1] "%1 megakilograma po kubičnom metru"
-#~ msgstr[2] "%1 megakilograma po kubičnom metru"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "kilokilograms per cubic meter"
-#~ msgstr "kilokilograma po kubičnom metru"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "kilokilogram per cubic meter;kilokilograms per cubic meter;kKg/m³"
-#~ msgstr ""
-#~ "kilokilogram po kubičnom metru;kilokilograma po kubičnom metru;kKg/m³"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 kilokilograms per cubic meter"
-#~ msgstr "%1 kilokilograma po kubičnom metru"
-
-#~ msgctxt "amount in units (integer)"
-#~ msgid "%1 kilokilogram per cubic meter"
-#~ msgid_plural "%1 kilokilograms per cubic meter"
-#~ msgstr[0] "%1 kilokilogram po kubičnom metru"
-#~ msgstr[1] "%1 kilokilograma po kubičnom metru"
-#~ msgstr[2] "%1 kilokilograma po kubičnom metru"
-
-#~ msgctxt "density unit symbol"
-#~ msgid "hKg/m³"
-#~ msgstr "hKg/m³"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "hectokilograms per cubic meter"
-#~ msgstr "hektokilograma po kubičnom metru"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "hectokilogram per cubic meter;hectokilograms per cubic meter;hKg/m³"
-#~ msgstr ""
-#~ "hektokilogram po kubičnom metru;hektokilograma po kubičnom metru;hKg/m³"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 hectokilograms per cubic meter"
-#~ msgstr "%1 hektokilograma po kubičnom metru"
-
-#~ msgctxt "amount in units (integer)"
-#~ msgid "%1 hectokilogram per cubic meter"
-#~ msgid_plural "%1 hectokilograms per cubic meter"
-#~ msgstr[0] "%1 hektokilogram po kubičnom metru"
-#~ msgstr[1] "%1 hektokilograma po kubičnom metru"
-#~ msgstr[2] "%1 hektokilograma po kubičnom metru"
-
-#~ msgctxt "density unit symbol"
-#~ msgid "daKg/m³"
-#~ msgstr "daKg/m³"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "decakilograms per cubic meter"
-#~ msgstr "dekakilograma po kubičnom metru"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "decakilogram per cubic meter;decakilograms per cubic meter;daKg/m³"
-#~ msgstr ""
-#~ "dekakilogram po kubičnom metru;dekakilograma po kubičnom metru;daKg/m³"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 decakilograms per cubic meter"
-#~ msgstr "%1 dekakilograma po kubičnom metru"
-
-#~ msgctxt "amount in units (integer)"
-#~ msgid "%1 decakilogram per cubic meter"
-#~ msgid_plural "%1 decakilograms per cubic meter"
-#~ msgstr[0] "%1 dekakilogram po kubičnom metru"
-#~ msgstr[1] "%1 dekakilograma po kubičnom metru"
-#~ msgstr[2] "%1 dekakilograma po kubičnom metru"
-
-#~ msgctxt "density unit symbol"
-#~ msgid "Kg/m³"
-#~ msgstr "Kg/m³"
-
-#~ msgctxt "density unit symbol"
-#~ msgid "dKg/m³"
-#~ msgstr "dKg/m³"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "decikilograms per cubic meter"
-#~ msgstr "decikilograma po kubičnom metru"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "decikilogram per cubic meter;decikilograms per cubic meter;dKg/m³"
-#~ msgstr ""
-#~ "decikilogram po kubičnom metru;decikilograma po kubičnom metru;dKg/m³"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 decikilograms per cubic meter"
-#~ msgstr "%1 decikilograma po kubičnom metru"
-
-#~ msgctxt "amount in units (integer)"
-#~ msgid "%1 decikilogram per cubic meter"
-#~ msgid_plural "%1 decikilograms per cubic meter"
-#~ msgstr[0] "%1 decikilogram po kubičnom metru"
-#~ msgstr[1] "%1 decikilograma po kubičnom metru"
-#~ msgstr[2] "%1 decikilograma po kubičnom metru"
-
-#~ msgctxt "density unit symbol"
-#~ msgid "cKg/m³"
-#~ msgstr "cKg/m³"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "centikilograms per cubic meter"
-#~ msgstr "centikilograma po kubičnom metru"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "centikilogram per cubic meter;centikilograms per cubic meter;cKg/m³"
-#~ msgstr ""
-#~ "centikilogram po kubičnom metru;centikilograma po kubičnom metru;cKg/m³"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 centikilograms per cubic meter"
-#~ msgstr "%1 centikilograma po kubičnom metru"
-
-#~ msgctxt "amount in units (integer)"
-#~ msgid "%1 centikilogram per cubic meter"
-#~ msgid_plural "%1 centikilograms per cubic meter"
-#~ msgstr[0] "%1 centikilogram po kubičnom metru"
-#~ msgstr[1] "%1 centikilograma po kubičnom metru"
-#~ msgstr[2] "%1 centikilograma po kubičnom metru"
-
-#~ msgctxt "density unit symbol"
-#~ msgid "mKg/m³"
-#~ msgstr "mKg/m³"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "millikilograms per cubic meter"
-#~ msgstr "milikilograma po kubičnom metru"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "millikilogram per cubic meter;millikilograms per cubic meter;mKg/m³"
-#~ msgstr ""
-#~ "milikilogram po kubičnom metru;milikilograma po kubičnom metru;mKg/m³"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 millikilograms per cubic meter"
-#~ msgstr "%1 milikilograma po kubičnom metru"
-
-#~ msgctxt "amount in units (integer)"
-#~ msgid "%1 millikilogram per cubic meter"
-#~ msgid_plural "%1 millikilograms per cubic meter"
-#~ msgstr[0] "%1 milikilogram po kubičnom metru"
-#~ msgstr[1] "%1 milikilograma po kubičnom metru"
-#~ msgstr[2] "%1 milikilograma po kubičnom metru"
-
-#~ msgctxt "density unit symbol"
-#~ msgid "µKg/m³"
-#~ msgstr "µKg/m³"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "microkilograms per cubic meter"
-#~ msgstr "mikrokilograma po kubičnom metru"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid ""
-#~ "microkilogram per cubic meter;microkilograms per cubic meter;µKg/m³;uKg/m³"
-#~ msgstr ""
-#~ "mikrokilogram po kubičnom metru;mikrokilograma po kubičnom metru;µKg/m³;"
-#~ "uKg/m³"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 microkilograms per cubic meter"
-#~ msgstr "%1 mikrokilograma po kubičnom metru"
-
-#~ msgctxt "amount in units (integer)"
-#~ msgid "%1 microkilogram per cubic meter"
-#~ msgid_plural "%1 microkilograms per cubic meter"
-#~ msgstr[0] "%1 mikrokilogram po kubičnom metru"
-#~ msgstr[1] "%1 mikrokilograma po kubičnom metru"
-#~ msgstr[2] "%1 mikrokilograma po kubičnom metru"
-
-#~ msgctxt "density unit symbol"
-#~ msgid "nKg/m³"
-#~ msgstr "nKg/m³"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "nanokilograms per cubic meter"
-#~ msgstr "nanokilograma po kubičnom metru"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "nanokilogram per cubic meter;nanokilograms per cubic meter;nKg/m³"
-#~ msgstr ""
-#~ "nanokilogram po kubičnom metru;nanokilograma po kubičnom metru;nKg/m³"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 nanokilograms per cubic meter"
-#~ msgstr "%1 nanokilograma po kubičnom metru"
-
-#~ msgctxt "amount in units (integer)"
-#~ msgid "%1 nanokilogram per cubic meter"
-#~ msgid_plural "%1 nanokilograms per cubic meter"
-#~ msgstr[0] "%1 nanokilogram po kubičnom metru"
-#~ msgstr[1] "%1 nanokilograma po kubičnom metru"
-#~ msgstr[2] "%1 nanokilograma po kubičnom metru"
-
-#~ msgctxt "density unit symbol"
-#~ msgid "pKg/m³"
-#~ msgstr "pKg/m³"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "picokilograms per cubic meter"
-#~ msgstr "pikokilograma po kubičnom metru"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "picokilogram per cubic meter;picokilograms per cubic meter;pKg/m³"
-#~ msgstr ""
-#~ "pikokilogram po kubičnom metru;pikokilograma po kubičnom metru;pKg/m³"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 picokilograms per cubic meter"
-#~ msgstr "%1 pikokilograma po kubičnom metru"
-
-#~ msgctxt "amount in units (integer)"
-#~ msgid "%1 picokilogram per cubic meter"
-#~ msgid_plural "%1 picokilograms per cubic meter"
-#~ msgstr[0] "%1 pikokilogram po kubičnom metru"
-#~ msgstr[1] "%1 pikokilograma po kubičnom metru"
-#~ msgstr[2] "%1 pikokilograma po kubičnom metru"
-
-#~ msgctxt "density unit symbol"
-#~ msgid "fKg/m³"
-#~ msgstr "fKg/m³"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "femtokilograms per cubic meter"
-#~ msgstr "femtokilograma po kubičnom metru"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "femtokilogram per cubic meter;femtokilograms per cubic meter;fKg/m³"
-#~ msgstr ""
-#~ "femtokilogram po kubičnom metru;femtokilograma po kubičnom metru;fKg/m³"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 femtokilograms per cubic meter"
-#~ msgstr "%1 femtokilograma po kubičnom metru"
-
-#~ msgctxt "amount in units (integer)"
-#~ msgid "%1 femtokilogram per cubic meter"
-#~ msgid_plural "%1 femtokilograms per cubic meter"
-#~ msgstr[0] "%1 femtokilogram po kubičnom metru"
-#~ msgstr[1] "%1 femtokilograma po kubičnom metru"
-#~ msgstr[2] "%1 femtokilograma po kubičnom metru"
-
-#~ msgctxt "density unit symbol"
-#~ msgid "aKg/m³"
-#~ msgstr "aKg/m³"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "attokilograms per cubic meter"
-#~ msgstr "atokilograma po kubičnom metru"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "attokilogram per cubic meter;attokilograms per cubic meter;aKg/m³"
-#~ msgstr "atokilogram po kubičnom metru;atokilograma po kubičnom metru;aKg/m³"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 attokilograms per cubic meter"
-#~ msgstr "%1 atokilograma po kubičnom metru"
-
-#~ msgctxt "amount in units (integer)"
-#~ msgid "%1 attokilogram per cubic meter"
-#~ msgid_plural "%1 attokilograms per cubic meter"
-#~ msgstr[0] "%1 atokilogram po kubičnom metru"
-#~ msgstr[1] "%1 atokilograma po kubičnom metru"
-#~ msgstr[2] "%1 atokilograma po kubičnom metru"
-
-#~ msgctxt "density unit symbol"
-#~ msgid "zKg/m³"
-#~ msgstr "zKg/m³"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "zeptokilograms per cubic meter"
-#~ msgstr "zeptokilograma po kubičnom metru"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "zeptokilogram per cubic meter;zeptokilograms per cubic meter;zKg/m³"
-#~ msgstr ""
-#~ "zeptokilogram po kubičnom metru;zeptokilograma po kubičnom metru;zKg/m³"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 zeptokilograms per cubic meter"
-#~ msgstr "%1 zeptokilograma po kubičnom metru"
-
-#~ msgctxt "amount in units (integer)"
-#~ msgid "%1 zeptokilogram per cubic meter"
-#~ msgid_plural "%1 zeptokilograms per cubic meter"
-#~ msgstr[0] "%1 zeptokilogram po kubičnom metru"
-#~ msgstr[1] "%1 zeptokilograma po kubičnom metru"
-#~ msgstr[2] "%1 zeptokilograma po kubičnom metru"
-
-#~ msgctxt "density unit symbol"
-#~ msgid "yKg/m³"
-#~ msgstr "yKg/m³"
-
-#~ msgctxt "unit description in lists"
-#~ msgid "yoctokilograms per cubic meter"
-#~ msgstr "joktokilograma po kubičnom metru"
-
-#~ msgctxt "unit synonyms for matching user input"
-#~ msgid "yoctokilogram per cubic meter;yoctokilograms per cubic meter;yKg/m³"
-#~ msgstr ""
-#~ "joktokilogram po kubičnom metru;joktokilograma po kubičnom metru;yKg/m³"
-
-#~ msgctxt "amount in units (real)"
-#~ msgid "%1 yoctokilograms per cubic meter"
-#~ msgstr "%1 joktokilograma po kubičnom metru"
-
-#~ msgctxt "amount in units (integer)"
-#~ msgid "%1 yoctokilogram per cubic meter"
-#~ msgid_plural "%1 yoctokilograms per cubic meter"
-#~ msgstr[0] "%1 joktokilogram po kubičnom metru"
-#~ msgstr[1] "%1 joktokilograma po kubičnom metru"
-#~ msgstr[2] "%1 joktokilograma po kubičnom metru"
-
-#~ msgctxt "temperature unit symbol"
-#~ msgid "°R"
-#~ msgstr "°R"
-
-#~ msgctxt "amount in units (integer)"
-#~ msgid "%1 mach"
-#~ msgid_plural "%1 machs"
-#~ msgstr[0] "%1 mah"
-#~ msgstr[1] "%1 maha"
-#~ msgstr[2] "%1 maha"
diff -Nru kde-l10n-hr-4.12.97/messages/frameworks/solid_qt.po kde-l10n-hr-4.13.0/messages/frameworks/solid_qt.po
--- kde-l10n-hr-4.12.97/messages/frameworks/solid_qt.po 2014-01-25 21:41:22.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/frameworks/solid_qt.po 1970-01-01 00:00:00.000000000 +0000
@@ -1,846 +0,0 @@
-# Translation of solid_qt to Croatian
-#
-# Zarko Pintar , 2009.
-# Andrej Dundović , 2009, 2010.
-# Andrej Dundovic , 2010.
-# Marko Dimjasevic , 2011.
-# Marko Dimjašević , 2011.
-msgid ""
-msgstr ""
-"Project-Id-Version: solid_qt\n"
-"Report-Msgid-Bugs-To: \n"
-"POT-Creation-Date: 2014-01-24 18:50+0000\n"
-"PO-Revision-Date: 2011-07-22 16:19+0200\n"
-"Last-Translator: Marko Dimjašević \n"
-"Language-Team: Croatian \n"
-"Language: hr\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Generator: Lokalize 1.2\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n"
-"%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"X-Environment: kde\n"
-"X-Accelerator-Marker: &\n"
-"X-Text-Markup: qtrich\n"
-
-#: backends/fstab/fstabmanager.cpp:88
-msgid "Network Shares"
-msgstr "Mrežno dijeljenje"
-
-#: backends/fstab/fstabmanager.cpp:89
-msgid "NFS and SMB shares declared in your system"
-msgstr "NFS i SMB sustavi navedeni u Vašem sustavu"
-
-#: backends/hal/haldevice.cpp:72 backends/udisks/udisksdevice.cpp:60
-#, qt-format
-msgid "%1 TiB"
-msgstr "%1 TiB"
-
-#: backends/hal/haldevice.cpp:74 backends/udisks/udisksdevice.cpp:62
-#, qt-format
-msgid "%1 GiB"
-msgstr "%1 GiB"
-
-#: backends/hal/haldevice.cpp:80 backends/udisks/udisksdevice.cpp:68
-#, qt-format
-msgid "%1 MiB"
-msgstr "%1 MiB"
-
-#: backends/hal/haldevice.cpp:85 backends/udisks/udisksdevice.cpp:73
-#, qt-format
-msgid "%1 KiB"
-msgstr "%1 KiB"
-
-#: backends/hal/haldevice.cpp:89 backends/udisks/udisksdevice.cpp:77
-#, qt-format
-msgid "%1 B"
-msgstr "%1 B"
-
-#: backends/hal/haldevice.cpp:93 backends/udisks/udisksdevice.cpp:81
-msgid "0 B"
-msgstr "0 B"
-
-#: backends/hal/haldevice.cpp:353 backends/udev/udevdevice.cpp:205
-msgid "WLAN Interface"
-msgstr "WLAN sučelje"
-
-#: backends/hal/haldevice.cpp:355 backends/udev/udevdevice.cpp:207
-msgid "Networking Interface"
-msgstr "Mrežno sučelje"
-
-#: backends/hal/haldevice.cpp:574 backends/udisks/udisksdevice.cpp:238
-#: backends/udisks2/udisksdevice.cpp:273
-msgctxt "First item of %1%2 Drive sentence"
-msgid "CD-ROM"
-msgstr "CD-ROM"
-
-#: backends/hal/haldevice.cpp:576 backends/udisks/udisksdevice.cpp:240
-#: backends/udisks2/udisksdevice.cpp:275
-msgctxt "First item of %1%2 Drive sentence"
-msgid "CD-R"
-msgstr "CD-R"
-
-#: backends/hal/haldevice.cpp:579 backends/udisks/udisksdevice.cpp:243
-#: backends/udisks2/udisksdevice.cpp:278
-msgctxt "First item of %1%2 Drive sentence"
-msgid "CD-RW"
-msgstr "CD-RW"
-
-#: backends/hal/haldevice.cpp:583 backends/udisks/udisksdevice.cpp:247
-#: backends/udisks2/udisksdevice.cpp:282
-msgctxt "Second item of %1%2 Drive sentence"
-msgid "/DVD-ROM"
-msgstr "/DVD-ROM"
-
-#: backends/hal/haldevice.cpp:586 backends/udisks/udisksdevice.cpp:250
-#: backends/udisks2/udisksdevice.cpp:285
-msgctxt "Second item of %1%2 Drive sentence"
-msgid "/DVD+R"
-msgstr "/DVD+R"
-
-#: backends/hal/haldevice.cpp:589 backends/udisks/udisksdevice.cpp:253
-#: backends/udisks2/udisksdevice.cpp:288
-msgctxt "Second item of %1%2 Drive sentence"
-msgid "/DVD+RW"
-msgstr "/DVD+RW"
-
-#: backends/hal/haldevice.cpp:592 backends/udisks/udisksdevice.cpp:256
-#: backends/udisks2/udisksdevice.cpp:291
-msgctxt "Second item of %1%2 Drive sentence"
-msgid "/DVD-R"
-msgstr "/DVD-R"
-
-#: backends/hal/haldevice.cpp:595 backends/udisks/udisksdevice.cpp:259
-#: backends/udisks2/udisksdevice.cpp:294
-msgctxt "Second item of %1%2 Drive sentence"
-msgid "/DVD-RW"
-msgstr "/DVD-RW"
-
-#: backends/hal/haldevice.cpp:598 backends/udisks/udisksdevice.cpp:262
-#: backends/udisks2/udisksdevice.cpp:297
-msgctxt "Second item of %1%2 Drive sentence"
-msgid "/DVD-RAM"
-msgstr "/DVD-RAM"
-
-#: backends/hal/haldevice.cpp:602
-msgctxt "Second item of %1%2 Drive sentence"
-msgid "/DVD±R DL"
-msgstr "/DVD±R DL"
-
-#: backends/hal/haldevice.cpp:604
-msgctxt "Second item of %1%2 Drive sentence"
-msgid "/DVD±R"
-msgstr "/DVD±R"
-
-#: backends/hal/haldevice.cpp:609
-msgctxt "Second item of %1%2 Drive sentence"
-msgid "/DVD±RW DL"
-msgstr "/DVD±RW DL"
-
-#: backends/hal/haldevice.cpp:611
-msgctxt "Second item of %1%2 Drive sentence"
-msgid "/DVD±RW"
-msgstr "/DVD±RW"
-
-#: backends/hal/haldevice.cpp:615 backends/udisks/udisksdevice.cpp:279
-#: backends/udisks2/udisksdevice.cpp:314
-msgctxt "Second item of %1%2 Drive sentence"
-msgid "/BD-ROM"
-msgstr "/BD-ROM"
-
-#: backends/hal/haldevice.cpp:618 backends/udisks/udisksdevice.cpp:282
-#: backends/udisks2/udisksdevice.cpp:317
-msgctxt "Second item of %1%2 Drive sentence"
-msgid "/BD-R"
-msgstr "/BD-R"
-
-#: backends/hal/haldevice.cpp:621 backends/udisks/udisksdevice.cpp:285
-#: backends/udisks2/udisksdevice.cpp:320
-msgctxt "Second item of %1%2 Drive sentence"
-msgid "/BD-RE"
-msgstr "/BD-RE"
-
-#: backends/hal/haldevice.cpp:624 backends/udisks/udisksdevice.cpp:288
-#: backends/udisks2/udisksdevice.cpp:323
-msgctxt "Second item of %1%2 Drive sentence"
-msgid "/HD DVD-ROM"
-msgstr "/HD DVD-ROM"
-
-#: backends/hal/haldevice.cpp:627 backends/udisks/udisksdevice.cpp:291
-#: backends/udisks2/udisksdevice.cpp:326
-msgctxt "Second item of %1%2 Drive sentence"
-msgid "/HD DVD-R"
-msgstr "/HD DVD-R"
-
-#: backends/hal/haldevice.cpp:630 backends/udisks/udisksdevice.cpp:294
-#: backends/udisks2/udisksdevice.cpp:329
-msgctxt "Second item of %1%2 Drive sentence"
-msgid "/HD DVD-RW"
-msgstr "/HD DVD-RW"
-
-#: backends/hal/haldevice.cpp:634 backends/udisks/udisksdevice.cpp:298
-#: backends/udisks2/udisksdevice.cpp:333
-#, qt-format
-msgctxt ""
-"%1 is CD-ROM/CD-R/etc; %2 is '/DVD-ROM'/'/DVD-R'/etc (with leading slash)"
-msgid "External %1%2 Drive"
-msgstr "Eksterni %1%2 uređaj"
-
-#: backends/hal/haldevice.cpp:636 backends/udisks/udisksdevice.cpp:300
-#: backends/udisks2/udisksdevice.cpp:335
-#, qt-format
-msgctxt ""
-"%1 is CD-ROM/CD-R/etc; %2 is '/DVD-ROM'/'/DVD-R'/etc (with leading slash)"
-msgid "%1%2 Drive"
-msgstr "%1%2 uređaj"
-
-#: backends/hal/haldevice.cpp:644 backends/udisks/udisksdevice.cpp:308
-#: backends/udisks2/udisksdevice.cpp:343
-msgid "External Floppy Drive"
-msgstr "Eksterni disketni pogon"
-
-#: backends/hal/haldevice.cpp:646 backends/udisks/udisksdevice.cpp:310
-#: backends/udisks2/udisksdevice.cpp:345
-msgid "Floppy Drive"
-msgstr "Disketni pogon"
-
-#: backends/hal/haldevice.cpp:658 backends/hal/haldevice.cpp:861
-#: backends/udisks/udisksdevice.cpp:322 backends/udisks/udisksdevice.cpp:530
-#: backends/udisks2/udisksdevice.cpp:357 backends/udisks2/udisksdevice.cpp:565
-#, qt-format
-msgctxt "%1 is the size"
-msgid "%1 External Hard Drive"
-msgstr "%1 Eksterni tvrdi disk"
-
-#: backends/hal/haldevice.cpp:660 backends/hal/haldevice.cpp:863
-#: backends/udisks/udisksdevice.cpp:324 backends/udisks/udisksdevice.cpp:532
-#: backends/udisks2/udisksdevice.cpp:359 backends/udisks2/udisksdevice.cpp:567
-#, qt-format
-msgctxt "%1 is the size"
-msgid "%1 Hard Drive"
-msgstr "%1 Tvrdi disk"
-
-#: backends/hal/haldevice.cpp:664 backends/hal/haldevice.cpp:867
-#: backends/udisks/udisksdevice.cpp:328 backends/udisks/udisksdevice.cpp:536
-#: backends/udisks2/udisksdevice.cpp:363 backends/udisks2/udisksdevice.cpp:571
-msgid "External Hard Drive"
-msgstr "Vanjski tvrdi disk"
-
-#: backends/hal/haldevice.cpp:666 backends/hal/haldevice.cpp:869
-#: backends/udisks/udisksdevice.cpp:330 backends/udisks/udisksdevice.cpp:538
-#: backends/udisks2/udisksdevice.cpp:365 backends/udisks2/udisksdevice.cpp:573
-msgid "Hard Drive"
-msgstr "Tvrdi disk"
-
-#: backends/hal/haldevice.cpp:685 backends/udisks/udisksdevice.cpp:353
-#: backends/udisks2/udisksdevice.cpp:388
-#, qt-format
-msgctxt "%1 is the vendor, %2 is the model of the device"
-msgid "%1 %2"
-msgstr "%1 %2"
-
-#: backends/hal/haldevice.cpp:690 backends/udisks/udisksdevice.cpp:359
-#: backends/udisks2/udisksdevice.cpp:394
-msgid "Drive"
-msgstr "Disk"
-
-#: backends/hal/haldevice.cpp:719 backends/udisks/udisksdevice.cpp:388
-#: backends/udisks2/udisksdevice.cpp:424
-msgid "CD-ROM"
-msgstr "CD-ROM"
-
-#: backends/hal/haldevice.cpp:724 backends/udisks/udisksdevice.cpp:393
-#: backends/udisks2/udisksdevice.cpp:429
-msgid "Blank CD-R"
-msgstr "Prazan CD-R"
-
-#: backends/hal/haldevice.cpp:726 backends/udisks/udisksdevice.cpp:395
-#: backends/udisks2/udisksdevice.cpp:431
-msgid "CD-R"
-msgstr "CD-R"
-
-#: backends/hal/haldevice.cpp:732 backends/udisks/udisksdevice.cpp:401
-#: backends/udisks2/udisksdevice.cpp:437
-msgid "Blank CD-RW"
-msgstr "Prazan CD-RW"
-
-#: backends/hal/haldevice.cpp:734 backends/udisks/udisksdevice.cpp:403
-#: backends/udisks2/udisksdevice.cpp:439
-msgid "CD-RW"
-msgstr "CD-RW"
-
-#: backends/hal/haldevice.cpp:739 backends/udisks/udisksdevice.cpp:408
-#: backends/udisks2/udisksdevice.cpp:444
-msgid "DVD-ROM"
-msgstr "DVD-ROM"
-
-#: backends/hal/haldevice.cpp:744 backends/udisks/udisksdevice.cpp:413
-#: backends/udisks2/udisksdevice.cpp:449
-msgid "Blank DVD-RAM"
-msgstr "Prazan DVD-RAM"
-
-#: backends/hal/haldevice.cpp:746 backends/udisks/udisksdevice.cpp:415
-#: backends/udisks2/udisksdevice.cpp:451
-msgid "DVD-RAM"
-msgstr "DVD-RAM"
-
-#: backends/hal/haldevice.cpp:752 backends/udisks/udisksdevice.cpp:421
-#: backends/udisks2/udisksdevice.cpp:457
-msgid "Blank DVD-R"
-msgstr "Prazan DVD-R"
-
-#: backends/hal/haldevice.cpp:754 backends/udisks/udisksdevice.cpp:423
-#: backends/udisks2/udisksdevice.cpp:459
-msgid "DVD-R"
-msgstr "DVD-R"
-
-#: backends/hal/haldevice.cpp:760 backends/udisks/udisksdevice.cpp:429
-#: backends/udisks2/udisksdevice.cpp:465
-msgid "Blank DVD+R Dual-Layer"
-msgstr "Prazan DVD+R Dual-Layer"
-
-#: backends/hal/haldevice.cpp:762 backends/udisks/udisksdevice.cpp:431
-#: backends/udisks2/udisksdevice.cpp:467
-msgid "DVD+R Dual-Layer"
-msgstr "DVD+R Dual-Layer"
-
-#: backends/hal/haldevice.cpp:768 backends/udisks/udisksdevice.cpp:437
-#: backends/udisks2/udisksdevice.cpp:473
-msgid "Blank DVD-RW"
-msgstr "Prazan DVD-RW"
-
-#: backends/hal/haldevice.cpp:770 backends/udisks/udisksdevice.cpp:439
-#: backends/udisks2/udisksdevice.cpp:475
-msgid "DVD-RW"
-msgstr "DVD-RW"
-
-#: backends/hal/haldevice.cpp:776 backends/udisks/udisksdevice.cpp:445
-#: backends/udisks2/udisksdevice.cpp:481
-msgid "Blank DVD+R"
-msgstr "Prazan DVD+R"
-
-#: backends/hal/haldevice.cpp:778 backends/udisks/udisksdevice.cpp:447
-#: backends/udisks2/udisksdevice.cpp:483
-msgid "DVD+R"
-msgstr "DVD+R"
-
-#: backends/hal/haldevice.cpp:784 backends/udisks/udisksdevice.cpp:453
-#: backends/udisks2/udisksdevice.cpp:489
-msgid "Blank DVD+RW"
-msgstr "Prazan DVD+RW"
-
-#: backends/hal/haldevice.cpp:786 backends/udisks/udisksdevice.cpp:455
-#: backends/udisks2/udisksdevice.cpp:491
-msgid "DVD+RW"
-msgstr "DVD+RW"
-
-#: backends/hal/haldevice.cpp:792 backends/udisks/udisksdevice.cpp:461
-#: backends/udisks2/udisksdevice.cpp:497
-msgid "Blank DVD+RW Dual-Layer"
-msgstr "Prazan DVD+RW Dual-Layer"
-
-#: backends/hal/haldevice.cpp:794 backends/udisks/udisksdevice.cpp:463
-#: backends/udisks2/udisksdevice.cpp:499
-msgid "DVD+RW Dual-Layer"
-msgstr "DVD+RW Dual-Layer"
-
-#: backends/hal/haldevice.cpp:799 backends/udisks/udisksdevice.cpp:468
-#: backends/udisks2/udisksdevice.cpp:504
-msgid "BD-ROM"
-msgstr "BD-ROM"
-
-#: backends/hal/haldevice.cpp:804 backends/udisks/udisksdevice.cpp:473
-#: backends/udisks2/udisksdevice.cpp:509
-msgid "Blank BD-R"
-msgstr "Prazan BD-R"
-
-#: backends/hal/haldevice.cpp:806 backends/udisks/udisksdevice.cpp:475
-#: backends/udisks2/udisksdevice.cpp:511
-msgid "BD-R"
-msgstr "BD-R"
-
-#: backends/hal/haldevice.cpp:812 backends/udisks/udisksdevice.cpp:481
-#: backends/udisks2/udisksdevice.cpp:517
-msgid "Blank BD-RE"
-msgstr "Prazan BD-RE"
-
-#: backends/hal/haldevice.cpp:814 backends/udisks/udisksdevice.cpp:483
-#: backends/udisks2/udisksdevice.cpp:519
-msgid "BD-RE"
-msgstr "BD-RE"
-
-#: backends/hal/haldevice.cpp:819 backends/udisks/udisksdevice.cpp:488
-#: backends/udisks2/udisksdevice.cpp:524
-msgid "HD DVD-ROM"
-msgstr "HD DVD-ROM"
-
-#: backends/hal/haldevice.cpp:824 backends/udisks/udisksdevice.cpp:493
-#: backends/udisks2/udisksdevice.cpp:529
-msgid "Blank HD DVD-R"
-msgstr "Blank HD DVD-R"
-
-#: backends/hal/haldevice.cpp:826 backends/udisks/udisksdevice.cpp:495
-#: backends/udisks2/udisksdevice.cpp:531
-msgid "HD DVD-R"
-msgstr "HD DVD-R"
-
-#: backends/hal/haldevice.cpp:832 backends/udisks/udisksdevice.cpp:501
-#: backends/udisks2/udisksdevice.cpp:537
-msgid "Blank HD DVD-RW"
-msgstr "Blank HD DVD-RW"
-
-#: backends/hal/haldevice.cpp:834 backends/udisks/udisksdevice.cpp:503
-#: backends/udisks2/udisksdevice.cpp:539
-msgid "HD DVD-RW"
-msgstr "HD DVD-RW"
-
-#: backends/hal/haldevice.cpp:841 backends/udisks/udisksdevice.cpp:510
-#: backends/udisks2/udisksdevice.cpp:546
-msgid "Audio CD"
-msgstr "Audio CD"
-
-#: backends/hal/haldevice.cpp:854 backends/udisks/udisksdevice.cpp:523
-#, qt-format
-msgctxt "%1 is the size"
-msgid "%1 Encrypted Container"
-msgstr "%1 kriptirani spremnik"
-
-#: backends/hal/haldevice.cpp:856 backends/udisks/udisksdevice.cpp:525
-msgid "Encrypted Container"
-msgstr "Kriptirani spremnik"
-
-#: backends/hal/haldevice.cpp:874 backends/udisks/udisksdevice.cpp:543
-#: backends/udisks2/udisksdevice.cpp:578
-#, qt-format
-msgctxt "%1 is the size"
-msgid "%1 Removable Media"
-msgstr "%1 Izmjenljivi medij"
-
-#: backends/hal/haldevice.cpp:876 backends/udisks/udisksdevice.cpp:545
-#: backends/udisks2/udisksdevice.cpp:580
-#, qt-format
-msgctxt "%1 is the size"
-msgid "%1 Media"
-msgstr "%1 Medij"
-
-#: backends/kupnp/internetgatewaydevice1.cpp:62
-msgid "UPnP Internet Gateway Device"
-msgstr "UPnP Internet Gateway Device"
-
-#: backends/kupnp/kupnprootdevice.cpp:59
-msgid "UPnP devices"
-msgstr "UPnP uređaji"
-
-#: backends/kupnp/mediaserver1.cpp:78
-msgid "UPnP Media Server v1"
-msgstr "UPnP Media Server v1"
-
-#: backends/kupnp/mediaserver2.cpp:78
-msgid "UPnP Media Server v2"
-msgstr "UPnP Media Server v2"
-
-#: backends/kupnp/mediaserver3.cpp:78
-msgid "UPnP Media Server v3"
-msgstr "UPnP Media Server v3"
-
-#: backends/udev/udevdevice.cpp:179
-msgid "Computer"
-msgstr "Računalo"
-
-#: backends/udev/udevdevice.cpp:183
-msgid "Processor"
-msgstr "Procesor"
-
-#: backends/udev/udevdevice.cpp:194
-msgid "Portable Media Player"
-msgstr "Prenosivi multimedijalni uređaj"
-
-#: backends/udev/udevdevice.cpp:197
-msgid "Camera"
-msgstr "Kamera"
-
-#: backends/udev/udevmanager.cpp:254
-msgid "Devices"
-msgstr "Uređaji"
-
-#: backends/udev/udevmanager.cpp:255
-msgid "Devices declared in your system"
-msgstr "Uređaji navedeni u Vašem sustavu"
-
-#: backends/udisks/udisksdevice.cpp:756
-msgid "You are not authorized to perform this operation."
-msgstr "Nemate dopuštenje za izvršenje ove radnje."
-
-#: backends/udisks/udisksdevice.cpp:758
-msgid "The device is currently busy."
-msgstr "Ovaj je uređaj trenutno zauzet."
-
-#: backends/udisks/udisksdevice.cpp:760
-msgid "The requested operation has failed."
-msgstr "Tražena radnja nije uspjela."
-
-#: backends/udisks/udisksdevice.cpp:762
-msgid "The requested operation has been canceled."
-msgstr "Tražena radnja je prekinuta."
-
-#: backends/udisks/udisksdevice.cpp:764
-msgid "An invalid or malformed option has been given."
-msgstr "Dana je nevaljana ili neispravna opcija."
-
-#: backends/udisks/udisksdevice.cpp:766
-msgid "The kernel driver for this filesystem type is not available."
-msgstr "Nije dostupan upravljački program u jezgri za ovaj datotečni sustav."
-
-#: backends/udisks/udisksdevice.cpp:768
-msgid "An unspecified error has occurred."
-msgstr "Dogodila se nenavedena pogreška."
-
-#: backends/udisks/udisksmanager.cpp:89 backends/udisks2/udisksmanager.cpp:90
-msgid "Storage"
-msgstr "Pohrana"
-
-#: backends/udisks/udisksmanager.cpp:90 backends/udisks2/udisksmanager.cpp:91
-msgid "Storage devices"
-msgstr "Uređaji za pohranu"
-
-#: backends/udisks2/udisksdevice.cpp:63
-#, fuzzy, qt-format
-#| msgid "%1 TiB"
-msgctxt "udisksdevice"
-msgid "%1 TiB"
-msgstr "%1 TiB"
-
-#: backends/udisks2/udisksdevice.cpp:65
-#, fuzzy, qt-format
-#| msgid "%1 GiB"
-msgctxt "udisksdevice"
-msgid "%1 GiB"
-msgstr "%1 GiB"
-
-#: backends/udisks2/udisksdevice.cpp:71
-#, fuzzy, qt-format
-#| msgid "%1 MiB"
-msgctxt "udisksdevice"
-msgid "%1 MiB"
-msgstr "%1 MiB"
-
-#: backends/udisks2/udisksdevice.cpp:76
-#, fuzzy, qt-format
-#| msgid "%1 KiB"
-msgctxt "udisksdevice"
-msgid "%1 KiB"
-msgstr "%1 KiB"
-
-#: backends/udisks2/udisksdevice.cpp:80
-#, fuzzy, qt-format
-#| msgid "%1 B"
-msgctxt "udisksdevice"
-msgid "%1 B"
-msgstr "%1 B"
-
-#: backends/udisks2/udisksdevice.cpp:84
-#, fuzzy
-#| msgid "0 B"
-msgctxt "udisksdevice"
-msgid "0 B"
-msgstr "0 B"
-
-#: backends/udisks2/udisksdevice.cpp:248
-#, fuzzy
-#| msgid "Devices"
-msgid "Loop Device"
-msgstr "Uređaji"
-
-#: backends/udisks2/udisksdevice.cpp:250
-msgid "Swap Space"
-msgstr ""
-
-#: backends/udisks2/udisksdevice.cpp:558
-#, fuzzy, qt-format
-#| msgctxt "%1 is the size"
-#| msgid "%1 Encrypted Container"
-msgctxt "%1 is the size"
-msgid "%1 Encrypted Drive"
-msgstr "%1 kriptirani spremnik"
-
-#: backends/udisks2/udisksdevice.cpp:560
-#, fuzzy
-#| msgid "Encrypted Container"
-msgid "Encrypted Drive"
-msgstr "Kriptirani spremnik"
-
-#: backends/udisks2/udisksdevice.cpp:712
-#, fuzzy
-#| msgid "You are not authorized to perform this operation."
-msgid "You are not authorized to perform this operation"
-msgstr "Nemate dopuštenje za izvršenje ove radnje."
-
-#: backends/udisks2/udisksdevice.cpp:714
-#, fuzzy
-#| msgid "The device is currently busy."
-msgid "The device is currently busy"
-msgstr "Ovaj je uređaj trenutno zauzet."
-
-#: backends/udisks2/udisksdevice.cpp:716
-#, fuzzy
-#| msgid "The requested operation has failed."
-msgid "The requested operation has failed"
-msgstr "Tražena radnja nije uspjela."
-
-#: backends/udisks2/udisksdevice.cpp:718
-#, fuzzy
-#| msgid "The requested operation has been canceled."
-msgid "The requested operation has been canceled"
-msgstr "Tražena radnja je prekinuta."
-
-#: backends/udisks2/udisksdevice.cpp:720
-#, fuzzy
-#| msgid "An invalid or malformed option has been given."
-msgid "An invalid or malformed option has been given"
-msgstr "Dana je nevaljana ili neispravna opcija."
-
-#: backends/udisks2/udisksdevice.cpp:722
-#, fuzzy
-#| msgid "The kernel driver for this filesystem type is not available."
-msgid "The kernel driver for this filesystem type is not available"
-msgstr "Nije dostupan upravljački program u jezgri za ovaj datotečni sustav."
-
-#: backends/udisks2/udisksdevice.cpp:724
-#, fuzzy
-#| msgid "The device is currently busy."
-msgid "The device is already mounted"
-msgstr "Ovaj je uređaj trenutno zauzet."
-
-#: backends/udisks2/udisksdevice.cpp:726
-#, fuzzy
-#| msgid "The device is currently busy."
-msgid "The device is not mounted"
-msgstr "Ovaj je uređaj trenutno zauzet."
-
-#: backends/udisks2/udisksdevice.cpp:728
-#, fuzzy
-#| msgid "The device is currently busy."
-msgid "The device is mounted by another user"
-msgstr "Ovaj je uređaj trenutno zauzet."
-
-#: backends/udisks2/udisksdevice.cpp:730
-#, fuzzy
-#| msgid "The device is currently busy."
-msgid "The device is already unmounting"
-msgstr "Ovaj je uređaj trenutno zauzet."
-
-#: backends/udisks2/udisksdevice.cpp:732
-msgid "The operation timed out"
-msgstr ""
-
-#: backends/udisks2/udisksdevice.cpp:734
-msgid "The operation would wake up a disk that is in a deep-sleep state"
-msgstr ""
-
-#: backends/udisks2/udisksdevice.cpp:736
-#, fuzzy
-#| msgid "The requested operation has been canceled."
-msgid "The operation has already been canceled"
-msgstr "Tražena radnja je prekinuta."
-
-#: backends/udisks2/udisksdevice.cpp:738
-#, fuzzy
-#| msgid "An unspecified error has occurred."
-msgid "An unspecified error has occurred"
-msgstr "Dogodila se nenavedena pogreška."
-
-#: backends/upnp/upnpdevicemanager.cpp:103
-msgid "UPnP Devices"
-msgstr "UPnP uređaji"
-
-#: backends/upnp/upnpdevicemanager.cpp:104
-msgid "UPnP devices detected on your network"
-msgstr "UPnP uređaji otkriveni na Vašoj mreži"
-
-#: backends/upower/upowerdevice.cpp:105 backends/win/windevice.cpp:103
-#: backends/wmi/wmidevice.cpp:467
-msgid "A/C Adapter"
-msgstr "AC adapter"
-
-#: backends/upower/upowerdevice.cpp:107 backends/wmi/wmidevice.cpp:471
-#, qt-format
-msgctxt "%1 is battery technology"
-msgid "%1 Battery"
-msgstr "%1 baterija"
-
-#: backends/upower/upowerdevice.cpp:122 backends/win/windevice.cpp:175
-#: backends/wmi/wmibattery.cpp:95
-msgctxt "battery technology"
-msgid "Lithium Ion"
-msgstr "Litij-ion"
-
-#: backends/upower/upowerdevice.cpp:124 backends/wmi/wmibattery.cpp:97
-msgctxt "battery technology"
-msgid "Lithium Polymer"
-msgstr "Litij-polimer"
-
-#: backends/upower/upowerdevice.cpp:126
-msgctxt "battery technology"
-msgid "Lithium Iron Phosphate"
-msgstr "Litij-željezo fosfat"
-
-#: backends/upower/upowerdevice.cpp:128 backends/win/windevice.cpp:178
-#: backends/wmi/wmibattery.cpp:89
-msgctxt "battery technology"
-msgid "Lead Acid"
-msgstr "Olovo"
-
-#: backends/upower/upowerdevice.cpp:130 backends/win/windevice.cpp:181
-#: backends/wmi/wmibattery.cpp:91
-msgctxt "battery technology"
-msgid "Nickel Cadmium"
-msgstr "Nikal-kadmij"
-
-#: backends/upower/upowerdevice.cpp:132 backends/win/windevice.cpp:184
-#: backends/wmi/wmibattery.cpp:93
-msgctxt "battery technology"
-msgid "Nickel Metal Hydride"
-msgstr "Nikal-metal hidrid"
-
-#: backends/upower/upowerdevice.cpp:134 backends/win/winbattery.cpp:173
-#: backends/win/windevice.cpp:187 backends/wmi/wmibattery.cpp:99
-msgctxt "battery technology"
-msgid "Unknown"
-msgstr "Nepoznata"
-
-#: backends/upower/upowermanager.cpp:89
-msgid "Power Management"
-msgstr "Upravljanje potrošnjom energije"
-
-#: backends/upower/upowermanager.cpp:90
-msgid "Batteries and other sources of power"
-msgstr "Baterije i drugi izvori energije"
-
-#: deviceinterface.cpp:66
-msgctxt "Unknown device type"
-msgid "Unknown"
-msgstr "Nepoznato"
-
-#: deviceinterface.cpp:68
-msgctxt "Generic Interface device type"
-msgid "Generic Interface"
-msgstr "Opće sučelje"
-
-#: deviceinterface.cpp:70
-msgctxt "Processor device type"
-msgid "Processor"
-msgstr "Procesor"
-
-#: deviceinterface.cpp:72
-msgctxt "Block device type"
-msgid "Block"
-msgstr "Blok"
-
-#: deviceinterface.cpp:74
-msgctxt "Storage Access device type"
-msgid "Storage Access"
-msgstr "Pristup pohrani"
-
-#: deviceinterface.cpp:76
-msgctxt "Storage Drive device type"
-msgid "Storage Drive"
-msgstr "Disk za pohranu"
-
-#: deviceinterface.cpp:78
-msgctxt "Optical Drive device type"
-msgid "Optical Drive"
-msgstr "Optički disk"
-
-#: deviceinterface.cpp:80
-msgctxt "Storage Volume device type"
-msgid "Storage Volume"
-msgstr "Volumen za pohranu"
-
-#: deviceinterface.cpp:82
-msgctxt "Optical Disc device type"
-msgid "Optical Disc"
-msgstr "Optički disk"
-
-#: deviceinterface.cpp:84
-msgctxt "Camera device type"
-msgid "Camera"
-msgstr "Kamera"
-
-#: deviceinterface.cpp:86
-msgctxt "Portable Media Player device type"
-msgid "Portable Media Player"
-msgstr "Prenosivi Media Player"
-
-#: deviceinterface.cpp:88
-msgctxt "Network Interface device type"
-msgid "Network Interface"
-msgstr "Mrežno sučelje"
-
-#: deviceinterface.cpp:90
-msgctxt "Ac Adapter device type"
-msgid "Ac Adapter"
-msgstr "Ac Punjač"
-
-#: deviceinterface.cpp:92
-msgctxt "Battery device type"
-msgid "Battery"
-msgstr "Baterija"
-
-#: deviceinterface.cpp:94
-msgctxt "Button device type"
-msgid "Button"
-msgstr "Gumb"
-
-#: deviceinterface.cpp:96
-msgctxt "Audio Interface device type"
-msgid "Audio Interface"
-msgstr "Audio sučelje"
-
-#: deviceinterface.cpp:98
-msgctxt "Dvb Interface device type"
-msgid "Dvb Interface"
-msgstr "Dvb sučelje"
-
-#: deviceinterface.cpp:100
-msgctxt "Video device type"
-msgid "Video"
-msgstr "Video"
-
-#: deviceinterface.cpp:102
-msgctxt "Serial Interface device type"
-msgid "Serial Interface"
-msgstr "Serijsko sučelje"
-
-#: deviceinterface.cpp:104
-msgctxt "Smart Card Reader device type"
-msgid "Smart Card Reader"
-msgstr "Smart Card čitač"
-
-#: deviceinterface.cpp:106
-msgctxt "Internet Gateway device type"
-msgid "Internet Gateway Device"
-msgstr "Uređaj za pristup Internetu"
-
-#: deviceinterface.cpp:108
-msgctxt "Network Share device type"
-msgid "Network Share"
-msgstr "Mrežno dijeljenje"
-
-#: deviceinterface.cpp:110
-msgctxt "A keyboard"
-msgid "Keyboard"
-msgstr ""
-
-#: deviceinterface.cpp:112
-#, fuzzy
-#| msgid "UPnP Devices"
-msgctxt "A pointing device"
-msgid "PointingDevice"
-msgstr "UPnP uređaji"
-
-#~ msgid "Blank DVD-R Dual-Layer"
-#~ msgstr "Prazni DVD-R Dual-Layer"
-
-#~ msgid "DVD-R Dual-Layer"
-#~ msgstr "DVD-R Dual-Layer"
diff -Nru kde-l10n-hr-4.12.97/messages/frameworks/timezones4.po kde-l10n-hr-4.13.0/messages/frameworks/timezones4.po
--- kde-l10n-hr-4.12.97/messages/frameworks/timezones4.po 2014-01-25 21:41:22.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/frameworks/timezones4.po 1970-01-01 00:00:00.000000000 +0000
@@ -1,2953 +0,0 @@
-# Translation of timezones4 to Croatian
-#
-# Andrej Dundović , 2009.
-msgid ""
-msgstr ""
-"Project-Id-Version: timezones4 0\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-08-02 05:31+0200\n"
-"PO-Revision-Date: 2009-06-27 13:16+0200\n"
-"Last-Translator: Andrej Dundović \n"
-"Language-Team: Croatian \n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"Language: hr\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
-"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"X-Generator: Lokalize 0.3\n"
-"X-Environment: kde\n"
-"X-Accelerator-Marker: &\n"
-"X-Text-Markup: kde4\n"
-
-#: TIMEZONES:1
-msgid "Africa/Abidjan"
-msgstr "Afrika/Abidjan"
-
-#: TIMEZONES:2
-msgid "Africa/Accra"
-msgstr "Afrika/Accra"
-
-#: TIMEZONES:3
-msgid "Africa/Addis_Ababa"
-msgstr "Afrika/Adis_Abeba"
-
-#: TIMEZONES:4
-msgid "Africa/Algiers"
-msgstr "Afrika/Alžir"
-
-#: TIMEZONES:5
-msgid "Africa/Asmara"
-msgstr "Afrika/Asmara"
-
-#: TIMEZONES:6
-msgid "Africa/Asmera"
-msgstr "Afrika/Asmera"
-
-#: TIMEZONES:7
-msgid "Africa/Bamako"
-msgstr "Afrika/Bamako"
-
-#: TIMEZONES:8
-msgid "Africa/Bangui"
-msgstr "Afrika/Bangui"
-
-#: TIMEZONES:9
-msgid "Africa/Banjul"
-msgstr "Afrika/Banjul"
-
-#: TIMEZONES:10
-msgid "Africa/Bissau"
-msgstr "Afrika/Bissau"
-
-#: TIMEZONES:11
-msgid "Africa/Blantyre"
-msgstr "Afrika/Blantyre"
-
-#: TIMEZONES:12
-msgid "Africa/Brazzaville"
-msgstr "Afrika/Brazzaville"
-
-#: TIMEZONES:13
-msgid "Africa/Bujumbura"
-msgstr "Afrika/Bujumbura"
-
-#: TIMEZONES:14
-msgid "Africa/Cairo"
-msgstr "Afrika/Kairo"
-
-#: TIMEZONES:15
-msgid "Africa/Casablanca"
-msgstr "Afrika/Casablanca"
-
-#: TIMEZONES:16
-msgid "Africa/Ceuta"
-msgstr "Afrika/Ceuta"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:18
-msgid "Ceuta & Melilla"
-msgstr "Ceuta i Melilla"
-
-#: TIMEZONES:19
-msgid "Africa/Conakry"
-msgstr "Afrika/Conakry"
-
-#: TIMEZONES:20
-msgid "Africa/Dakar"
-msgstr "Afrika/Dakar"
-
-#: TIMEZONES:21
-msgid "Africa/Dar_es_Salaam"
-msgstr "Afrika/Dar_es_Salaam"
-
-#: TIMEZONES:22
-msgid "Africa/Djibouti"
-msgstr "Afrika/Djibouti"
-
-#: TIMEZONES:23
-msgid "Africa/Douala"
-msgstr "Afrika/Douala"
-
-#: TIMEZONES:24
-msgid "Africa/El_Aaiun"
-msgstr "Afrika/El_Aaiun"
-
-#: TIMEZONES:25
-msgid "Africa/Freetown"
-msgstr "Afrika/Freetown"
-
-#: TIMEZONES:26
-msgid "Africa/Gaborone"
-msgstr "Afrika/Gaborone"
-
-#: TIMEZONES:27
-msgid "Africa/Harare"
-msgstr "Afrika/Harare"
-
-#: TIMEZONES:28
-msgid "Africa/Johannesburg"
-msgstr "Afrika/Johannesburg"
-
-#: TIMEZONES:29
-msgid "Africa/Kampala"
-msgstr "Afrika/Kampala"
-
-#: TIMEZONES:30
-msgid "Africa/Khartoum"
-msgstr "Afrika/Khartoum"
-
-#: TIMEZONES:31
-msgid "Africa/Kigali"
-msgstr "Afrika/Kigali"
-
-#: TIMEZONES:32
-msgid "Africa/Kinshasa"
-msgstr "Afrika/Kinshasa"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:34
-msgid "west Dem. Rep. of Congo"
-msgstr "zapad Dem. Rep. Kongo"
-
-#: TIMEZONES:35
-msgid "Africa/Lagos"
-msgstr "Afrika/Lagos"
-
-#: TIMEZONES:36
-msgid "Africa/Libreville"
-msgstr "Afrika/Liberville"
-
-#: TIMEZONES:37
-msgid "Africa/Lome"
-msgstr "Afrika/Lome"
-
-#: TIMEZONES:38
-msgid "Africa/Luanda"
-msgstr "Afrika/Luanda"
-
-#: TIMEZONES:39
-msgid "Africa/Lubumbashi"
-msgstr "Afrika/Lubumbashi"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:41
-msgid "east Dem. Rep. of Congo"
-msgstr "istok Dem. Rep. Kongo"
-
-#: TIMEZONES:42
-msgid "Africa/Lusaka"
-msgstr "Afrika/Lusaka"
-
-#: TIMEZONES:43
-msgid "Africa/Malabo"
-msgstr "Afrika/Malabo"
-
-#: TIMEZONES:44
-msgid "Africa/Maputo"
-msgstr "Afrika/Maputo"
-
-#: TIMEZONES:45
-msgid "Africa/Maseru"
-msgstr "Afrika/Maseru"
-
-#: TIMEZONES:46
-msgid "Africa/Mbabane"
-msgstr "Afrika/Mbabane"
-
-#: TIMEZONES:47
-msgid "Africa/Mogadishu"
-msgstr "Afrika/Mogadishu"
-
-#: TIMEZONES:48
-msgid "Africa/Monrovia"
-msgstr "Afrika/Monrovia"
-
-#: TIMEZONES:49
-msgid "Africa/Nairobi"
-msgstr "Afrika/Nairobi"
-
-#: TIMEZONES:50
-msgid "Africa/Ndjamena"
-msgstr "Afrika/Ndjamena"
-
-#: TIMEZONES:51
-msgid "Africa/Niamey"
-msgstr "Afrika/Niamey"
-
-#: TIMEZONES:52
-msgid "Africa/Nouakchott"
-msgstr "Afrika/Nouakchott"
-
-#: TIMEZONES:53
-msgid "Africa/Ouagadougou"
-msgstr "Afrika/Ouagadougou"
-
-#: TIMEZONES:54
-msgid "Africa/Porto-Novo"
-msgstr "Afrika/Porto-Novo"
-
-#: TIMEZONES:55
-msgid "Africa/Pretoria"
-msgstr "Afrika/Pretoria"
-
-#: TIMEZONES:56
-msgid "Africa/Sao_Tome"
-msgstr "Afrika/Sao_Tome"
-
-#: TIMEZONES:57
-msgid "Africa/Timbuktu"
-msgstr "Afrika/Timbuktu"
-
-#: TIMEZONES:58
-msgid "Africa/Tripoli"
-msgstr "Afrika/Tripoli"
-
-#: TIMEZONES:59
-msgid "Africa/Tunis"
-msgstr "Afrika/Tunis"
-
-#: TIMEZONES:60
-msgid "Africa/Windhoek"
-msgstr "Afrika/Windhoek"
-
-#: TIMEZONES:61
-msgid "America/Adak"
-msgstr "Amerika/Adak"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:63 TIMEZONES:120 TIMEZONES:991
-msgid "Aleutian Islands"
-msgstr "Aleutski otoci"
-
-#: TIMEZONES:64
-msgid "America/Anchorage"
-msgstr "Amerika/Anchorage"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:66 TIMEZONES:988
-msgid "Alaska Time"
-msgstr "Aljaško vrijeme"
-
-#: TIMEZONES:67
-msgid "America/Anguilla"
-msgstr "Amerika/Anguilla"
-
-#: TIMEZONES:68
-msgid "America/Antigua"
-msgstr "Amerika/Antigua"
-
-#: TIMEZONES:69
-msgid "America/Araguaina"
-msgstr "Amerika/Araguaina"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:71
-msgid "Tocantins"
-msgstr "Tocantins"
-
-#: TIMEZONES:72
-msgid "America/Argentina/Buenos_Aires"
-msgstr "Amerika/Argentina/Buenos_Aires"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:74 TIMEZONES:141
-msgid "Buenos Aires (BA, CF)"
-msgstr "Buenos Aires (BA, CF)"
-
-#: TIMEZONES:75
-msgid "America/Argentina/Catamarca"
-msgstr "Amerika/Argentina/Catamarca"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:77 TIMEZONES:80 TIMEZONES:157
-msgid "Catamarca (CT), Chubut (CH)"
-msgstr "Catamarca (CT), Chubut (CH)"
-
-#: TIMEZONES:78
-msgid "America/Argentina/ComodRivadavia"
-msgstr "Amerika/Argentina/ComodRivadavia"
-
-#: TIMEZONES:81
-msgid "America/Argentina/Cordoba"
-msgstr "Amerika/Argentina/Cordoba"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:83 TIMEZONES:171 TIMEZONES:392
-msgid "most locations (CB, CC, CN, ER, FM, LP, MN, NQ, RN, SA, SE, SF)"
-msgstr "većina lokacija (CB, CC, CN, ER, FM, LP, MN, NQ, RN, SA, SE, SF)"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:85
-msgid "most locations (CB, CC, CN, ER, FM, MN, SE, SF)"
-msgstr "većina lokacija (CB, CC, CN, ER, FM, MN, SE, SF)"
-
-#: TIMEZONES:86
-msgid "America/Argentina/Jujuy"
-msgstr "Amerika/Argentina/Jujuy"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:88 TIMEZONES:276
-msgid "Jujuy (JY)"
-msgstr "Jujuy (JY)"
-
-#: TIMEZONES:89
-msgid "America/Argentina/La_Rioja"
-msgstr "Amerika/Argentina/La_Rioja"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:91
-msgid "La Rioja (LR)"
-msgstr "La Rioja (LR)"
-
-#: TIMEZONES:92
-msgid "America/Argentina/Mendoza"
-msgstr "Amerika/Argentina/Mendoza"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:94 TIMEZONES:311
-msgid "Mendoza (MZ)"
-msgstr "Mendoza (MZ)"
-
-#: TIMEZONES:95
-msgid "America/Argentina/Rio_Gallegos"
-msgstr "Amerika/Argentina/Rio_Gallegos"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:97
-msgid "Santa Cruz (SC)"
-msgstr "Santa Cruz (SC)"
-
-#: TIMEZONES:98
-msgid "America/Argentina/Salta"
-msgstr "Amerika/Argentina/Salta"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:100
-msgid "(SA, LP, NQ, RN)"
-msgstr "(SA, LP, NQ, RN)"
-
-#: TIMEZONES:101
-msgid "America/Argentina/San_Juan"
-msgstr "Amerika/Argentina/San_Juan"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:103
-msgid "San Juan (SJ)"
-msgstr "San Juan (SJ)"
-
-#: TIMEZONES:104
-msgid "America/Argentina/San_Luis"
-msgstr "Amerika/Argentina/San_Luis"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:106
-msgid "San Luis (SL)"
-msgstr "San Luis (SL)"
-
-#: TIMEZONES:107
-msgid "America/Argentina/Tucuman"
-msgstr "Amerika/Argentina/Tucuman"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:109
-msgid "Tucuman (TM)"
-msgstr "Tucuman (TM)"
-
-#: TIMEZONES:110
-msgid "America/Argentina/Ushuaia"
-msgstr "Amerika/Argentina/Ushuaia"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:112
-msgid "Tierra del Fuego (TF)"
-msgstr "Tierra del Fuego (TF)"
-
-#: TIMEZONES:113
-msgid "America/Aruba"
-msgstr "Amerika/Aruba"
-
-#: TIMEZONES:114
-msgid "America/Asuncion"
-msgstr "Amerika/Asuncion"
-
-#: TIMEZONES:115
-msgid "America/Atikokan"
-msgstr "Amerika/Atikokan"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:117 TIMEZONES:168
-msgid "Eastern Standard Time - Atikokan, Ontario and Southampton I, Nunavut"
-msgstr ""
-"Istočno standardno vrijeme – Atikokan, Ontario i Southampton I, Nunavut"
-
-#: TIMEZONES:118
-msgid "America/Atka"
-msgstr "Amerika/Atka"
-
-#: TIMEZONES:121
-msgid "America/Bahia"
-msgstr "Amerika/Bahia"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:123
-msgid "Bahia"
-msgstr "Bahia"
-
-#: TIMEZONES:124
-msgid "America/Barbados"
-msgstr "Amerika/Barbados"
-
-#: TIMEZONES:125
-msgid "America/Belem"
-msgstr "Amerika/Belem"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:127
-msgid "Amapa, E Para"
-msgstr "Amapa, E Para"
-
-#: TIMEZONES:128
-msgid "America/Belize"
-msgstr "Amerika/Belize"
-
-#: TIMEZONES:129
-msgid "America/Blanc-Sablon"
-msgstr "Amerika/Blanc-Sablon"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:131
-msgid "Atlantic Standard Time - Quebec - Lower North Shore"
-msgstr "Atlansko standardno vrijeme – Quebec – Lower North Shore"
-
-#: TIMEZONES:132
-msgid "America/Boa_Vista"
-msgstr "Amerika/Boa_Vista"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:134
-msgid "Roraima"
-msgstr "Roraima"
-
-#: TIMEZONES:135
-msgid "America/Bogota"
-msgstr "Amerika/Bogota"
-
-#: TIMEZONES:136
-msgid "America/Boise"
-msgstr "Amerika/Boise"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:138
-msgid "Mountain Time - south Idaho & east Oregon"
-msgstr "Planinsko vrijeme – južni Idaho & istočni Oregon"
-
-#: TIMEZONES:139
-msgid "America/Buenos_Aires"
-msgstr "Amerika/Buenos_Aires"
-
-#: TIMEZONES:142
-msgid "America/Calgary"
-msgstr "Amerika/Calgary"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:144 TIMEZONES:195 TIMEZONES:755
-msgid "Mountain Time - Alberta, east British Columbia & west Saskatchewan"
-msgstr ""
-"Planinsko vrijeme – Alberta, istočna Britanska Kolumbija & zapadni "
-"Saskatchewan"
-
-#: TIMEZONES:145
-msgid "America/Cambridge_Bay"
-msgstr "Amerika/Cambridge_Bay"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:147
-msgid "Mountain Time - west Nunavut"
-msgstr "Planinsko vrijeme – zapadni Nunavut"
-
-#: TIMEZONES:148
-msgid "America/Campo_Grande"
-msgstr "Amerika/Campo_Grande"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:150
-msgid "Mato Grosso do Sul"
-msgstr "Mato Grosso do Sul"
-
-#: TIMEZONES:151
-msgid "America/Cancun"
-msgstr "Amerika/Cancun"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:153
-msgid "Central Time - Quintana Roo"
-msgstr "Središnje vrijeme – Quintana Roo"
-
-#: TIMEZONES:154
-msgid "America/Caracas"
-msgstr "Amerika/Caracas"
-
-#: TIMEZONES:155
-msgid "America/Catamarca"
-msgstr "Amerika/Catamarca"
-
-#: TIMEZONES:158
-msgid "America/Cayenne"
-msgstr "Amerika/Cayenne"
-
-#: TIMEZONES:159
-msgid "America/Cayman"
-msgstr "Amerika/Cayman"
-
-#: TIMEZONES:160
-msgid "America/Chicago"
-msgstr "Amerika/Chicago"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:162 TIMEZONES:997
-msgid "Central Time"
-msgstr "Središnje vrijeme"
-
-#: TIMEZONES:163
-msgid "America/Chihuahua"
-msgstr "Amerika/Chihuahua"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:165
-msgid "Mountain Time - Chihuahua"
-msgstr "Planinsko vrijeme – Chihuahua"
-
-#: TIMEZONES:166
-msgid "America/Coral_Harbour"
-msgstr "Amerika/Coral_Harbour"
-
-#: TIMEZONES:169
-msgid "America/Cordoba"
-msgstr "Amerika/Cordoba"
-
-#: TIMEZONES:172
-msgid "America/Costa_Rica"
-msgstr "Amerika/Costa_Rica"
-
-#: TIMEZONES:173
-msgid "America/Cuiaba"
-msgstr "Amerika/Cuiaba"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:175
-msgid "Mato Grosso"
-msgstr "Mato Grosso"
-
-#: TIMEZONES:176
-msgid "America/Curacao"
-msgstr "Amerika/Curacao"
-
-#: TIMEZONES:177
-msgid "America/Danmarkshavn"
-msgstr "Amerika/Danmarkshavn"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:179
-msgid "east coast, north of Scoresbysund"
-msgstr "istočna obala, sjeverno od Scoresbysunda"
-
-#: TIMEZONES:180
-msgid "America/Dawson"
-msgstr "Amerika/Dawson"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:182
-msgid "Pacific Time - north Yukon"
-msgstr "Tihooceansko vrijeme – sjeverni Yukon"
-
-#: TIMEZONES:183
-msgid "America/Dawson_Creek"
-msgstr "Amerika/Dawson_Creek"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:185
-msgid ""
-"Mountain Standard Time - Dawson Creek & Fort Saint John, British Columbia"
-msgstr ""
-"Planinsko standardno vrijeme – Dawson Creek & Fort Saint John, Britanska "
-"Kolumbija"
-
-#: TIMEZONES:186
-msgid "America/Denver"
-msgstr "Amerika/Denver"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:188 TIMEZONES:894 TIMEZONES:1015
-msgid "Mountain Time"
-msgstr "Planinsko vrijeme"
-
-#: TIMEZONES:189
-msgid "America/Detroit"
-msgstr "Amerika/Detroit"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:191 TIMEZONES:1012
-msgid "Eastern Time - Michigan - most locations"
-msgstr "Istočno vrijeme – Michigan – većina lokacija"
-
-#: TIMEZONES:192
-msgid "America/Dominica"
-msgstr "Amerika/Dominica"
-
-#: TIMEZONES:193
-msgid "America/Edmonton"
-msgstr "Amerika/Edmonton"
-
-#: TIMEZONES:196
-msgid "America/Eirunepe"
-msgstr "Amerika/Eirunepe"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:198
-msgid "W Amazonas"
-msgstr "W Amazonas"
-
-#: TIMEZONES:199
-msgid "America/El_Salvador"
-msgstr "Amerika/El_Salvador"
-
-#: TIMEZONES:200
-msgid "America/Ensenada"
-msgstr "Amerika/Ensenada"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:202 TIMEZONES:293 TIMEZONES:432 TIMEZONES:879 TIMEZONES:1018
-msgid "Pacific Time"
-msgstr "Tihooceansko vrijeme"
-
-#: TIMEZONES:203
-msgid "America/Fort_Wayne"
-msgstr "Amerika/Fort_Wayne"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:205 TIMEZONES:238 TIMEZONES:266 TIMEZONES:1000
-msgid "Eastern Time - Indiana - most locations"
-msgstr "Istočno vrijeme – Indiana – većina lokacija"
-
-#: TIMEZONES:206
-msgid "America/Fortaleza"
-msgstr "Amerika/Fortaleza"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:208
-msgid "NE Brazil (MA, PI, CE, RN, PB)"
-msgstr "SI Brazil (MA, PI, CE, RN, PB)"
-
-#: TIMEZONES:209
-msgid "America/Fredericton"
-msgstr "Amerika/Fredericton"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:211 TIMEZONES:231 TIMEZONES:743
-msgid "Atlantic Time - Nova Scotia (most places), PEI"
-msgstr "Atlantsko vrijeme – Nova Škotska (većina lokacija), PEI"
-
-#: TIMEZONES:212
-msgid "America/Glace_Bay"
-msgstr "Amerika/Glace_Bay"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:214
-msgid "Atlantic Time - Nova Scotia - places that did not observe DST 1966-1971"
-msgstr ""
-"Atlantsko vrijeme – Nova Škotska – mjesta koja se nisu pratila ljetna "
-"računanja vremena od1966. do 1971."
-
-#: TIMEZONES:215
-msgid "America/Godthab"
-msgstr "Amerika/Godthab"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:217 TIMEZONES:398 TIMEZONES:487 TIMEZONES:624 TIMEZONES:627
-#: TIMEZONES:770 TIMEZONES:801 TIMEZONES:888 TIMEZONES:901 TIMEZONES:940
-msgid "most locations"
-msgstr "većina lokacija"
-
-#: TIMEZONES:218
-msgid "America/Goose_Bay"
-msgstr "Amerika/Goose_Bay"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:220
-msgid "Atlantic Time - Labrador - most locations"
-msgstr "Atlantsko vrijeme – Labrador – većina lokacija"
-
-#: TIMEZONES:221
-msgid "America/Grand_Turk"
-msgstr "Amerika/Grand_Turk"
-
-#: TIMEZONES:222
-msgid "America/Grenada"
-msgstr "Amerika/Grenada"
-
-#: TIMEZONES:223
-msgid "America/Guadeloupe"
-msgstr "Amerika/Guadaloupe"
-
-#: TIMEZONES:224
-msgid "America/Guatemala"
-msgstr "Amerika/Guatemala"
-
-#: TIMEZONES:225
-msgid "America/Guayaquil"
-msgstr "Amerika/Guayaquil"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:227 TIMEZONES:804 TIMEZONES:810 TIMEZONES:981
-msgid "mainland"
-msgstr "kontinent"
-
-#: TIMEZONES:228
-msgid "America/Guyana"
-msgstr "Amerika/Guyana"
-
-#: TIMEZONES:229
-msgid "America/Halifax"
-msgstr "Amerika/Halifax"
-
-#: TIMEZONES:232
-msgid "America/Havana"
-msgstr "Amerika/Havana"
-
-#: TIMEZONES:233
-msgid "America/Hermosillo"
-msgstr "Amerika/Hermosillo"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:235
-msgid "Mountain Standard Time - Sonora"
-msgstr "Planinsko standardno vrijeme – Sonora"
-
-#: TIMEZONES:236
-msgid "America/Indiana/Indianapolis"
-msgstr "Amerika/Indiana/Indianapolis"
-
-#: TIMEZONES:239
-msgid "America/Indiana/Knox"
-msgstr "Amerika/Indiana/Knox"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:241 TIMEZONES:288 TIMEZONES:1009
-msgid "Eastern Time - Indiana - Starke County"
-msgstr "Istočno vrijeme – Indiana – okrug Starke"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:243
-msgid "Central Time - Indiana - Starke County"
-msgstr "Središnje vrijeme – Indiana – okrug Starke"
-
-#: TIMEZONES:244
-msgid "America/Indiana/Marengo"
-msgstr "Amerika/Indiana/Marengo"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:246
-msgid "Eastern Time - Indiana - Crawford County"
-msgstr "Istočno vrijeme – Indiana – okrug Crawford"
-
-#: TIMEZONES:247
-msgid "America/Indiana/Petersburg"
-msgstr "Amerika/Indiana/Petersburg"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:249
-msgid "Central Time - Indiana - Pike County"
-msgstr "Središnje vrijeme – Indiana – okrug Pike"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:251
-msgid "Eastern Time - Indiana - Pike County"
-msgstr "Istočno vrijeme – Indiana – okrug Pike"
-
-#: TIMEZONES:252
-msgid "America/Indiana/Tell_City"
-msgstr "Amerika/Indiana/Tell_City"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:254
-msgid "Central Time - Indiana - Perry County"
-msgstr "Središnje vrijeme – Indiana – okrug Perry"
-
-#: TIMEZONES:255
-msgid "America/Indiana/Vevay"
-msgstr "Amerika/Indiana/Vevay"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:257
-msgid "Eastern Time - Indiana - Switzerland County"
-msgstr "Istočno vrijeme – Indiana – okrug Switzerland"
-
-#: TIMEZONES:258
-msgid "America/Indiana/Vincennes"
-msgstr "Amerika/Indiana/Vincennes"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:260
-msgid "Eastern Time - Indiana - Daviess, Dubois, Knox & Martin Counties"
-msgstr "Istočno vrijeme – Indiana – Daviess, Dubois, Knox & Martin Counties"
-
-#: TIMEZONES:261
-msgid "America/Indiana/Winamac"
-msgstr "Amerika/Indiana/Winamac"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:263
-msgid "Eastern Time - Indiana - Pulaski County"
-msgstr "Istočno vrijeme – Indiana – okrug Pulaski"
-
-#: TIMEZONES:264
-msgid "America/Indianapolis"
-msgstr "Amerika/Indianapolis"
-
-#: TIMEZONES:267
-msgid "America/Inuvik"
-msgstr "Amerika/Inuvik"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:269
-msgid "Mountain Time - west Northwest Territories"
-msgstr "Planinsko vrijeme – zapadni Sjevernozapadni teritorij"
-
-#: TIMEZONES:270
-msgid "America/Iqaluit"
-msgstr "Amerika/Iqaluit"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:272
-msgid "Eastern Time - east Nunavut - most locations"
-msgstr "Istočno vrijeme – istočni Nunavut – većina lokacija"
-
-#: TIMEZONES:273
-msgid "America/Jamaica"
-msgstr "Amerika/Jamaica"
-
-#: TIMEZONES:274
-msgid "America/Jujuy"
-msgstr "Amerika/Jujuy"
-
-#: TIMEZONES:277
-msgid "America/Juneau"
-msgstr "Amerika/Juneau"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:279
-msgid "Alaska Time - Alaska panhandle"
-msgstr "Aljaško vrijeme – Aljaska prevlaka"
-
-#: TIMEZONES:280
-msgid "America/Kentucky/Louisville"
-msgstr "Amerika/Kentucky/Louisville"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:282 TIMEZONES:296
-msgid "Eastern Time - Kentucky - Louisville area"
-msgstr "Istočno vrijeme – Kentucky – područje Louisville"
-
-#: TIMEZONES:283
-msgid "America/Kentucky/Monticello"
-msgstr "Amerika/Kentucky/Monticello"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:285
-msgid "Eastern Time - Kentucky - Wayne County"
-msgstr "Istočno vrijeme – Kentucky – okrug Wayne"
-
-#: TIMEZONES:286
-msgid "America/Knox_IN"
-msgstr "Amerika/Knox_IN"
-
-#: TIMEZONES:289
-msgid "America/La_Paz"
-msgstr "Amerika/La_Paz"
-
-#: TIMEZONES:290
-msgid "America/Lima"
-msgstr "Amerika/Lima"
-
-#: TIMEZONES:291
-msgid "America/Los_Angeles"
-msgstr "Amerika/Los_Angeles"
-
-#: TIMEZONES:294
-msgid "America/Louisville"
-msgstr "Amerika/Louisville"
-
-#: TIMEZONES:297
-msgid "America/Maceio"
-msgstr "Amerika/Maceio"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:299
-msgid "Alagoas, Sergipe"
-msgstr "Alagoas, Sergipe"
-
-#: TIMEZONES:300
-msgid "America/Managua"
-msgstr "Amerika/Managua"
-
-#: TIMEZONES:301
-msgid "America/Manaus"
-msgstr "Amerika/Manaus"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:303 TIMEZONES:740
-msgid "E Amazonas"
-msgstr "E Amazonas"
-
-#: TIMEZONES:304
-msgid "America/Marigot"
-msgstr "Amerika/Marigot"
-
-#: TIMEZONES:305
-msgid "America/Martinique"
-msgstr "Amerika/Martinique"
-
-#: TIMEZONES:306
-msgid "America/Mazatlan"
-msgstr "Amerika/Mazatlan"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:308 TIMEZONES:882
-msgid "Mountain Time - S Baja, Nayarit, Sinaloa"
-msgstr "Planinsko vrijeme – S Baja, Nayarit, Sinaloa"
-
-#: TIMEZONES:309
-msgid "America/Mendoza"
-msgstr "Amerika/Mendoza"
-
-#: TIMEZONES:312
-msgid "America/Menominee"
-msgstr "Amerika/Menominee"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:314
-msgid "Central Time - Michigan - Dickinson, Gogebic, Iron & Menominee Counties"
-msgstr ""
-"Središnje vrijeme – Michigan – okruzi Dickinson, Gogebic, Iron i Menominee"
-
-#: TIMEZONES:315
-msgid "America/Merida"
-msgstr "Amerika/Merida"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:317
-msgid "Central Time - Campeche, Yucatan"
-msgstr "Središnje vrijeme – Campeche, Yucatan"
-
-#: TIMEZONES:318
-msgid "America/Mexico_City"
-msgstr "Amerika/Mexico_City"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:320 TIMEZONES:885
-msgid "Central Time - most locations"
-msgstr "Središnje vrijeme – većina lokacija"
-
-#: TIMEZONES:321
-msgid "America/Miquelon"
-msgstr "Amerika/Miquelon"
-
-#: TIMEZONES:322
-msgid "America/Moncton"
-msgstr "Amerika/Moncton"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:324
-msgid "Atlantic Time - New Brunswick"
-msgstr "Atlantsko vrijeme – Novi Brunswick"
-
-#: TIMEZONES:325
-msgid "America/Monterrey"
-msgstr "Amerika/Monterrey"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:327
-msgid "Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas"
-msgstr "Središnje vrijeme – Coahuila, Durango, Nuevo Leon, Tamaulipas"
-
-#: TIMEZONES:328
-msgid "America/Montevideo"
-msgstr "Amerika/Montevideo"
-
-#: TIMEZONES:329
-msgid "America/Montreal"
-msgstr "Amerika/Montreal"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:331 TIMEZONES:354
-msgid "Eastern Time - Quebec - most locations"
-msgstr "Istočno vrijeme – Quebec – većina lokacija"
-
-#: TIMEZONES:332
-msgid "America/Montserrat"
-msgstr "Amerika/Montserrat"
-
-#: TIMEZONES:333
-msgid "America/Nassau"
-msgstr "Amerika/Nassau"
-
-#: TIMEZONES:334
-msgid "America/New_York"
-msgstr "Amerika/New_York"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:336 TIMEZONES:1003
-msgid "Eastern Time"
-msgstr "Istočno vrijeme"
-
-#: TIMEZONES:337
-msgid "America/Nipigon"
-msgstr "Amerika/Nipigon"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:339
-msgid ""
-"Eastern Time - Ontario & Quebec - places that did not observe DST 1967-1973"
-msgstr ""
-"Istočno vrijeme – Ontario & Quebec – mjesta koja se nisu pratila ljetna "
-"računanja vremena od 1967. od 1973."
-
-#: TIMEZONES:340
-msgid "America/Nome"
-msgstr "Amerika/Nome"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:342
-msgid "Alaska Time - west Alaska"
-msgstr "Aljaško vrijeme – zapadna Aljaska"
-
-#: TIMEZONES:343
-msgid "America/Noronha"
-msgstr "Amerika/Noronha"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:345 TIMEZONES:734
-msgid "Atlantic islands"
-msgstr "Atlantski otoci"
-
-#: TIMEZONES:346
-msgid "America/North_Dakota/Center"
-msgstr "Amerika/Sjeverna_Dakota/Sredina"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:348
-msgid "Central Time - North Dakota - Oliver County"
-msgstr "Središnje vrijeme – Indiana – okrug Oliver"
-
-#: TIMEZONES:349
-msgid "America/North_Dakota/New_Salem"
-msgstr "Amerika/Sjeverna_Dakota/New_Salem"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:351
-msgid "Central Time - North Dakota - Morton County (except Mandan area)"
-msgstr ""
-"Središnje vrijeme – Sjeverna Dakota – okrug Mortony (bez područja Mandan)"
-
-#: TIMEZONES:352
-msgid "America/Ontario"
-msgstr "Amerika/Ontario"
-
-#: TIMEZONES:355
-msgid "America/Panama"
-msgstr "Amerika/Panama"
-
-#: TIMEZONES:356
-msgid "America/Pangnirtung"
-msgstr "Amerika/Pangnirtung"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:358
-msgid "Eastern Time - Pangnirtung, Nunavut"
-msgstr "Istočno vrijeme – Pangnirtung, Nunavut"
-
-#: TIMEZONES:359
-msgid "America/Paramaribo"
-msgstr "Amerika/Paramari"
-
-#: TIMEZONES:360
-msgid "America/Phoenix"
-msgstr "Amerika/Phoenix"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:362 TIMEZONES:994
-msgid "Mountain Standard Time - Arizona"
-msgstr "Planinsko standardno vrijeme – Arizona"
-
-#: TIMEZONES:363
-msgid "America/Port-au-Prince"
-msgstr "Amerika/Port-au-Prince"
-
-#: TIMEZONES:364
-msgid "America/Port_of_Spain"
-msgstr "Amerika/Port_of_Spain"
-
-#: TIMEZONES:365
-msgid "America/Porto_Acre"
-msgstr "Amerika/Porto_Acre"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:367 TIMEZONES:389 TIMEZONES:731
-msgid "Acre"
-msgstr "Acre"
-
-#: TIMEZONES:368
-msgid "America/Porto_Velho"
-msgstr "Amerika/Porto_Velho"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:370
-msgid "Rondonia"
-msgstr "Rondonia"
-
-#: TIMEZONES:371
-msgid "America/Puerto_Rico"
-msgstr "Amerika/Puerto_Rico"
-
-#: TIMEZONES:372
-msgid "America/Rainy_River"
-msgstr "Amerika/Rainy_River"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:374
-msgid "Central Time - Rainy River & Fort Frances, Ontario"
-msgstr "Središnje vrijeme – Rainy River & Fort Frances, Ontario"
-
-#: TIMEZONES:375
-msgid "America/Rankin_Inlet"
-msgstr "Amerika/Rankin_Inlet"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:377
-msgid "Central Time - central Nunavut"
-msgstr "Središnje vrijeme – središnji Nunavut"
-
-#: TIMEZONES:378
-msgid "America/Recife"
-msgstr "Amerika/Recife"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:380
-msgid "Pernambuco"
-msgstr "Pernambuco"
-
-#: TIMEZONES:381
-msgid "America/Regina"
-msgstr "Amerika/Regina"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:383 TIMEZONES:405 TIMEZONES:749 TIMEZONES:764
-msgid "Central Standard Time - Saskatchewan - most locations"
-msgstr "Središnje standardno vrijeme – Saskatchewan – većina lokacija"
-
-#: TIMEZONES:384
-msgid "America/Resolute"
-msgstr "Amerika/Resolute"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:386
-msgid "Eastern Time - Resolute, Nunavut"
-msgstr "Istočno vrijeme – Resolute, Nunavut"
-
-#: TIMEZONES:387
-msgid "America/Rio_Branco"
-msgstr "Amerika/Rio_Branco"
-
-#: TIMEZONES:390
-msgid "America/Rosario"
-msgstr "Amerika/Rosario"
-
-#: TIMEZONES:393
-msgid "America/Santarem"
-msgstr "Amerika/Santarem"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:395
-msgid "W Para"
-msgstr "W Para"
-
-#: TIMEZONES:396
-msgid "America/Santiago"
-msgstr "Amerika/Santiago"
-
-#: TIMEZONES:399
-msgid "America/Santo_Domingo"
-msgstr "Amerika/Santo_Domingo"
-
-#: TIMEZONES:400
-msgid "America/Sao_Paulo"
-msgstr "Amerika/Sao_Paulo"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:402 TIMEZONES:737
-msgid "S & SE Brazil (GO, DF, MG, ES, RJ, SP, PR, SC, RS)"
-msgstr "J & JI Brazila (GO, DF, MG, ES, RJ, SP, PR, SC, RS)"
-
-#: TIMEZONES:403
-msgid "America/Saskatoon"
-msgstr "Amerika/Saskatoon"
-
-#: TIMEZONES:406
-msgid "America/Scoresbysund"
-msgstr "Amerika/Scoresbysund"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:408
-msgid "Scoresbysund / Ittoqqortoormiit"
-msgstr "Scoresbysund / Ittoqqortoormiit"
-
-#: TIMEZONES:409
-msgid "America/Shiprock"
-msgstr "Amerika/Shiprock"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:411
-msgid "Mountain Time - Navajo"
-msgstr "Planinsko vrijeme – Navajo"
-
-#: TIMEZONES:412
-msgid "America/St_Barthelemy"
-msgstr "Amerika/St_Barthelemy"
-
-#: TIMEZONES:413
-msgid "America/St_Johns"
-msgstr "Amerika/St_Johns"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:415 TIMEZONES:758
-msgid "Newfoundland Time, including SE Labrador"
-msgstr "Newfoundlandsko vrijeme, uključujući u JI Labrador"
-
-#: TIMEZONES:416
-msgid "America/St_Kitts"
-msgstr "Amerika/St_Kitts"
-
-#: TIMEZONES:417
-msgid "America/St_Lucia"
-msgstr "Amerika/St_Lucia"
-
-#: TIMEZONES:418
-msgid "America/St_Thomas"
-msgstr "Amerika/St_Thomas"
-
-#: TIMEZONES:419
-msgid "America/St_Vincent"
-msgstr "Amerika/St_Vincent"
-
-#: TIMEZONES:420
-msgid "America/Swift_Current"
-msgstr "Amerika/Swift_Current"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:422
-msgid "Central Standard Time - Saskatchewan - midwest"
-msgstr "Središnje standardno vrijeme – Saskatchewan – sredozapad"
-
-#: TIMEZONES:423
-msgid "America/Tegucigalpa"
-msgstr "Amerika/Tegucigalpa"
-
-#: TIMEZONES:424
-msgid "America/Thule"
-msgstr "Amerika/Thule"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:426
-msgid "Thule / Pituffik"
-msgstr "Thule / Pituffik"
-
-#: TIMEZONES:427
-msgid "America/Thunder_Bay"
-msgstr "Amerika/Thunder_Bay"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:429
-msgid "Eastern Time - Thunder Bay, Ontario"
-msgstr "Istočno vrijeme – Thunder Bay, Ontario"
-
-#: TIMEZONES:430
-msgid "America/Tijuana"
-msgstr "Amerika/Tijuana"
-
-#: TIMEZONES:433
-msgid "America/Toronto"
-msgstr "Amerika/Toronto"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:435 TIMEZONES:752
-msgid "Eastern Time - Ontario - most locations"
-msgstr "Istočno vrijeme – Ontario – većina lokacija"
-
-#: TIMEZONES:436
-msgid "America/Tortola"
-msgstr "Amerika/Tortola"
-
-#: TIMEZONES:437
-msgid "America/Vancouver"
-msgstr "Amerika/Vancouver"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:439 TIMEZONES:761
-msgid "Pacific Time - west British Columbia"
-msgstr "Tihooceansko vrijeme – zapadna Britanska Kolumbija"
-
-#: TIMEZONES:440
-msgid "America/Virgin"
-msgstr "Amerika/Virginija"
-
-#: TIMEZONES:441
-msgid "America/Whitehorse"
-msgstr "Amerika/Whitehorse"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:443 TIMEZONES:767
-msgid "Pacific Time - south Yukon"
-msgstr "Tihooceansko vrijeme – južni Yukon"
-
-#: TIMEZONES:444
-msgid "America/Winnipeg"
-msgstr "Amerika/Winnipeg"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:446 TIMEZONES:746
-msgid "Central Time - Manitoba & west Ontario"
-msgstr "Središnje vrijeme – Manitoba & zapadni Ontario"
-
-#: TIMEZONES:447
-msgid "America/Yakutat"
-msgstr "Amerika/Yakutat"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:449
-msgid "Alaska Time - Alaska panhandle neck"
-msgstr "Aljaško vrijeme – vrat Aljaskine prevlake"
-
-#: TIMEZONES:450
-msgid "America/Yellowknife"
-msgstr "Amerika/Yellowknife"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:452
-msgid "Mountain Time - central Northwest Territories"
-msgstr "Planinsko vrijeme – središnji Sjevernozapadni teritorij"
-
-#: TIMEZONES:453
-msgid "Antarctica/Casey"
-msgstr "Antarktika/Casey"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:455
-msgid "Casey Station, Bailey Peninsula"
-msgstr "Postaja Casey, Bailey Peninsula"
-
-#: TIMEZONES:456
-msgid "Antarctica/Davis"
-msgstr "Antarktika/Davis"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:458
-msgid "Davis Station, Vestfold Hills"
-msgstr "Postaja Davis, gorje Vestfold"
-
-#: TIMEZONES:459
-msgid "Antarctica/DumontDUrville"
-msgstr "Antarktika/DumontDUrville"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:461
-msgid "Dumont-d'Urville Station, Terre Adelie"
-msgstr "Postaja Dumont-d'Urville, Terre Adelie"
-
-#: TIMEZONES:462
-msgid "Antarctica/Mawson"
-msgstr "Antarktika/Mawson"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:464
-msgid "Mawson Station, Holme Bay"
-msgstr "Postaja Mawson, uvala Holme"
-
-#: TIMEZONES:465
-msgid "Antarctica/McMurdo"
-msgstr "Antarktika/McMurdo"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:467
-msgid "McMurdo Station, Ross Island"
-msgstr "Postaja McMurdo, otok Ross"
-
-#: TIMEZONES:468
-msgid "Antarctica/Palmer"
-msgstr "Antarktika/Palmer"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:470
-msgid "Palmer Station, Anvers Island"
-msgstr "Postaja Palmer, otok Anvers"
-
-#: TIMEZONES:471
-msgid "Antarctica/Rothera"
-msgstr "Antarktika/Rothera"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:473
-msgid "Rothera Station, Adelaide Island"
-msgstr "Postaja Rothera, otok Adelaide"
-
-#: TIMEZONES:474
-msgid "Antarctica/South_Pole"
-msgstr "Antarktika/Južni_pol"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:476
-msgid "Amundsen-Scott Station, South Pole"
-msgstr "Amundsen-Scott Station, South Pole"
-
-#: TIMEZONES:477
-msgid "Antarctica/Syowa"
-msgstr "Antarktika/Syowa"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:479
-msgid "Syowa Station, E Ongul I"
-msgstr "Postaja Syowa, E Ongul I"
-
-#: TIMEZONES:480
-msgid "Antarctica/Vostok"
-msgstr "Antarktika/Vostok"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:482
-msgid "Vostok Station, S Magnetic Pole"
-msgstr "Postaja Vostok, S magnetski pol"
-
-#: TIMEZONES:483
-msgid "Arctic/Longyearbyen"
-msgstr "Arktik/Longyearbyen"
-
-#: TIMEZONES:484
-msgid "Asia/Aden"
-msgstr "Azija/Aden"
-
-#: TIMEZONES:485
-msgid "Asia/Almaty"
-msgstr "Azija/Almaty"
-
-#: TIMEZONES:488
-msgid "Asia/Amman"
-msgstr "Azija/Amman"
-
-#: TIMEZONES:489
-msgid "Asia/Anadyr"
-msgstr "Azija/Anadyr"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:491
-msgid "Moscow+10 - Bering Sea"
-msgstr "Moskva+10 – Beringovo more"
-
-#: TIMEZONES:492
-msgid "Asia/Aqtau"
-msgstr "Azija/Aqtau"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:494
-msgid "Atyrau (Atirau, Gur'yev), Mangghystau (Mankistau)"
-msgstr "Atyrau (Atirau, Gur'yev), Mangghystau (Mankistau)"
-
-#: TIMEZONES:495
-msgid "Asia/Aqtobe"
-msgstr "Azija/Aqtobe"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:497
-msgid "Aqtobe (Aktobe)"
-msgstr "Aqtobe (Aktobe)"
-
-#: TIMEZONES:498
-msgid "Asia/Ashgabat"
-msgstr "Azija/Ashgabat"
-
-#: TIMEZONES:499
-msgid "Asia/Ashkhabad"
-msgstr "Azija/Ashkhabad"
-
-#: TIMEZONES:500
-msgid "Asia/Baghdad"
-msgstr "Azija/Bagdad"
-
-#: TIMEZONES:501
-msgid "Asia/Bahrain"
-msgstr "Azija/Bahrain"
-
-#: TIMEZONES:502
-msgid "Asia/Baku"
-msgstr "Azija/Baku"
-
-#: TIMEZONES:503
-msgid "Asia/Bangkok"
-msgstr "Azija/Bangkok"
-
-#: TIMEZONES:504
-msgid "Asia/Beijing"
-msgstr "Azija/Peking"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:506 TIMEZONES:607 TIMEZONES:897
-msgid "east China - Beijing, Guangdong, Shanghai, etc."
-msgstr "istočna China – Peking, Guangdong, Shanghai, itd."
-
-#: TIMEZONES:507
-msgid "Asia/Beirut"
-msgstr "Azija/Beirut"
-
-#: TIMEZONES:508
-msgid "Asia/Bishkek"
-msgstr "Azija/Bishkek"
-
-#: TIMEZONES:509
-msgid "Asia/Brunei"
-msgstr "Azija/Brunei"
-
-#: TIMEZONES:510
-msgid "Asia/Calcutta"
-msgstr "Azija/Kalkuta"
-
-#: TIMEZONES:511
-msgid "Asia/Choibalsan"
-msgstr "Azija/Choibalsan"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:513
-msgid "Dornod, Sukhbaatar"
-msgstr "Dornod, Sukhbaatar"
-
-#: TIMEZONES:514
-msgid "Asia/Chongqing"
-msgstr "Azija/Chongqing"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:516 TIMEZONES:519
-msgid "central China - Sichuan, Yunnan, Guangxi, Shaanxi, Guizhou, etc."
-msgstr "središnja Kina – Sichuan, Yunnan, Guangxi, Shaanxi, Guizhou, itd."
-
-#: TIMEZONES:517
-msgid "Asia/Chungking"
-msgstr "Azija/Chungking"
-
-#: TIMEZONES:520
-msgid "Asia/Colombo"
-msgstr "Azija/Colombo"
-
-#: TIMEZONES:521
-msgid "Asia/Dacca"
-msgstr "Azija/Dacca"
-
-#: TIMEZONES:522
-msgid "Asia/Damascus"
-msgstr "Azija/Damascus"
-
-#: TIMEZONES:523
-msgid "Asia/Dhaka"
-msgstr "Azija/Dhaka"
-
-#: TIMEZONES:524
-msgid "Asia/Dili"
-msgstr "Azija/Dili"
-
-#: TIMEZONES:525
-msgid "Asia/Dubai"
-msgstr "Azija/Dubai"
-
-#: TIMEZONES:526
-msgid "Asia/Dushanbe"
-msgstr "Azija/Dušanbe"
-
-#: TIMEZONES:527
-msgid "Asia/Gaza"
-msgstr "Azija/Gaza"
-
-#: TIMEZONES:528
-msgid "Asia/Harbin"
-msgstr "Azija/Harbin"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:530
-msgid "Heilongjiang (except Mohe), Jilin"
-msgstr "Heilongjiang (bez Mohe), Jilin"
-
-#: TIMEZONES:531
-msgid "Asia/Ho_Chi_Minh"
-msgstr "Azija/Ho_Chi_Minh"
-
-#: TIMEZONES:532
-msgid "Asia/Hong_Kong"
-msgstr "Azija/Hong_Kong"
-
-#: TIMEZONES:533
-msgid "Asia/Hovd"
-msgstr "Azija/Hovd"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:535
-msgid "Bayan-Olgiy, Govi-Altai, Hovd, Uvs, Zavkhan"
-msgstr "Bayan-Olgiy, Govi-Altai, Hovd, Uvs, Zavkhan"
-
-#: TIMEZONES:536
-msgid "Asia/Irkutsk"
-msgstr "Azija/Irkutsk"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:538
-msgid "Moscow+05 - Lake Baikal"
-msgstr "Moskva+05 – Bajkalsko jezero"
-
-#: TIMEZONES:539
-msgid "Asia/Jakarta"
-msgstr "Azija/Jakarta"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:541
-msgid "Java & Sumatra"
-msgstr "Java & Sumatra"
-
-#: TIMEZONES:542
-msgid "Asia/Jayapura"
-msgstr "Azija/Jayapura"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:544
-msgid "Irian Jaya & the Moluccas"
-msgstr "Irian Jaya & the Moluccas"
-
-#: TIMEZONES:545
-msgid "Asia/Jerusalem"
-msgstr "Azija/Jeruzalem"
-
-#: TIMEZONES:546
-msgid "Asia/Kabul"
-msgstr "Azija/Kabul"
-
-#: TIMEZONES:547
-msgid "Asia/Kamchatka"
-msgstr "Azija/Kamčatka"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:549
-msgid "Moscow+09 - Kamchatka"
-msgstr "Moskva+09 – Kamčatka"
-
-#: TIMEZONES:550
-msgid "Asia/Karachi"
-msgstr "Azija/Karachi"
-
-#: TIMEZONES:551
-msgid "Asia/Kashgar"
-msgstr "Azija/Kashgar"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:553
-msgid "west Tibet & Xinjiang"
-msgstr "zapadni Tibet & Xinjiang"
-
-#: TIMEZONES:554
-msgid "Asia/Katmandu"
-msgstr "Azija/Katmandu"
-
-#: TIMEZONES:555
-msgid "Asia/Kolkata"
-msgstr "Azija/Kolkata"
-
-#: TIMEZONES:556
-msgid "Asia/Krasnoyarsk"
-msgstr "Azija/Krasnojarsk"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:558
-msgid "Moscow+04 - Yenisei River"
-msgstr "Moskva+04 – rijeka Jenisej"
-
-#: TIMEZONES:559
-msgid "Asia/Kuala_Lumpur"
-msgstr "Azija/Kuala_Lumpur"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:561
-msgid "peninsular Malaysia"
-msgstr "poluotočna Malezija"
-
-#: TIMEZONES:562
-msgid "Asia/Kuching"
-msgstr "Azija/Kuching"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:564
-msgid "Sabah & Sarawak"
-msgstr "Sabah & Sarawak"
-
-#: TIMEZONES:565
-msgid "Asia/Kuwait"
-msgstr "Azija/Kuvajt"
-
-#: TIMEZONES:566
-msgid "Asia/Macao"
-msgstr "Azija/Macao"
-
-#: TIMEZONES:567
-msgid "Asia/Macau"
-msgstr "Azija/Macau"
-
-#: TIMEZONES:568
-msgid "Asia/Magadan"
-msgstr "Azija/Magadan"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:570
-msgid "Moscow+08 - Magadan"
-msgstr "Moskva+08 – Magadan"
-
-#: TIMEZONES:571
-msgid "Asia/Makassar"
-msgstr "Azija/Makassar"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:573 TIMEZONES:621
-msgid "east & south Borneo, Celebes, Bali, Nusa Tengarra, west Timor"
-msgstr "istok i jug Bornea, Celebes, Bali, Nusa Tengarra, zapadni Timor"
-
-#: TIMEZONES:574
-msgid "Asia/Manila"
-msgstr "Azija/Manila"
-
-#: TIMEZONES:575
-msgid "Asia/Muscat"
-msgstr "Azija/Muscat"
-
-#: TIMEZONES:576
-msgid "Asia/Nicosia"
-msgstr "Azija/Nicosia"
-
-#: TIMEZONES:577
-msgid "Asia/Novosibirsk"
-msgstr "Azija/Novosibirsk"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:579
-msgid "Moscow+03 - Novosibirsk"
-msgstr "Moskva+03 – Novosibirsk"
-
-#: TIMEZONES:580
-msgid "Asia/Omsk"
-msgstr "Azija/Omsk"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:582
-msgid "Moscow+03 - west Siberia"
-msgstr "Moskva+03 – zapadni Sibir"
-
-#: TIMEZONES:583
-msgid "Asia/Oral"
-msgstr "Azija/Oral"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:585
-msgid "West Kazakhstan"
-msgstr "Zapadni Kazahstan"
-
-#: TIMEZONES:586
-msgid "Asia/Phnom_Penh"
-msgstr "Azija/Phnom_Penh"
-
-#: TIMEZONES:587
-msgid "Asia/Pontianak"
-msgstr "Azija/Pontianak"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:589
-msgid "west & central Borneo"
-msgstr "zapadni i središnji Borneo"
-
-#: TIMEZONES:590
-msgid "Asia/Pyongyang"
-msgstr "Azija/Pyongyang"
-
-#: TIMEZONES:591
-msgid "Asia/Qatar"
-msgstr "Azija/Qatar"
-
-#: TIMEZONES:592
-msgid "Asia/Qyzylorda"
-msgstr "Azija/Qyzylorda"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:594
-msgid "Qyzylorda (Kyzylorda, Kzyl-Orda)"
-msgstr "Qyzylorda (Kyzylorda, Kzyl-Orda)"
-
-#: TIMEZONES:595
-msgid "Asia/Rangoon"
-msgstr "Azija/Rangoon"
-
-#: TIMEZONES:596
-msgid "Asia/Riyadh"
-msgstr "Azija/Riyadh"
-
-#: TIMEZONES:597
-msgid "Asia/Saigon"
-msgstr "Azija/Saigon"
-
-#: TIMEZONES:598
-msgid "Asia/Sakhalin"
-msgstr "Azija/Sahalin"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:600
-msgid "Moscow+07 - Sakhalin Island"
-msgstr "Moskva+7 – otok Sahalin"
-
-#: TIMEZONES:601
-msgid "Asia/Samarkand"
-msgstr "Azija/Samarkand"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:603
-msgid "west Uzbekistan"
-msgstr "zapadni Uzbekistan"
-
-#: TIMEZONES:604
-msgid "Asia/Seoul"
-msgstr "Azija/Seul"
-
-#: TIMEZONES:605
-msgid "Asia/Shanghai"
-msgstr "Azijia/Shanghai"
-
-#: TIMEZONES:608
-msgid "Asia/Singapore"
-msgstr "Azija/Singapore"
-
-#: TIMEZONES:609
-msgid "Asia/Taipei"
-msgstr "Azija/Taipei"
-
-#: TIMEZONES:610
-msgid "Asia/Tashkent"
-msgstr "Azija/Taškent"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:612
-msgid "east Uzbekistan"
-msgstr "istočni Uzbekistan"
-
-#: TIMEZONES:613
-msgid "Asia/Tbilisi"
-msgstr "Azija/Tbilisi"
-
-#: TIMEZONES:614
-msgid "Asia/Tehran"
-msgstr "Azija/Teheran"
-
-#: TIMEZONES:615
-msgid "Asia/Tel_Aviv"
-msgstr "Azija/Tel_Aviv"
-
-#: TIMEZONES:616
-msgid "Asia/Thimbu"
-msgstr "Azija/Thimbu"
-
-#: TIMEZONES:617
-msgid "Asia/Thimphu"
-msgstr "Azija/Thimphu"
-
-#: TIMEZONES:618
-msgid "Asia/Tokyo"
-msgstr "Azija/Tokio"
-
-#: TIMEZONES:619
-msgid "Asia/Ujung_Pandang"
-msgstr "Azija/Ujung_Pandang"
-
-#: TIMEZONES:622
-msgid "Asia/Ulaanbaatar"
-msgstr "Azija/Ulaanbaatar"
-
-#: TIMEZONES:625
-msgid "Asia/Ulan_Bator"
-msgstr "Azija/Ulan_Bator"
-
-#: TIMEZONES:628
-msgid "Asia/Urumqi"
-msgstr "Azija/Urumqi"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:630
-msgid "most of Tibet & Xinjiang"
-msgstr "većina Tibeta i Xinjianga"
-
-#: TIMEZONES:631
-msgid "Asia/Vientiane"
-msgstr "Azija/Vientiane"
-
-#: TIMEZONES:632
-msgid "Asia/Vladivostok"
-msgstr "Azija/Vladivostok"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:634
-msgid "Moscow+07 - Amur River"
-msgstr "Moskva+07 – rijeka Armur"
-
-#: TIMEZONES:635
-msgid "Asia/Yakutsk"
-msgstr "Azija/Jakutsk"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:637
-msgid "Moscow+06 - Lena River"
-msgstr "Moskva+06 – rijeka Lena"
-
-#: TIMEZONES:638
-msgid "Asia/Yekaterinburg"
-msgstr "Azija/Jekaterinburg"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:640
-msgid "Moscow+02 - Urals"
-msgstr "Moskva+02 – Ural"
-
-#: TIMEZONES:641
-msgid "Asia/Yerevan"
-msgstr "Azija/Jerevan"
-
-#: TIMEZONES:642
-msgid "Atlantic/Azores"
-msgstr "Atlantik/Azores"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:644
-msgid "Azores"
-msgstr "Azori"
-
-#: TIMEZONES:645
-msgid "Atlantic/Bermuda"
-msgstr "Atlantik/Bermuda"
-
-#: TIMEZONES:646
-msgid "Atlantic/Canary"
-msgstr "Atlantik/Kanari"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:648
-msgid "Canary Islands"
-msgstr "Kanarski otoci"
-
-#: TIMEZONES:649
-msgid "Atlantic/Cape_Verde"
-msgstr "Atlantik/Cape_Verde"
-
-#: TIMEZONES:650
-msgid "Atlantic/Faeroe"
-msgstr "Atlantik/Faeroe"
-
-#: TIMEZONES:651
-msgid "Atlantic/Faroe"
-msgstr "Atlantik/Faroe"
-
-#: TIMEZONES:652
-msgid "Atlantic/Jan_Mayen"
-msgstr "Atlantik/Jan_Mayen"
-
-#: TIMEZONES:653
-msgid "Atlantic/Madeira"
-msgstr "Atlantik/Madeira"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:655
-msgid "Madeira Islands"
-msgstr "Otoci Madeira"
-
-#: TIMEZONES:656
-msgid "Atlantic/Reykjavik"
-msgstr "Atlantik/Reykjavik"
-
-#: TIMEZONES:657
-msgid "Atlantic/South_Georgia"
-msgstr "Atlantik/Južna_Georgia"
-
-#: TIMEZONES:658
-msgid "Atlantic/St_Helena"
-msgstr "Atlantik/Sv._Helena"
-
-#: TIMEZONES:659
-msgid "Atlantic/Stanley"
-msgstr "Atlantik/Stanley"
-
-#: TIMEZONES:660
-msgid "Australia/ACT"
-msgstr "Australija/ACT"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:662 TIMEZONES:674 TIMEZONES:701 TIMEZONES:716
-msgid "New South Wales - most locations"
-msgstr "Novi južni Wales – većina lokacija"
-
-#: TIMEZONES:663
-msgid "Australia/Adelaide"
-msgstr "Australija/Adelaide"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:665 TIMEZONES:713
-msgid "South Australia"
-msgstr "Južna Australija"
-
-#: TIMEZONES:666
-msgid "Australia/Brisbane"
-msgstr "Australija/Brisbane"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:668 TIMEZONES:710
-msgid "Queensland - most locations"
-msgstr "Queensland – većina lokacija"
-
-#: TIMEZONES:669
-msgid "Australia/Broken_Hill"
-msgstr "Australija/Broken_Hill"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:671 TIMEZONES:728
-msgid "New South Wales - Yancowinna"
-msgstr "Novi južni Wales – Yancowinna"
-
-#: TIMEZONES:672
-msgid "Australia/Canberra"
-msgstr "Australija/Canberra"
-
-#: TIMEZONES:675
-msgid "Australia/Currie"
-msgstr "Australija/Currie"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:677
-msgid "Tasmania - King Island"
-msgstr "Tasmanija – Kraljevski otok"
-
-#: TIMEZONES:678
-msgid "Australia/Darwin"
-msgstr "Australija/Darwin"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:680 TIMEZONES:704
-msgid "Northern Territory"
-msgstr "Sjeverni teritorij"
-
-#: TIMEZONES:681
-msgid "Australia/Eucla"
-msgstr "Australija/Eucla"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:683
-msgid "Western Australia - Eucla area"
-msgstr "Zapadna Australija – područje Eucla"
-
-#: TIMEZONES:684
-msgid "Australia/Hobart"
-msgstr "Australija/Hobart"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:686 TIMEZONES:719
-msgid "Tasmania - most locations"
-msgstr "Tasmanija – većina lokacija"
-
-#: TIMEZONES:687
-msgid "Australia/LHI"
-msgstr "Australija/LHI"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:689 TIMEZONES:695
-msgid "Lord Howe Island"
-msgstr "Lord Howe otoci"
-
-#: TIMEZONES:690
-msgid "Australia/Lindeman"
-msgstr "Australija/Lindeman"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:692
-msgid "Queensland - Holiday Islands"
-msgstr "Queensland – Blagdanski otoci"
-
-#: TIMEZONES:693
-msgid "Australia/Lord_Howe"
-msgstr "Australija/Lord_Howe"
-
-#: TIMEZONES:696
-msgid "Australia/Melbourne"
-msgstr "Australija/Melbourne"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:698 TIMEZONES:722
-msgid "Victoria"
-msgstr "Victoria"
-
-#: TIMEZONES:699
-msgid "Australia/NSW"
-msgstr "Australija/NSW"
-
-#: TIMEZONES:702
-msgid "Australia/North"
-msgstr "Australija/North"
-
-#: TIMEZONES:705
-msgid "Australia/Perth"
-msgstr "Australija/Perth"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:707 TIMEZONES:725
-msgid "Western Australia - most locations"
-msgstr "Zapadna Australija – većina lokacija"
-
-#: TIMEZONES:708
-msgid "Australia/Queensland"
-msgstr "Australija/Queensland"
-
-#: TIMEZONES:711
-msgid "Australia/South"
-msgstr "Australija/Jug"
-
-#: TIMEZONES:714
-msgid "Australia/Sydney"
-msgstr "Australija/Sydney"
-
-#: TIMEZONES:717
-msgid "Australia/Tasmania"
-msgstr "Australija/Tasmania"
-
-#: TIMEZONES:720
-msgid "Australia/Victoria"
-msgstr "Australija/Victoria"
-
-#: TIMEZONES:723
-msgid "Australia/West"
-msgstr "Australija/Zapad"
-
-#: TIMEZONES:726
-msgid "Australia/Yancowinna"
-msgstr "Australija/Yancowinna"
-
-#: TIMEZONES:729
-msgid "Brazil/Acre"
-msgstr "Brazil/Acre"
-
-#: TIMEZONES:732
-msgid "Brazil/DeNoronha"
-msgstr "Brazil/DeNoronha"
-
-#: TIMEZONES:735
-msgid "Brazil/East"
-msgstr "Brazil/Istok"
-
-#: TIMEZONES:738
-msgid "Brazil/West"
-msgstr "Brazil/Zapad"
-
-#: TIMEZONES:741
-msgid "Canada/Atlantic"
-msgstr "Kanada/Atlantik"
-
-#: TIMEZONES:744
-msgid "Canada/Central"
-msgstr "Kanada/Središnja"
-
-#: TIMEZONES:747
-msgid "Canada/East-Saskatchewan"
-msgstr "Kanada/Istočna-Saskatchewan"
-
-#: TIMEZONES:750
-msgid "Canada/Eastern"
-msgstr "Kanada/Istočna"
-
-#: TIMEZONES:753
-msgid "Canada/Mountain"
-msgstr "Kanada/Planine"
-
-#: TIMEZONES:756
-msgid "Canada/Newfoundland"
-msgstr "Kanada/Newfoundland"
-
-#: TIMEZONES:759
-msgid "Canada/Pacific"
-msgstr "Kanada/Tihi ocean"
-
-#: TIMEZONES:762
-msgid "Canada/Saskatchewan"
-msgstr "Kanada/Saskatchewan"
-
-#: TIMEZONES:765
-msgid "Canada/Yukon"
-msgstr "Kanada/Yukon"
-
-#: TIMEZONES:768
-msgid "Chile/Continental"
-msgstr "Čile/Kontinentalni"
-
-#: TIMEZONES:771
-msgid "Chile/EasterIsland"
-msgstr "Čile/Uskršnji otoci"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:773 TIMEZONES:907
-msgid "Easter Island & Sala y Gomez"
-msgstr "Uskršnji otoci & Sala y Gomez"
-
-#: TIMEZONES:774
-msgid "Cuba"
-msgstr "Kuba"
-
-#: TIMEZONES:775
-msgid "Egypt"
-msgstr "Egipat"
-
-#: TIMEZONES:776
-msgid "Eire"
-msgstr "Eire"
-
-#: TIMEZONES:777
-msgid "Europe/Amsterdam"
-msgstr "Europa/Amsterdam"
-
-#: TIMEZONES:778
-msgid "Europe/Andorra"
-msgstr "Europa/Andora"
-
-#: TIMEZONES:779
-msgid "Europe/Athens"
-msgstr "Europa/Atena"
-
-#: TIMEZONES:780
-msgid "Europe/Belfast"
-msgstr "Europa/Belfast"
-
-#: TIMEZONES:781
-msgid "Europe/Belgrade"
-msgstr "Europa/Beograd"
-
-#: TIMEZONES:782
-msgid "Europe/Berlin"
-msgstr "Europa/Berlin"
-
-#: TIMEZONES:783
-msgid "Europe/Bratislava"
-msgstr "Europa/Bratislava"
-
-#: TIMEZONES:784
-msgid "Europe/Brussels"
-msgstr "Europa/Bruxelles"
-
-#: TIMEZONES:785
-msgid "Europe/Bucharest"
-msgstr "Europa/Bukurešt"
-
-#: TIMEZONES:786
-msgid "Europe/Budapest"
-msgstr "Europa/Budimpešta"
-
-#: TIMEZONES:787
-msgid "Europe/Chisinau"
-msgstr "Europa/Chisinau"
-
-#: TIMEZONES:788
-msgid "Europe/Copenhagen"
-msgstr "Europa/Copenhagen"
-
-#: TIMEZONES:789
-msgid "Europe/Dublin"
-msgstr "Europa/Dublin"
-
-#: TIMEZONES:790
-msgid "Europe/Gibraltar"
-msgstr "Europa/Gibraltar"
-
-#: TIMEZONES:791
-msgid "Europe/Guernsey"
-msgstr "Europa/Guernsey"
-
-#: TIMEZONES:792
-msgid "Europe/Helsinki"
-msgstr "Europa/Helsinki"
-
-#: TIMEZONES:793
-msgid "Europe/Isle_of_Man"
-msgstr "Europa/Otok Man"
-
-#: TIMEZONES:794
-msgid "Europe/Istanbul"
-msgstr "Europa/Istanbul"
-
-#: TIMEZONES:795
-msgid "Europe/Jersey"
-msgstr "Europa/Jersey"
-
-#: TIMEZONES:796
-msgid "Europe/Kaliningrad"
-msgstr "Europa/Kalinjingrad"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:798
-msgid "Moscow-01 - Kaliningrad"
-msgstr "Moskva-01 – Kaliningrad"
-
-#: TIMEZONES:799
-msgid "Europe/Kiev"
-msgstr "Europa/Kijev"
-
-#: TIMEZONES:802
-msgid "Europe/Lisbon"
-msgstr "Europa/Lisabon"
-
-#: TIMEZONES:805
-msgid "Europe/Ljubljana"
-msgstr "Europa/Ljubljana"
-
-#: TIMEZONES:806
-msgid "Europe/London"
-msgstr "Europa/London"
-
-#: TIMEZONES:807
-msgid "Europe/Luxembourg"
-msgstr "Europa/Luxemburg"
-
-#: TIMEZONES:808
-msgid "Europe/Madrid"
-msgstr "Europa/Madrid"
-
-#: TIMEZONES:811
-msgid "Europe/Malta"
-msgstr "Europa/Malta"
-
-#: TIMEZONES:812
-msgid "Europe/Mariehamn"
-msgstr "Europa/Mariehamn"
-
-#: TIMEZONES:813
-msgid "Europe/Minsk"
-msgstr "Europa/Minsk"
-
-#: TIMEZONES:814
-msgid "Europe/Monaco"
-msgstr "Europa/Monaco"
-
-#: TIMEZONES:815
-msgid "Europe/Moscow"
-msgstr "Europa/Moskva"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:817 TIMEZONES:1022
-msgid "Moscow+00 - west Russia"
-msgstr "Moskva+00 – zapadna Rusija"
-
-#: TIMEZONES:818
-msgid "Europe/Oslo"
-msgstr "Europa/Oslo"
-
-#: TIMEZONES:819
-msgid "Europe/Paris"
-msgstr "Europa/Pariz"
-
-#: TIMEZONES:820
-msgid "Europe/Podgorica"
-msgstr "Europa/Podgorica"
-
-#: TIMEZONES:821
-msgid "Europe/Prague"
-msgstr "Europa/Prag"
-
-#: TIMEZONES:822
-msgid "Europe/Riga"
-msgstr "Europa/Riga"
-
-#: TIMEZONES:823
-msgid "Europe/Rome"
-msgstr "Europa/Rim"
-
-#: TIMEZONES:824
-msgid "Europe/Samara"
-msgstr "Europa/Samara"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:826
-msgid "Moscow+01 - Samara, Udmurtia"
-msgstr "Moskva+01 – Samarska oblast, Udmurtska"
-
-#: TIMEZONES:827
-msgid "Europe/San_Marino"
-msgstr "Europa/San_Marino"
-
-#: TIMEZONES:828
-msgid "Europe/Sarajevo"
-msgstr "Europa/Sarajevo"
-
-#: TIMEZONES:829
-msgid "Europe/Simferopol"
-msgstr "Europa/Sevastopolj"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:831
-msgid "central Crimea"
-msgstr "središnji Krim"
-
-#: TIMEZONES:832
-msgid "Europe/Skopje"
-msgstr "Europa/Skopje"
-
-#: TIMEZONES:833
-msgid "Europe/Sofia"
-msgstr "Europa/Sofija"
-
-#: TIMEZONES:834
-msgid "Europe/Stockholm"
-msgstr "Europa/Stockholm"
-
-#: TIMEZONES:835
-msgid "Europe/Tallinn"
-msgstr "Europa/Tallinn"
-
-#: TIMEZONES:836
-msgid "Europe/Tirane"
-msgstr "Europa/Tirana"
-
-#: TIMEZONES:837
-msgid "Europe/Tiraspol"
-msgstr "Europa/Tiraspol"
-
-#: TIMEZONES:838
-msgid "Europe/Uzhgorod"
-msgstr "Europa/Užgorod"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:840
-msgid "Ruthenia"
-msgstr "Ruthenia"
-
-#: TIMEZONES:841
-msgid "Europe/Vaduz"
-msgstr "Europa/Vaduz"
-
-#: TIMEZONES:842
-msgid "Europe/Vatican"
-msgstr "Europa/Vatikan"
-
-#: TIMEZONES:843
-msgid "Europe/Vienna"
-msgstr "Europa/Beč"
-
-#: TIMEZONES:844
-msgid "Europe/Vilnius"
-msgstr "Europa/Vilnius"
-
-#: TIMEZONES:845
-msgid "Europe/Volgograd"
-msgstr "Europa/Volgograd"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:847
-msgid "Moscow+00 - Caspian Sea"
-msgstr "Moskva+00 – Kaspijsko jezero"
-
-#: TIMEZONES:848
-msgid "Europe/Warsaw"
-msgstr "Europa/Varšava"
-
-#: TIMEZONES:849
-msgid "Europe/Zagreb"
-msgstr "Europa/Zagreb"
-
-#: TIMEZONES:850
-msgid "Europe/Zaporozhye"
-msgstr "Europa/Zaporožje"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:852
-msgid "Zaporozh'ye, E Lugansk / Zaporizhia, E Luhansk"
-msgstr "Zaporozh'ye, E Lugansk / Zaporizhia, E Luhansk"
-
-#: TIMEZONES:853
-msgid "Europe/Zurich"
-msgstr "Europa/Cirih"
-
-#: TIMEZONES:854
-msgid "GB"
-msgstr "GB"
-
-#: TIMEZONES:855
-msgid "GB-Eire"
-msgstr "GB-Eire"
-
-#: TIMEZONES:856
-msgid "Hongkong"
-msgstr "Hongkong"
-
-#: TIMEZONES:857
-msgid "Iceland"
-msgstr "Island"
-
-#: TIMEZONES:858
-msgid "Indian/Antananarivo"
-msgstr "Indijski_ocean/Antananarivo"
-
-#: TIMEZONES:859
-msgid "Indian/Chagos"
-msgstr "Indijski_ocean/Chagos"
-
-#: TIMEZONES:860
-msgid "Indian/Christmas"
-msgstr "Indijski_ocean/Božićni_otoci"
-
-#: TIMEZONES:861
-msgid "Indian/Cocos"
-msgstr "Indijski_ocean/Cocos"
-
-#: TIMEZONES:862
-msgid "Indian/Comoro"
-msgstr "Indijski_ocean/Comoro"
-
-#: TIMEZONES:863
-msgid "Indian/Kerguelen"
-msgstr "Indijski_ocean/Kerguelen"
-
-#: TIMEZONES:864
-msgid "Indian/Mahe"
-msgstr "Indijski_ocean/Mahe"
-
-#: TIMEZONES:865
-msgid "Indian/Maldives"
-msgstr "Indijski_ocean/Maldives"
-
-#: TIMEZONES:866
-msgid "Indian/Mauritius"
-msgstr "Indijski_ocean/Mauritius"
-
-#: TIMEZONES:867
-msgid "Indian/Mayotte"
-msgstr "Indijski_ocean/Mayotte"
-
-#: TIMEZONES:868
-msgid "Indian/Reunion"
-msgstr "Indijski_ocean/Reunion"
-
-#: TIMEZONES:869
-msgid "Iran"
-msgstr "Iran"
-
-#: TIMEZONES:870
-msgid "Israel"
-msgstr "Izrael"
-
-#: TIMEZONES:871
-msgid "Jamaica"
-msgstr "Jamajka"
-
-#: TIMEZONES:872
-msgid "Japan"
-msgstr "Japan"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:873 TIMEZONES:875 TIMEZONES:937
-msgid "Kwajalein"
-msgstr "Kwajalein"
-
-#: TIMEZONES:876
-msgid "Libya"
-msgstr "Libija"
-
-#: TIMEZONES:877
-msgid "Mexico/BajaNorte"
-msgstr "Meksiko/BajaNorte"
-
-#: TIMEZONES:880
-msgid "Mexico/BajaSur"
-msgstr "Meksiko/General"
-
-#: TIMEZONES:883
-msgid "Mexico/General"
-msgstr "Meksiko/Opće"
-
-#: TIMEZONES:886
-msgid "NZ"
-msgstr "NZ"
-
-#: TIMEZONES:889
-msgid "NZ-CHAT"
-msgstr "NZ-CHAT"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:891 TIMEZONES:904
-msgid "Chatham Islands"
-msgstr "Otoci Chatham"
-
-#: TIMEZONES:892
-msgid "Navajo"
-msgstr "Navajo"
-
-#: TIMEZONES:895
-msgid "PRC"
-msgstr "PRC"
-
-#: TIMEZONES:898
-msgid "Pacific/Apia"
-msgstr "Tihi_ocean/Apia"
-
-#: TIMEZONES:899
-msgid "Pacific/Auckland"
-msgstr "Tihi_ocean/Auckland"
-
-#: TIMEZONES:902
-msgid "Pacific/Chatham"
-msgstr "Tihi_ocean/Chatham"
-
-#: TIMEZONES:905
-msgid "Pacific/Easter"
-msgstr "Tihi_ocean/Uskršnji_otoci"
-
-#: TIMEZONES:908
-msgid "Pacific/Efate"
-msgstr "Tihi_ocean/Efate"
-
-#: TIMEZONES:909
-msgid "Pacific/Enderbury"
-msgstr "Tihi_ocean/Enderbury"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:911
-msgid "Phoenix Islands"
-msgstr "Otoci Phoenix"
-
-#: TIMEZONES:912
-msgid "Pacific/Fakaofo"
-msgstr "Tihi_ocean/Fakaofo"
-
-#: TIMEZONES:913
-msgid "Pacific/Fiji"
-msgstr "Tihi_ocean/Fiji"
-
-#: TIMEZONES:914
-msgid "Pacific/Funafuti"
-msgstr "Tihi_ocean/Funafuti"
-
-#: TIMEZONES:915
-msgid "Pacific/Galapagos"
-msgstr "Tihi_ocean/Galapagos"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:917
-msgid "Galapagos Islands"
-msgstr "Otočje Galapagos"
-
-#: TIMEZONES:918
-msgid "Pacific/Gambier"
-msgstr "Tihi_ocean/Gambier"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:920
-msgid "Gambier Islands"
-msgstr "Otoci Gambier"
-
-#: TIMEZONES:921
-msgid "Pacific/Guadalcanal"
-msgstr "Tihi_ocean/Guadalcanal"
-
-#: TIMEZONES:922
-msgid "Pacific/Guam"
-msgstr "Tihi_ocean/Guam"
-
-#: TIMEZONES:923
-msgid "Pacific/Honolulu"
-msgstr "Tihi_ocean/Honolulu"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:925 TIMEZONES:1006
-msgid "Hawaii"
-msgstr "Hawaii"
-
-#: TIMEZONES:926
-msgid "Pacific/Johnston"
-msgstr "Tihi_ocean/Johnston"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:928
-msgid "Johnston Atoll"
-msgstr "Johnston Atol"
-
-#: TIMEZONES:929
-msgid "Pacific/Kiritimati"
-msgstr "Tihi_ocean/Kiritimati"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:931
-msgid "Line Islands"
-msgstr "Linijski otoci"
-
-#: TIMEZONES:932
-msgid "Pacific/Kosrae"
-msgstr "Tihi_ocean/Kosrae"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:934
-msgid "Kosrae"
-msgstr "Kosrae"
-
-#: TIMEZONES:935
-msgid "Pacific/Kwajalein"
-msgstr "Tihi_ocean/Kwajalein"
-
-#: TIMEZONES:938
-msgid "Pacific/Majuro"
-msgstr "Tihi_ocean/Majuro"
-
-#: TIMEZONES:941
-msgid "Pacific/Marquesas"
-msgstr "Tihi_ocean/Marquesas"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:943
-msgid "Marquesas Islands"
-msgstr "Otoci Marquesas"
-
-#: TIMEZONES:944
-msgid "Pacific/Midway"
-msgstr "Tihi_ocean/Midway"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:946
-msgid "Midway Islands"
-msgstr "Otoci Midway"
-
-#: TIMEZONES:947
-msgid "Pacific/Nauru"
-msgstr "Tihi_ocean/Nauru"
-
-#: TIMEZONES:948
-msgid "Pacific/Niue"
-msgstr "Tihi_ocean/Niue"
-
-#: TIMEZONES:949
-msgid "Pacific/Norfolk"
-msgstr "Tihi_ocean/Norfolk"
-
-#: TIMEZONES:950
-msgid "Pacific/Noumea"
-msgstr "Tihi_ocean/Noumea"
-
-#: TIMEZONES:951
-msgid "Pacific/Pago_Pago"
-msgstr "Tihi_ocean/Pago_Pago"
-
-#: TIMEZONES:952
-msgid "Pacific/Palau"
-msgstr "Tihi_ocean/Palau"
-
-#: TIMEZONES:953
-msgid "Pacific/Pitcairn"
-msgstr "Tihi_ocean/Pitcairn"
-
-#: TIMEZONES:954
-msgid "Pacific/Ponape"
-msgstr "Tihi_ocean/Ponape"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:956
-msgid "Ponape (Pohnpei)"
-msgstr "Ponape (Pohnpei)"
-
-#: TIMEZONES:957
-msgid "Pacific/Port_Moresby"
-msgstr "Tihi_ocean/Port_Moresby"
-
-#: TIMEZONES:958
-msgid "Pacific/Rarotonga"
-msgstr "Tihi_ocean/Rarotonga"
-
-#: TIMEZONES:959
-msgid "Pacific/Saipan"
-msgstr "Tihi_ocean/Saipan"
-
-#: TIMEZONES:960
-msgid "Pacific/Samoa"
-msgstr "Tihi_ocean/Samoa"
-
-#: TIMEZONES:961
-msgid "Pacific/Tahiti"
-msgstr "Tihi_ocean/Tahiti"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:963
-msgid "Society Islands"
-msgstr "Društveni otoci"
-
-#: TIMEZONES:964
-msgid "Pacific/Tarawa"
-msgstr "Tihi_ocean/Tarawa"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:966
-msgid "Gilbert Islands"
-msgstr "Gilbertski otoci"
-
-#: TIMEZONES:967
-msgid "Pacific/Tongatapu"
-msgstr "Tihi_ocean/Tongatapu"
-
-#: TIMEZONES:968
-msgid "Pacific/Truk"
-msgstr "Tihi_ocean/Truk"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:970 TIMEZONES:977
-msgid "Truk (Chuuk) and Yap"
-msgstr "Truk (Chuuk) i Yap"
-
-#: TIMEZONES:971
-msgid "Pacific/Wake"
-msgstr "Tihi_ocean/Wake"
-
-#. i18n: comment to the previous timezone
-#: TIMEZONES:973
-msgid "Wake Island"
-msgstr "Otoci Wake"
-
-#: TIMEZONES:974
-msgid "Pacific/Wallis"
-msgstr "Tihi_ocean/Wallis"
-
-#: TIMEZONES:975
-msgid "Pacific/Yap"
-msgstr "Tihi_ocean/Yap"
-
-#: TIMEZONES:978
-msgid "Poland"
-msgstr "Poljska"
-
-#: TIMEZONES:979
-msgid "Portugal"
-msgstr "Portugal"
-
-#: TIMEZONES:982
-msgid "ROC"
-msgstr "ROC"
-
-#: TIMEZONES:983
-msgid "ROK"
-msgstr "ROK"
-
-#: TIMEZONES:984
-msgid "Singapore"
-msgstr "Singapur"
-
-#: TIMEZONES:985
-msgid "Turkey"
-msgstr "Turska"
-
-#: TIMEZONES:986
-msgid "US/Alaska"
-msgstr "US/Aljaska"
-
-#: TIMEZONES:989
-msgid "US/Aleutian"
-msgstr "US/Aleutian"
-
-#: TIMEZONES:992
-msgid "US/Arizona"
-msgstr "US/Arizona"
-
-#: TIMEZONES:995
-msgid "US/Central"
-msgstr "US/Središnje"
-
-#: TIMEZONES:998
-msgid "US/East-Indiana"
-msgstr "US/Istočna-Indiana"
-
-#: TIMEZONES:1001
-msgid "US/Eastern"
-msgstr "US/Istočno"
-
-#: TIMEZONES:1004
-msgid "US/Hawaii"
-msgstr "US/Hawaii"
-
-#: TIMEZONES:1007
-msgid "US/Indiana-Starke"
-msgstr "US/Indiana-Starke"
-
-#: TIMEZONES:1010
-msgid "US/Michigan"
-msgstr "US/Michigan"
-
-#: TIMEZONES:1013
-msgid "US/Mountain"
-msgstr "US/Planinsko"
-
-#: TIMEZONES:1016
-msgid "US/Pacific"
-msgstr "US/Tihi_ocean"
-
-#: TIMEZONES:1019
-msgid "US/Samoa"
-msgstr "US/Samoa"
-
-#: TIMEZONES:1020
-msgid "W-SU"
-msgstr "W-SU"
-
-#~ msgctxt "NAME OF TRANSLATORS"
-#~ msgid "Your names"
-#~ msgstr "Renato_Pavičić"
-
-#~ msgctxt "EMAIL OF TRANSLATORS"
-#~ msgid "Your emails"
-#~ msgstr "renato@translator-shop.org"
diff -Nru kde-l10n-hr-4.12.97/messages/frameworks/xml_mimetypes.po kde-l10n-hr-4.13.0/messages/frameworks/xml_mimetypes.po
--- kde-l10n-hr-4.12.97/messages/frameworks/xml_mimetypes.po 2014-01-25 21:41:22.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/frameworks/xml_mimetypes.po 1970-01-01 00:00:00.000000000 +0000
@@ -1,344 +0,0 @@
-# Translation of xml_mimetypes to Croatian
-#
-# Zarko Pintar , 2009.
-# Andrej Dundovic , 2010.
-# Marko Dimjašević , 2011.
-msgid ""
-msgstr ""
-"Project-Id-Version: xml_mimetypes\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2014-01-24 18:50+0000\n"
-"PO-Revision-Date: 2011-07-22 16:17+0200\n"
-"Last-Translator: Marko Dimjašević \n"
-"Language-Team: Croatian \n"
-"Language: hr\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Generator: Lokalize 1.2\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n"
-"%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"X-Environment: kde\n"
-"X-Accelerator-Marker: \n"
-"X-Text-Markup: \n"
-
-#: kde5.xml.podir/kde5.xml.in.h:1
-msgid "Metalink download"
-msgstr "Metalink preuzimanje"
-
-#: kde5.xml.podir/kde5.xml.in.h:2
-msgid "RELAX NG"
-msgstr "RELAX NG"
-
-#: kde5.xml.podir/kde5.xml.in.h:3
-msgid "CD audio"
-msgstr "CD audio"
-
-#: kde5.xml.podir/kde5.xml.in.h:4
-msgid "SNF bitmap font"
-msgstr "SNF bitmap pismo"
-
-#: kde5.xml.podir/kde5.xml.in.h:5
-msgid "Java applet"
-msgstr "Java applet"
-
-#: kde5.xml.podir/kde5.xml.in.h:6
-msgid "KHTML Extension Adaptor"
-msgstr "KHTML adapter proširenja"
-
-#: kde5.xml.podir/kde5.xml.in.h:7
-msgid "KDE color scheme"
-msgstr "KDE-ova paleta boja"
-
-#: kde5.xml.podir/kde5.xml.in.h:8
-msgid "KNewStuff package"
-msgstr "KNewStuff paket"
-
-#: kde5.xml.podir/kde5.xml.in.h:10
-msgid "KWallet wallet"
-msgstr "KWallet lisnica"
-
-#: kde5.xml.podir/kde5.xml.in.h:11
-msgid "Kugar report template"
-msgstr "Kugar predložak izvještaja"
-
-#: kde5.xml.podir/kde5.xml.in.h:12
-msgid "mime encapsulated web archive"
-msgstr "mime enkapsulirana mrežna arhiva"
-
-#: kde5.xml.podir/kde5.xml.in.h:14
-msgid "NewzBin usenet index"
-msgstr "NewzBin usenet indeks"
-
-#: kde5.xml.podir/kde5.xml.in.h:15
-msgid "plasmoid"
-msgstr "plasmoid"
-
-#: kde5.xml.podir/kde5.xml.in.h:16
-msgid "SuperKaramba theme"
-msgstr "tema za SuperKarambu"
-
-#: kde5.xml.podir/kde5.xml.in.h:17
-msgid "Calligra Plan project management document"
-msgstr "Calligra Plan, dokument za upravljanje projektom"
-
-#: kde5.xml.podir/kde5.xml.in.h:18
-msgid "Calligra Plan work package document"
-msgstr "Calligra Plan, dokument za radni paket"
-
-#: kde5.xml.podir/kde5.xml.in.h:19
-msgid "KPlato project management document"
-msgstr "KPlato dokument upravljanja projektom"
-
-#: kde5.xml.podir/kde5.xml.in.h:20
-msgid "KPlato project management work package"
-msgstr "KPlato radni paket upravljanja projektom"
-
-#: kde5.xml.podir/kde5.xml.in.h:21
-msgid "Kugar archive"
-msgstr "Kugar arhiva"
-
-#: kde5.xml.podir/kde5.xml.in.h:23
-msgid "web archive"
-msgstr "web arhiva"
-
-#: kde5.xml.podir/kde5.xml.in.h:24
-msgid "W3C XML schema"
-msgstr "W3C XML shema"
-
-#: kde5.xml.podir/kde5.xml.in.h:25
-msgid "AAC sound"
-msgstr "AAC zvuk"
-
-#: kde5.xml.podir/kde5.xml.in.h:27
-msgid "RealAudio plugin file"
-msgstr "priključna datoteka za RealAudio"
-
-#: kde5.xml.podir/kde5.xml.in.h:29
-msgid "KPhotoAlbum import"
-msgstr "KPhotoAlbum uvoz"
-
-#: kde5.xml.podir/kde5.xml.in.h:31
-msgid "HDR image"
-msgstr "HDR slika"
-
-#: kde5.xml.podir/kde5.xml.in.h:32
-msgid "KDE raw image formats"
-msgstr "KDE-ovi sirovi slikovni podaci"
-
-#: kde5.xml.podir/kde5.xml.in.h:33
-msgid "Intel® hexadecimal object file"
-msgstr "Intelova® heksadecimalna objektna datoteka"
-
-#: kde5.xml.podir/kde5.xml.in.h:34
-msgid "Kate file list loader plugin list"
-msgstr "Kate lista od priključka učitavača liste datoteka"
-
-#: kde5.xml.podir/kde5.xml.in.h:35
-msgid "Objective-C header"
-msgstr "Objective-C zaglavlje"
-
-#: kde5.xml.podir/kde5.xml.in.h:36
-msgid "abc musical notation file"
-msgstr "abc muzičko notacijska datoteka"
-
-#: kde5.xml.podir/kde5.xml.in.h:37
-msgid "all files and folders"
-msgstr "sve datoteke i direktoriji"
-
-#: kde5.xml.podir/kde5.xml.in.h:38
-msgid "all files"
-msgstr "sve datoteke"
-
-#: kde5.xml.podir/kde5.xml.in.h:39
-msgid "mms: URIs"
-msgstr "mms: URI-ovi"
-
-#: kde5.xml.podir/kde5.xml.in.h:40
-msgid "mmst: URIs"
-msgstr "mmst: URI-ovi"
-
-#: kde5.xml.podir/kde5.xml.in.h:41
-msgid "mmsu: URIs"
-msgstr "mmsu: URI-ovi"
-
-#: kde5.xml.podir/kde5.xml.in.h:42
-msgid "pnm: URIs"
-msgstr "pnm: URI-ovi"
-
-#: kde5.xml.podir/kde5.xml.in.h:43
-msgid "rtspt: URIs"
-msgstr "rtspt: URI-ovi"
-
-#: kde5.xml.podir/kde5.xml.in.h:44
-msgid "rtspu: URIs"
-msgstr "rtspu: URI-ovi"
-
-#: kde5.xml.podir/kde5.xml.in.h:45
-msgid "fonts package"
-msgstr "paket pisama"
-
-#: kde5.xml.podir/kde5.xml.in.h:46
-msgid "Windows server"
-msgstr "Windows poslužitelj"
-
-#: kde5.xml.podir/kde5.xml.in.h:47
-msgid "Windows workgroup"
-msgstr "Windows radna grupa"
-
-#: kde5.xml.podir/kde5.xml.in.h:49
-msgid "KDE system monitor"
-msgstr "KDE-ov monitor sustava"
-
-#: kde5.xml.podir/kde5.xml.in.h:50
-msgid "KDE theme"
-msgstr "KDE-ova tema"
-
-#: kde5.xml.podir/kde5.xml.in.h:51
-msgid "Quanta project"
-msgstr "Quanta projekt"
-
-#: kde5.xml.podir/kde5.xml.in.h:52
-msgid "Kommander file"
-msgstr "Kommander datoteka"
-
-#: kde5.xml.podir/kde5.xml.in.h:53
-msgid "potato"
-msgstr "potato"
-
-#: kde5.xml.podir/kde5.xml.in.h:54
-msgid "Kolf saved game"
-msgstr "Kolf spremljena igra"
-
-#: kde5.xml.podir/kde5.xml.in.h:55
-msgid "Kolf course"
-msgstr "Kolf staza"
-
-#: kde5.xml.podir/kde5.xml.in.h:56
-msgid "Okular document archive"
-msgstr "arhiva dokumenta za Okular"
-
-#: kde5.xml.podir/kde5.xml.in.h:57
-msgid "Cabri figure"
-msgstr "Cabri figura"
-
-#: kde5.xml.podir/kde5.xml.in.h:58
-msgid "Dr. Geo figure"
-msgstr "Dr. Geo figura"
-
-#: kde5.xml.podir/kde5.xml.in.h:59
-msgid "KGeo figure"
-msgstr "KGeo skica"
-
-#: kde5.xml.podir/kde5.xml.in.h:60
-msgid "Kig figure"
-msgstr "Kig figura"
-
-#: kde5.xml.podir/kde5.xml.in.h:61
-msgid "KSeg document"
-msgstr "KSeg dokument"
-
-#: kde5.xml.podir/kde5.xml.in.h:62
-msgid "vocabulary trainer document"
-msgstr "dokument vokabularskog trenera"
-
-#: kde5.xml.podir/kde5.xml.in.h:63
-msgid "KmPlot file"
-msgstr "KmPlot datoteka"
-
-#: kde5.xml.podir/kde5.xml.in.h:64
-msgid "KWordQuiz vocabulary"
-msgstr "KWordQuiz vokabular"
-
-#: kde5.xml.podir/kde5.xml.in.h:65
-msgid "Cachegrind/Callgrind profile dump"
-msgstr "Cachegrind/Callgrind odbačeni profil"
-
-#: kde5.xml.podir/kde5.xml.in.h:66
-msgid "Umbrello UML Modeller file"
-msgstr "Umbrello UML Modeller datoteka"
-
-#: kde5.xml.podir/kde5.xml.in.h:67
-msgid "Windows link"
-msgstr "Windows veza"
-
-#: kde5.xml.podir/kde5.xml.in.h:68
-msgid "KGet download list"
-msgstr "KGet lista preuzimanja"
-
-#: kde5.xml.podir/kde5.xml.in.h:69
-msgid "Kopete emoticons archive"
-msgstr "Kopete arhiva emotikona"
-
-#: kde5.xml.podir/kde5.xml.in.h:70
-msgid "ICQ contact"
-msgstr "ICQ kontakt"
-
-#: kde5.xml.podir/kde5.xml.in.h:72
-msgid "Microsoft Media Format"
-msgstr "Microsoft Media Format"
-
-#: kde5.xml.podir/kde5.xml.in.h:74
-msgid "TriG RDF document"
-msgstr "TriG RDF dokument"
-
-#: kde5.xml.podir/kde5.xml.in.h:76
-msgid "Turtle RDF document"
-msgstr "Turtle RDF dokument"
-
-#: kde5.xml.podir/kde5.xml.in.h:78
-msgid "Softimage PIC image"
-msgstr "Softimage PIC slika"
-
-#: kde5.xml.podir/kde5.xml.in.h:80
-msgid "Qt Markup Language file"
-msgstr "Datoteka Qt-ovog označnog jezika"
-
-#: kde5.xml.podir/kde5.xml.in.h:81
-msgid "Mobipocket e-book"
-msgstr "E-knjiga u Mobipocketu"
-
-#~ msgid "Kexi database file-based project"
-#~ msgstr "Kexi projekt datotečno bazirane baze podataka"
-
-#~ msgid "Kexi project file"
-#~ msgstr "Kexi datoteka projekta"
-
-#~ msgid "compressed Winamp skin"
-#~ msgstr "sažeti Winamp prekrivač"
-
-#~ msgid "data for database server connection"
-#~ msgstr "podaci za vezu sa poslužiteljem baze podataka"
-
-#~ msgid "file to open a shell"
-#~ msgstr "datoteka za otvaranje ljuske"
-
-#~ msgid "shortcut to Kexi project on database server"
-#~ msgstr "prečac na Kexi projekt na poslužitelj baze podataka"
-
-#~ msgid "FictionBook document"
-#~ msgstr "FictionBook dokument"
-
-#~ msgid "MP2 audio"
-#~ msgstr "MP2 audio"
-
-#~ msgid "MP3 audio"
-#~ msgstr "MP3 audio"
-
-#~ msgid "Ogg multimedia file"
-#~ msgstr "Ogg multimedijalna datoteka"
-
-#~ msgid "Ogg/Ogm Video"
-#~ msgstr "Ogg/Ogm video"
-
-#~ msgid "RDF/XML document"
-#~ msgstr "RDF/XML dokument"
-
-#~ msgid "Vorbis audio"
-#~ msgstr "Vorbis audio"
-
-#~ msgid "MRML document"
-#~ msgstr "MRML dokument"
-
-#~ msgid "OpenRaster document"
-#~ msgstr "OpenRaster dokument"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/kblankscrn.po kde-l10n-hr-4.13.0/messages/kde-workspace/kblankscrn.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/kblankscrn.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/kblankscrn.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,47 @@
+# Translation of kblankscrn to Croatian
+#
+# Andrej Dundovic , 2010.
+msgid ""
+msgstr ""
+"Project-Id-Version: kblankscrn\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-02 05:38+0200\n"
+"PO-Revision-Date: 2010-01-26 11:13+0100\n"
+"Last-Translator: Andrej Dundovic \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"X-Generator: Lokalize 1.0\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: blankscrn.cpp:33
+msgid "KBlankScreen"
+msgstr "KBlankScreen"
+
+#: blankscrn.cpp:34
+msgid "Blank Screen Saver"
+msgstr "Crni čuvar ekrana"
+
+#: blankscrn.cpp:62
+msgid "Setup Blank Screen Saver"
+msgstr "Postavke za Blank Screen Saver"
+
+#: blankscrn.cpp:73
+msgid "Color:"
+msgstr "Boja:"
+
+#: rc.cpp:1
+msgctxt "NAME OF TRANSLATORS"
+msgid "Your names"
+msgstr "Žarko Pintar"
+
+#: rc.cpp:2
+msgctxt "EMAIL OF TRANSLATORS"
+msgid "Your emails"
+msgstr "zarko.pintar@gmail.com"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/kcmbackground.po kde-l10n-hr-4.13.0/messages/kde-workspace/kcmbackground.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/kcmbackground.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/kcmbackground.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,937 @@
+# Translation of kcmbackground to Croatian
+#
+# DoDo , 2009.
+# Andrej Dundovic , 2010.
+msgid ""
+msgstr ""
+"Project-Id-Version: kcmbackground 0\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-02 05:37+0200\n"
+"PO-Revision-Date: 2010-01-26 11:29+0100\n"
+"Last-Translator: Andrej Dundovic \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 1.0\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: bgadvanced.cpp:53
+msgid "Advanced Background Settings"
+msgstr "Napredne postavke pozadine"
+
+#: bgadvanced.cpp:213
+#, kde-format
+msgid "%1 min."
+msgstr "%1 min."
+
+#: bgadvanced.cpp:247
+msgid ""
+"Unable to remove the program: the program is global and can only be removed "
+"by the system administrator."
+msgstr ""
+"Uklanjanje programa nije moguće! Program je globalan i može ukloniti samo ga "
+"administrator sustava."
+
+#: bgadvanced.cpp:249
+msgid "Cannot Remove Program"
+msgstr "Uklanjanje programa nije moguće"
+
+#: bgadvanced.cpp:253
+#, kde-format
+msgid "Are you sure you want to remove the program `%1'?"
+msgstr "Jeste li sigurni da želite ukloniti program`%1'?"
+
+#: bgadvanced.cpp:255
+msgid "Remove Background Program"
+msgstr "Ukloni program za pozadinu"
+
+#. i18n: file: bgadvanced_ui.ui:47
+#. i18n: ectx: property (text), widget (QPushButton, m_buttonRemove)
+#. i18n: file: bgwallpaper_ui.ui:115
+#. i18n: ectx: property (text), widget (QPushButton, m_buttonRemove)
+#: bgadvanced.cpp:256 rc.cpp:18 rc.cpp:189
+msgid "&Remove"
+msgstr "&Ukloni"
+
+#: bgadvanced.cpp:339
+msgid "Configure Background Program"
+msgstr "Konfiguriranje programa za pozadinu"
+
+#: bgadvanced.cpp:350
+msgid "&Name:"
+msgstr "&Naziv:"
+
+#: bgadvanced.cpp:356
+msgid "Co&mment:"
+msgstr "&Komentar:"
+
+#: bgadvanced.cpp:362
+msgid "Comman&d:"
+msgstr "Nare&dba:"
+
+#: bgadvanced.cpp:368
+msgid "&Preview cmd:"
+msgstr "Naredba za &pregled:"
+
+#: bgadvanced.cpp:374
+msgid "&Executable:"
+msgstr "&Izvršna datoteka:"
+
+#: bgadvanced.cpp:380
+msgid "&Refresh time:"
+msgstr "&Vrijeme osvježavanja:"
+
+#: bgadvanced.cpp:385
+msgid " min"
+msgstr " min"
+
+#: bgadvanced.cpp:392
+msgid "New Command"
+msgstr "Nova naredba"
+
+#: bgadvanced.cpp:395
+#, kde-format
+msgid "New Command <%1>"
+msgstr "Nova naredba <%1>"
+
+#: bgadvanced.cpp:422
+msgid ""
+"You did not fill in the `Name' field.\n"
+"This is a required field."
+msgstr ""
+"Niste ispunili polje 'Naziv'.\n"
+"To je polje potrebno ispuniti."
+
+#: bgadvanced.cpp:430
+#, kde-format
+msgid ""
+"There is already a program with the name `%1'.\n"
+"Do you want to overwrite it?"
+msgstr ""
+"Program s nazivom '%1' već postoji.\n"
+"Želite li prepisati preko postojećeg?"
+
+#: bgadvanced.cpp:431
+msgid "Overwrite"
+msgstr "Prepiši"
+
+#: bgadvanced.cpp:437
+msgid ""
+"You did not fill in the `Executable' field.\n"
+"This is a required field."
+msgstr ""
+"Niste ispunili polje 'Izvršna datoteka'.\n"
+"To je polje potrebno ispuniti."
+
+#: bgadvanced.cpp:442
+msgid ""
+"You did not fill in the `Command' field.\n"
+"This is a required field."
+msgstr ""
+"Niste ispunili polje 'Naredba'.\n"
+"To je polje potrebno ispuniti."
+
+#: bgdialog.cpp:110
+msgid "Open file dialog"
+msgstr "Dijalog otvaranje datoteke"
+
+#: bgdialog.cpp:334
+msgid ""
+"
Background This module allows you to control the appearance of "
+"the virtual desktops. KDE offers a variety of options for customization, "
+"including the ability to specify different settings for each virtual "
+"desktop, or a common background for all of them. The appearance of "
+"the desktop results from the combination of its background colors and "
+"patterns, and optionally, wallpaper, which is based on the image from a "
+"graphic file.
The background can be made up of a single color, or a "
+"pair of colors which can be blended in a variety of patterns. Wallpaper is "
+"also customizable, with options for tiling and stretching images. The "
+"wallpaper can be overlaid opaquely, or blended in different ways with the "
+"background colors and patterns.
KDE allows you to have the wallpaper "
+"change automatically at specified intervals of time. You can also replace "
+"the background with a program that updates the desktop dynamically. For "
+"example, the \"kdeworld\" program shows a day/night map of the world which "
+"is updated periodically.
"
+msgstr ""
+"
Pozadina Ovaj modul omogućuje upravljanje izgledom virtualnih "
+"radnih površina. KDE pruža raznolike opcije prilagođavanja, uključujući "
+"mogućnost određivanja različitih postavki za svaku virtualnu radnu površinu "
+"ili zajedničku pozadinu za sve. Izgled radne površine rezultat je "
+"kombinacije boja i uzoraka pozadine i opcionalno slike radne površine."
+"p>
Pozadina može biti izvedena od jedne boje ili para boja koje je moguće "
+"pretapati na različite načine. Sliku radne površine moguće je prilagoditi u "
+"obliku popločavanja ili razvlačenja određene slike. Sliku radne površine "
+"moguće je na različite načine postaviti uz prozirnost ili pretapanje s "
+"bojama i uzorcima.
KDE Vam dozvoljava da sliku radne površine "
+"mijenjate automatski nakon određenog vremenskog intervala. Također možete "
+"zamijeniti pozadinu sa programom koji dinamično mijenja pozadinu. Na "
+"primjer, \"kdeworld\" program prikazuje dnevnu/noćnu kartu svijeta koji se "
+"periodično ažurira.
"
+
+#: bgdialog.cpp:386
+#, kde-format
+msgid "Screen %1"
+msgstr "Pozadina %1"
+
+#: bgdialog.cpp:389
+msgid "Single Color"
+msgstr "Jednobojno"
+
+#: bgdialog.cpp:390
+msgid "Horizontal Gradient"
+msgstr "Vodoravno stupnjevanje"
+
+#: bgdialog.cpp:391
+msgid "Vertical Gradient"
+msgstr "Uspravno stupnjevanje"
+
+#: bgdialog.cpp:392
+msgid "Pyramid Gradient"
+msgstr "Piramidalno stupnjevanje"
+
+#: bgdialog.cpp:393
+msgid "Pipecross Gradient"
+msgstr "Križno stupnjevanje"
+
+#: bgdialog.cpp:394
+msgid "Elliptic Gradient"
+msgstr "Eliptično stupnjevanje"
+
+#: bgdialog.cpp:408
+msgid "Centered"
+msgstr "Sredina"
+
+#: bgdialog.cpp:409
+msgid "Tiled"
+msgstr "Popločeno"
+
+#: bgdialog.cpp:410
+msgid "Center Tiled"
+msgstr "Sredina popločeno"
+
+#: bgdialog.cpp:411
+msgid "Centered Maxpect"
+msgstr "Sredina uvećano"
+
+#: bgdialog.cpp:412
+msgid "Tiled Maxpect"
+msgstr "Popločeno uvećano"
+
+#: bgdialog.cpp:413
+msgid "Scaled"
+msgstr "Prilagođeno"
+
+#: bgdialog.cpp:414
+msgid "Centered Auto Fit"
+msgstr "Sredina automatski prilagođeno"
+
+#: bgdialog.cpp:415
+msgid "Scale & Crop"
+msgstr "Prilagođeno i obrezano"
+
+#: bgdialog.cpp:418
+msgid "No Blending"
+msgstr "Bez stapanja"
+
+#: bgdialog.cpp:419
+msgid "Flat"
+msgstr "Ravno"
+
+#: bgdialog.cpp:420
+msgid "Horizontal"
+msgstr "Vodoravno"
+
+#: bgdialog.cpp:421
+msgid "Vertical"
+msgstr "Uspravno"
+
+#: bgdialog.cpp:422
+msgid "Pyramid"
+msgstr "Piramida"
+
+#: bgdialog.cpp:423
+msgid "Pipecross"
+msgstr "Križno"
+
+#: bgdialog.cpp:424
+msgid "Elliptic"
+msgstr "Eliptično"
+
+#: bgdialog.cpp:425
+msgid "Intensity"
+msgstr "Intenzitet"
+
+#: bgdialog.cpp:426
+msgid "Saturation"
+msgstr "Zasićenje"
+
+#: bgdialog.cpp:427
+msgid "Contrast"
+msgstr "Kontrast"
+
+#: bgdialog.cpp:428
+msgid "Hue Shift"
+msgstr "Pomak nijanse"
+
+#: bgdialog.cpp:563
+msgid "Select Wallpaper"
+msgstr "Odaberite pozadinsku sliku"
+
+#: bgmonitor.cpp:51
+msgid ""
+"This picture of a monitor contains a preview of what the current settings "
+"will look like on your desktop."
+msgstr ""
+"Slika monitora sadrži prikaz na koji će način trenutne postavke izgledati na "
+"vašoj radnoj površini."
+
+#: bgwallpaper.cpp:108
+msgid "Setup Slide Show"
+msgstr "Podešavanje slajdova"
+
+#: bgwallpaper.cpp:116
+msgid " minute"
+msgid_plural " minutes"
+msgstr[0] "minuta"
+msgstr[1] "minute"
+msgstr[2] "minuta"
+
+#: bgwallpaper.cpp:164
+msgid "Select Image"
+msgstr "Odaberite sliku"
+
+#. i18n: file: bgadvanced_ui.ui:16
+#. i18n: ectx: property (title), widget (QGroupBox, m_groupProgram)
+#: rc.cpp:3
+msgid "Background Program"
+msgstr "Program za pozadinu"
+
+#. i18n: file: bgadvanced_ui.ui:31
+#. i18n: ectx: property (whatsThis), widget (QPushButton, m_buttonAdd)
+#: rc.cpp:6
+msgid ""
+"\n"
+"Click here if you want to add a program to the listbox. This button opens "
+"a dialog where you are asked to give details about the program you want to "
+"run. To successfully add a program, you must know if it is compatible, the "
+"name of the executable file and, if necessary, its options.
\n"
+"You usually can get the available options to a suitable program by typing "
+"in a terminal emulator the name of the executable file plus --help (foobar --"
+"help).
\n"
+" "
+msgstr ""
+"\n"
+"Kliknite za dodavanje programa na okvir s popisom. Otvorit će se dijalog "
+"putem kojeg možete unijeti detalje o programu koji želite pokrenuti. Da "
+"biste uspješno dodali program potrebno je znati je li kompatibilan, naziv "
+"izvršne datoteke i po potrebi njegove opcije.
\n"
+"Uobičajeno, raspoložive opcije odabranog programa možete saznati ako u "
+"terminalski emulator unesete naziv izvršnog programa uz dodatak opcije --"
+"help (foobar --help).
\n"
+" "
+
+#. i18n: file: bgadvanced_ui.ui:34
+#. i18n: ectx: property (text), widget (QPushButton, m_buttonAdd)
+#. i18n: file: bgwallpaper_ui.ui:92
+#. i18n: ectx: property (text), widget (QPushButton, m_buttonAdd)
+#: rc.cpp:12 rc.cpp:186
+msgid "&Add..."
+msgstr "&Dodaj…"
+
+#. i18n: file: bgadvanced_ui.ui:44
+#. i18n: ectx: property (whatsThis), widget (QPushButton, m_buttonRemove)
+#: rc.cpp:15
+msgid ""
+"Click here to remove programs from this list. Please note that it does not "
+"remove the program from your system, it only removes it from the available "
+"options in the background drawing programs list."
+msgstr ""
+"Kliknite za uklanjanje programa s popisa. Napomena: Ova opcija ne uklanja "
+"program s vašeg sustava, već samo s popisa dostupnih programa za iscrtavanje "
+"pozadine."
+
+#. i18n: file: bgadvanced_ui.ui:59
+#. i18n: ectx: property (whatsThis), widget (QPushButton, m_buttonModify)
+#: rc.cpp:21
+#, fuzzy
+#| msgid ""
+#| "\n"
+#| "Click here if you want to add a program to the listbox. This button "
+#| "opens a dialog where you are asked to give details about the program you "
+#| "want to run. To successfully add a program, you must know if it is "
+#| "compatible, the name of the executable file and, if necessary, its "
+#| "options.
\n"
+#| "You usually can get the available options to a suitable program by "
+#| "typing in a terminal emulator the name of the executable file plus --help "
+#| "(foobar --help).
\n"
+#| " "
+msgid ""
+"\n"
+"Click here to modify the programs options. You usually can get the "
+"available options to a suitable program by typing in a terminal emulator the "
+"name of the executable file plus --help. (example: kwebdesktop --help).
\n"
+" "
+msgstr ""
+"\n"
+"Kliknite za dodavanje programa na okvir s popisom. Otvorit će se dijalog "
+"putem kojeg možete unijeti detalje o programu koji želite pokrenuti. Da "
+"biste uspješno dodali program potrebno je znati je li kompatibilan, naziv "
+"izvršne datoteke i po potrebi njegove opcije.
\n"
+"Uobičajeno, raspoložive opcije odabranog programa možete saznati ako u "
+"terminalski emulator unesete naziv izvršnog programa uz dodatak opcije --"
+"help (foobar --help).
\n"
+" "
+
+#. i18n: file: bgadvanced_ui.ui:62
+#. i18n: ectx: property (text), widget (QPushButton, m_buttonModify)
+#: rc.cpp:26
+msgid "&Modify..."
+msgstr "&Izmijeni…"
+
+#. i18n: file: bgadvanced_ui.ui:101
+#. i18n: ectx: property (whatsThis), widget (QTreeWidget, m_listPrograms)
+#: rc.cpp:29
+#, fuzzy
+#| msgid ""
+#| "\n"
+#| "Select from this listbox the program you want to use to draw your "
+#| "desktop background.
\n"
+#| "The Program column shows the name of the program. \n"
+#| "The Comment column brings a short description. \n"
+#| "The Refresh column indicates the time interval between redraws of "
+#| "the desktop.
\n"
+#| "The K Web Desktop program (kwebdesktop) is worth noting: it "
+#| "draws a specified page of the web in your desktop. You can modify it, and "
+#| "the webpage it draws by selecting it here, then clicking on the "
+#| "Modify button. \n"
+#| "You can also add new compliant programs. To do that, click on the Add"
+#| "b> button. \n"
+#| "You can also remove programs from this list clicking on the Remove "
+#| "button. Please note that it does not remove the program from your system, "
+#| "it only removes it from the available options in this listbox.
\n"
+#| " "
+msgid ""
+"\n"
+"Select from this listbox the program you want to use to draw your desktop "
+"background.
\n"
+"The Program column shows the name of the program. \n"
+"The Comment column brings a short description. \n"
+"The Refresh column indicates the time interval between redraws of the "
+"desktop.
\n"
+"You can also add new compliant programs. To do that, click on the Add"
+"b> button. \n"
+"You can also remove programs from this list clicking on the Remove "
+"button. Please note that it does not remove the program from your system, it "
+"only removes it from the available options in this listbox.
\n"
+" "
+msgstr ""
+"\n"
+"S ovog popisa odaberite program koji želite upotrebljavati za iscrtavanje "
+"pozadine.
\n"
+"Stupac Program prikazuje naziv programa. \n"
+"Stupac Komentar prikazuje kratak opis. \n"
+"Stupac Osvježavanje naznačuje vremensko razdoblje ponovnog "
+"icrstavanja radne površine.
\n"
+"Program K Web Desktop (kwebdesktop) vrijedan je pažnje: na radnoj "
+"površini iscrtava određenu web stranicu. Odabir stranice možete urediti "
+"označavanjem naziva programa i klikanjem gumba Uredi . \n"
+"Moguće je dodati i nov, kompatibilan program. Da biste to uradili kliknite "
+"gumb Dodaj . \n"
+"Programe možete ukloniti s popisa klikanjem gumba Ukloni . Napomena: "
+"Na ovaj način ne uklanjate program sa sustava, već samo s ovog ovog popisa."
+"p>\n"
+"
"
+
+#. i18n: file: bgadvanced_ui.ui:105
+#. i18n: ectx: property (text), widget (QTreeWidget, m_listPrograms)
+#: rc.cpp:39
+msgid "Program"
+msgstr "Program"
+
+#. i18n: file: bgadvanced_ui.ui:110
+#. i18n: ectx: property (text), widget (QTreeWidget, m_listPrograms)
+#: rc.cpp:42
+msgid "Comment"
+msgstr "Komentar"
+
+#. i18n: file: bgadvanced_ui.ui:115
+#. i18n: ectx: property (text), widget (QTreeWidget, m_listPrograms)
+#: rc.cpp:45
+msgid "Refresh"
+msgstr "Osvježi"
+
+#. i18n: file: bgadvanced_ui.ui:123
+#. i18n: ectx: property (whatsThis), widget (QCheckBox, m_cbProgram)
+#: rc.cpp:48
+msgid ""
+"Check here if you want to allow a program to draw your desktop background. "
+"Below you can find the list of programs currently available for drawing the "
+"background. You may use one of the available programs, add new ones or "
+"modify the existing ones to fit your needs."
+msgstr ""
+"Označite ako želite programu dopustiti da iscrtava pozadinu vaše radne "
+"površine. Ispod je prikazan popis trenutno dostupnih programa za iscrtavanje "
+"pozadine. Možete upotrijebiti jedan od dostupnih programa, dodati nove ili "
+"po potrebi urediti postojeće."
+
+#. i18n: file: bgadvanced_ui.ui:126
+#. i18n: ectx: property (text), widget (QCheckBox, m_cbProgram)
+#: rc.cpp:51
+msgid "Use the following program for drawing the background:"
+msgstr "Za iscrtavanje pozadine upotrijebi sljedeći program:"
+
+#. i18n: file: bgadvanced_ui.ui:136
+#. i18n: ectx: property (title), widget (QGroupBox, m_groupCache)
+#: rc.cpp:54
+msgid "Memory Usage"
+msgstr "Upotreba memorije"
+
+#. i18n: file: bgadvanced_ui.ui:142
+#. i18n: ectx: property (whatsThis), widget (QLabel, m_lblCache)
+#. i18n: file: bgadvanced_ui.ui:155
+#. i18n: ectx: property (whatsThis), widget (KIntSpinBox, m_spinCache)
+#: rc.cpp:57 rc.cpp:63
+msgid ""
+"In this box you can enter how much memory KDE should use for caching the "
+"background(s). If you have different backgrounds for the different desktops "
+"caching can make switching desktops smoother at the expense of higher memory "
+"use."
+msgstr ""
+"Unesite veličinu memorije koju bi KDE trebao upotrebljavati za međuspremanje "
+"pozadina. Ako imate različite pozadine, međuspremanje će omogućiti "
+"bezbolniji prelazak između radnih površina, uz veći utrošak radne memorije."
+
+#. i18n: file: bgadvanced_ui.ui:145
+#. i18n: ectx: property (text), widget (QLabel, m_lblCache)
+#: rc.cpp:60
+msgid "Size of background cache:"
+msgstr "Veličina međuspremnika pozadine:"
+
+#. i18n: file: bgadvanced_ui.ui:158
+#. i18n: ectx: property (suffix), widget (KIntSpinBox, m_spinCache)
+#: rc.cpp:66
+msgid " KiB"
+msgstr "KiB"
+
+#. i18n: file: bgdialog_ui.ui:80
+#. i18n: ectx: property (whatsThis), widget (QPushButton, m_buttonIdentifyScreens)
+#: rc.cpp:69
+msgid "Click this button to show the identifying number for each screen."
+msgstr "Prikaz identifikacijskog broja za svaku pozadinu."
+
+#. i18n: file: bgdialog_ui.ui:83
+#. i18n: ectx: property (text), widget (QPushButton, m_buttonIdentifyScreens)
+#: rc.cpp:72
+msgid "Identify Screens"
+msgstr "Identificiraj zaslone"
+
+#. i18n: file: bgdialog_ui.ui:132
+#. i18n: ectx: property (whatsThis), widget (QPushButton, m_buttonAdvanced)
+#: rc.cpp:75
+msgid ""
+"Click this button to set the icon text colors and shadow, set up a program "
+"to run for the background picture or control the size of the background "
+"cache."
+msgstr ""
+"Kliknite ovaj gumb za postavljanje boje i sjene teksta ikone, postavljanje "
+"programa za iscrtavanje pozadine ili upravljanje veličine međuspremnika "
+"pozadine."
+
+#. i18n: file: bgdialog_ui.ui:135
+#. i18n: ectx: property (text), widget (QPushButton, m_buttonAdvanced)
+#: rc.cpp:78
+msgid "Advanced Options"
+msgstr "Napredne opcije"
+
+#. i18n: file: bgdialog_ui.ui:184
+#. i18n: ectx: property (whatsThis), widget (QPushButton, m_buttonGetNew)
+#: rc.cpp:81
+msgid ""
+"Click this button to give you a list of new wallpapers to download from the "
+"Internet."
+msgstr "Kliknite za popis pozadinskih slika koje možete preuzeti s Interneta."
+
+#. i18n: file: bgdialog_ui.ui:187
+#. i18n: ectx: property (text), widget (QPushButton, m_buttonGetNew)
+#: rc.cpp:84
+msgid "Get New Wallpapers"
+msgstr "Nabavite pozadinsku sliku"
+
+#. i18n: file: bgdialog_ui.ui:232
+#. i18n: ectx: property (title), widget (QGroupBox, groupBox3)
+#: rc.cpp:87
+msgid "Options"
+msgstr "Opcije"
+
+#. i18n: file: bgdialog_ui.ui:247
+#. i18n: ectx: property (whatsThis), widget (QLabel, m_lblWallpaperPos)
+#. i18n: file: bgdialog_ui.ui:438
+#. i18n: ectx: property (whatsThis), widget (QComboBox, m_comboWallpaperPos)
+#: rc.cpp:90 rc.cpp:135
+msgid ""
+"You can choose here how a background picture is shown on the desktop:\n"
+"\n"
+"Centered: Center the picture on the desktop. \n"
+" Tiled: Tile the picture beginning at the top left of the "
+"desktop, so the desktop is totally covered up. \n"
+"Center Tiled: Center the picture on the desktop and then tile "
+"around it so that the background is totally covered up. \n"
+"Centered Maxpect: Magnify the picture without distorting it "
+"until it fills either the width or height of the desktop, and then center it "
+"on the desktop. \n"
+"Scaled: Magnify the picture, until the entire desktop is "
+"covered. This may result in some distortion of the picture. \n"
+"Centered Auto Fit: If the picture fits the desktop this mode "
+"works like the Centered option. If the picture is larger than the desktop it "
+"is scaled down to fit while keeping the aspect ratio. \n"
+"Scale and Crop: Magnify the picture without distorting it until "
+"it fills both the width and height of the desktop (cropping the picture if "
+"necessary), and then center it on the desktop. \n"
+" "
+msgstr ""
+"Ovdje možete odabrani način na koji će pozadinska slika biti prikazana:\n"
+"\n"
+"Sredina: Smještanje slike na sredini radne površine. \n"
+" Popločeno: Prekrivanje radne površine popločavanjem slike, "
+"počevši od gornjeg lijevog kuta. \n"
+"Sredina popločeno: Prekrivanje radne površine popločavanjem "
+"slike, počevši od sredine. \n"
+"Sredina uvećano: Uvećanje slike bez njezinog izobličavanja sve "
+"dok ne ispuni visinu ili širinu radne površine i njezino smještanje u "
+"sredinu. \n"
+"Prilagođeno: Uvećavanje slike sve dok potpuno ne ispuni radnu "
+"površinu. Slika bi na ovaj način mogla postati izobličena \n"
+"Sredina automatski prilagođeno Ako veličina slike odgovara "
+"radnoj površini ova opcija funkcionira poput opcije Sredina. Ako je slika "
+"veća od radne površine bit će smanjena, uz održavanje svog omjera. \n"
+"Prilagođeno i obrezano: Uvećanje slike bez njezinog "
+"izobličavanja sve dok podjednako ne ispuni visinu i širinu radne površine, "
+"uz obrezivanje po potrebi, te njezino smještanje u sredinu. \n"
+" "
+
+#. i18n: file: bgdialog_ui.ui:250
+#. i18n: ectx: property (text), widget (QLabel, m_lblWallpaperPos)
+#: rc.cpp:102
+msgid "Posi&tion:"
+msgstr "&Smještaj:"
+
+#. i18n: file: bgdialog_ui.ui:266
+#. i18n: ectx: property (whatsThis), widget (QComboBox, m_comboBlend)
+#: rc.cpp:105
+msgid ""
+"If you have selected to use a background picture you can choose various "
+"methods of blending the background colors with the picture. The default "
+"option of \"No Blending\" means that the picture simply obscures the "
+"background colors below."
+msgstr ""
+"Ako ste odabrali upotrebu pozadinske slike, možete odabrati i različite "
+"načine stapanja boja pozadine sa samom slikom. Zadana opcija je \"Bez "
+"stapanja\",što znači da slika jednostavno prekriva boje ispod sebe."
+
+#. i18n: file: bgdialog_ui.ui:275
+#. i18n: ectx: property (whatsThis), widget (KColorButton, m_colorPrimary)
+#: rc.cpp:108
+msgid "Click to choose the primary background color."
+msgstr "Kliknite da biste odabrali osnovnu boju pozadine."
+
+#. i18n: file: bgdialog_ui.ui:285
+#. i18n: ectx: property (whatsThis), widget (KColorButton, m_colorSecondary)
+#: rc.cpp:111
+msgid ""
+"Click to choose the secondary background color. If no secondary color is "
+"required by the pattern selected this button will be disabled."
+msgstr ""
+"Kliknite da biste odabrali drugu boju pozadine. Ukoliko druga boja nije "
+"potrebna za odabrani uzorak, ovaj će gumb biti onemogućen."
+
+#. i18n: file: bgdialog_ui.ui:297
+#. i18n: ectx: property (text), widget (QLabel, m_lblColors)
+#: rc.cpp:114
+msgid "Co&lors:"
+msgstr "&Boje:"
+
+#. i18n: file: bgdialog_ui.ui:313
+#. i18n: ectx: property (text), widget (QLabel, m_lblBlending)
+#: rc.cpp:117
+msgid "&Blending:"
+msgstr "&Stapanje:"
+
+#. i18n: file: bgdialog_ui.ui:331
+#. i18n: ectx: property (whatsThis), widget (QLabel, m_lblBlendBalance)
+#. i18n: file: bgdialog_ui.ui:347
+#. i18n: ectx: property (whatsThis), widget (QSlider, m_sliderBlend)
+#: rc.cpp:120 rc.cpp:126
+msgid ""
+"You can use this slider to control the degree of blending. You can "
+"experiment by moving the slider and looking at the effects in the preview "
+"image."
+msgstr ""
+"Pomoću ovog klizača možete upravljati razinom stapanja. Možete "
+"eksperimentirati s njegovim pomicanjem i pregledavati učinak."
+
+#. i18n: file: bgdialog_ui.ui:334
+#. i18n: ectx: property (text), widget (QLabel, m_lblBlendBalance)
+#: rc.cpp:123
+msgid "Balance:"
+msgstr "Balans:"
+
+#. i18n: file: bgdialog_ui.ui:374
+#. i18n: ectx: property (whatsThis), widget (QCheckBox, m_cbBlendReverse)
+#: rc.cpp:129
+msgid ""
+"For some types of blending, you can reverse the role of the background and "
+"the picture by checking this option."
+msgstr ""
+"Odabirom ove opcije za neke je vrste stapanja moguće izmijeniti uloge "
+"pozadine i slike."
+
+#. i18n: file: bgdialog_ui.ui:377
+#. i18n: ectx: property (text), widget (QCheckBox, m_cbBlendReverse)
+#: rc.cpp:132
+msgid "Reverse roles"
+msgstr "Obrnute uloge"
+
+#. i18n: file: bgdialog_ui.ui:448
+#. i18n: ectx: property (title), widget (KButtonGroup, m_buttonGroupBackground)
+#: rc.cpp:147
+msgid "Background"
+msgstr "Pozadina"
+
+#. i18n: file: bgdialog_ui.ui:454
+#. i18n: ectx: property (toolTip), widget (QRadioButton, m_radioNoPicture)
+#: rc.cpp:150
+msgid "No picture, color only"
+msgstr "Bez slike, samo boja"
+
+#. i18n: file: bgdialog_ui.ui:457
+#. i18n: ectx: property (text), widget (QRadioButton, m_radioNoPicture)
+#: rc.cpp:153
+msgid "&No picture"
+msgstr "&Bez slike"
+
+#. i18n: file: bgdialog_ui.ui:464
+#. i18n: ectx: property (text), widget (QRadioButton, m_radioSlideShow)
+#: rc.cpp:156
+msgid "&Slide show:"
+msgstr "&Slajdovi:"
+
+#. i18n: file: bgdialog_ui.ui:471
+#. i18n: ectx: property (text), widget (QRadioButton, m_radioPicture)
+#: rc.cpp:159
+msgid "&Picture:"
+msgstr "&Slika:"
+
+#. i18n: file: bgdialog_ui.ui:497
+#. i18n: ectx: property (whatsThis), widget (QPushButton, m_buttonSetupWallpapers)
+#: rc.cpp:162
+msgid ""
+"Click this button to select a set of images to be used as background "
+"pictures. One picture at a time will be shown for a specified amount of "
+"time, after which another image from the set will be shown. Images can be "
+"shown at random or in the order you specify them."
+msgstr ""
+"Kliknite da biste odabrali komplet slika koje će se upotrebljavati kao "
+"pozadinske slike. Svaka će biti prikazana tijekom određenog razdoblja, nakon "
+"kojeg će je zamijeniti druga iz kompleta. Slike mogu biti prikazivane "
+"nasumičnim ili određenim redoslijedom."
+
+#. i18n: file: bgdialog_ui.ui:500
+#. i18n: ectx: property (text), widget (QPushButton, m_buttonSetupWallpapers)
+#: rc.cpp:165
+msgid "Set&up..."
+msgstr "&Postavke…"
+
+#. i18n: file: bgdialog_ui.ui:558
+#. i18n: ectx: property (whatsThis), widget (KComboBox, m_comboScreen)
+#: rc.cpp:168
+msgid ""
+"Choose the screen you wish to configure the background for from this list."
+msgstr "S popisa odaberite zaslon čiju pozadinu želite konfigurirati."
+
+#. i18n: file: bgdialog_ui.ui:562
+#. i18n: ectx: property (text), item, widget (KComboBox, m_comboScreen)
+#: rc.cpp:171
+msgid "Across All Screens"
+msgstr "Preko svih zaslona"
+
+#. i18n: file: bgdialog_ui.ui:567
+#. i18n: ectx: property (text), item, widget (KComboBox, m_comboScreen)
+#: rc.cpp:174
+msgid "On Each Screen"
+msgstr "Na svakom zaslonu"
+
+#. i18n: file: bgwallpaper_ui.ui:19
+#. i18n: ectx: property (text), widget (QLabel, textLabel2)
+#: rc.cpp:177
+msgid "Show the following pictures:"
+msgstr "Prikaži sljedeće slike:"
+
+#. i18n: file: bgwallpaper_ui.ui:29
+#. i18n: ectx: property (text), widget (QCheckBox, m_cbRandom)
+#: rc.cpp:180
+msgid "&Show pictures in random order"
+msgstr "Slike prikaži &nasumično"
+
+#. i18n: file: bgwallpaper_ui.ui:38
+#. i18n: ectx: property (text), widget (QLabel, textLabel1)
+#: rc.cpp:183
+msgid "Change &picture after:"
+msgstr "&Promijeni sliku nakon:"
+
+#. i18n: file: bgwallpaper_ui.ui:122
+#. i18n: ectx: property (text), widget (QPushButton, m_buttonMoveDown)
+#: rc.cpp:192
+msgid "Move &Down"
+msgstr "Prema dnu"
+
+#. i18n: file: bgwallpaper_ui.ui:129
+#. i18n: ectx: property (text), widget (QPushButton, m_buttonMoveUp)
+#: rc.cpp:195
+msgid "Move &Up"
+msgstr "Prema &vrhu"
+
+#~ msgid ""
+#~ "\n"
+#~ "Click here to modify the programs options. You usually can get the "
+#~ "available options to a suitable program by typing in a terminal emulator "
+#~ "the name of the executable file plus --help. (example: kwebdesktop --"
+#~ "help).
\n"
+#~ "One useful example is the program kwebdesktop. It draws a web page on "
+#~ "the background of your desktop. You can use this program by selecting it "
+#~ "on the listbox on the right, but it will draw a predefined web page. To "
+#~ "change the web page it renders, select the kwebdesktop program on the "
+#~ "listbox, then click here. A dialog will appear, allowing you to change "
+#~ "the web page by replacing the old address (URL) with a new one.
\n"
+#~ " "
+#~ msgstr ""
+#~ "\n"
+#~ "Kliknite za uređivanje programskih opcija. Uobičajeno, raspoložive "
+#~ "opcije odabranog programa možete saznati ako u terminalski emulator "
+#~ "unesete naziv izvršnog programa uz dodatak opcije --help. (npr.: "
+#~ "kwebdesktop --help).
\n"
+#~ "Program kwebdesktop je koristan primjer: na pozadinu radne površine "
+#~ "iscrtava web stranicu.Ovaj program možete upotrijebiti njegovim odabirom "
+#~ "s popisa (desno), ali će iscrtati unaprijed određenu stranicu. Da biste "
+#~ "izmijenili web stranicu koju iscrtava, odaberite program kwebdesktop s "
+#~ "popisa i potom kliknite ovdje. Pojavit će se dijalog koji vam omogućuje "
+#~ "izmjenu web stranice zamjenom stare URL adrese s novom.
\n"
+#~ " "
+
+#~ msgid " k"
+#~ msgstr "k"
+
+#~ msgid "Unlimited"
+#~ msgstr "Neograničen"
+
+#~ msgid "Background Icon Text"
+#~ msgstr "Tekst pozadinske ikone"
+
+#~ msgid "Click here to change the color of the desktop font."
+#~ msgstr "Kliknite da biste izmijenili boju fonta radne površine."
+
+#~ msgid "&Text color:"
+#~ msgstr "&Boja teksta:"
+
+#~ msgid ""
+#~ "Click here to select the solid background color. Choose a different color "
+#~ "from the background text color to assure readability."
+#~ msgstr ""
+#~ "Kliknite da biste odabrali punu pozadinsku boju. Da biste osigurali "
+#~ "čitljivost odaberite boju koja se znatno razlikuje od boje pozadinskog "
+#~ "teksta."
+
+#~ msgid ""
+#~ "Check here if you want to use a solid background color. This is useful to "
+#~ "ensure that the desktop text will be identifiable against all background "
+#~ "colors and wallpapers, or in other words, that a background or wallpaper "
+#~ "will not make a desktop text of a similar color difficult to read."
+#~ msgstr ""
+#~ "Kliknite ako za pozadinu želite upotrijebiti punu boju. Ovo je korisna "
+#~ "opcija da bi se osigurala čitljivost teksta na radnoj površini u odnosu "
+#~ "sve boje pozadine i pozadinske slike, odnosno da zbog sličnosti boje "
+#~ "pozadina ili slika neće tekst na radnoj površini učiniti nečitljivim."
+
+#~ msgid "&Use solid color behind text:"
+#~ msgstr "&Upotrijebi punu boju iza teksta:"
+
+#~ msgid ""
+#~ "Check here to enable a shadow outline around the desktop font. This also "
+#~ "improves the readability of the desktop text against backgrounds of a "
+#~ "similar color."
+#~ msgstr ""
+#~ "Kliknite ovdje da biste omogućili sjenčanje fontova na radnoj površini. "
+#~ "Ovo također poboljšava čitljivost teksta na radnoj površini kad je boja "
+#~ "pozadine slična."
+
+#~ msgid "&Enable shadow"
+#~ msgstr "&Omogući sjene"
+
+#~ msgid ""
+#~ "Choose here the maximum number of text lines below an icon on the "
+#~ "desktop. Longer text will be truncated at the end of the last line."
+#~ msgstr ""
+#~ "Ovdje odaberite najveći broj redaka teksta koji će biti prikazan ispod "
+#~ "ikone na radnoj površini. Dulji tekst će biti odrezan na završetku "
+#~ "posljednjeg retka."
+
+#~ msgid "&Lines for icon text:"
+#~ msgstr "&Redaka za tekst ikone:"
+
+#~ msgid ""
+#~ "Choose here the maximum width of text lines (in pixel) below an icon on "
+#~ "the desktop. If set to 'Auto' a default width based on the current font "
+#~ "is used."
+#~ msgstr ""
+#~ "Ovdje odaberite najveću širinu redaka teksta (u pikselima) koja će biti "
+#~ "prikazana ispod ikone na radnoj površini. Ako je odabrano 'Automatski' "
+#~ "bit će upotrijebljena zadana širina određena trenutno upotrebljavanim "
+#~ "fontom."
+
+#~ msgid "Auto"
+#~ msgstr "Automatski"
+
+#~ msgid "&Width for icon text:"
+#~ msgstr "&Širina za tekst ikone:"
+
+#~ msgid "Setting for &desktop:"
+#~ msgstr "&Postavke radne površine:"
+
+#~ msgid ""
+#~ "Choose the desktop you wish to configure the background for from this "
+#~ "list. If you want the same background settings to be applied to all "
+#~ "desktops select the \"All Desktops\" option."
+#~ msgstr ""
+#~ "S ovog popisa odaberite radnu površinu kojoj želite konfigurirati "
+#~ "pozadinu. Ako želite istu konfiguraciju upotrebljavati na svim radnim "
+#~ "površinama, odaberite opciju \"Sve radne površine\"."
+
+#~ msgid "All Desktops"
+#~ msgstr "Sve radne površine"
+
+#~ msgid "kcmbackground"
+#~ msgstr "kcmbackground"
+
+#~ msgid "KDE Background Control Module"
+#~ msgstr "KDE modul upravljanja pozadinom"
+
+#~ msgid "(c) 1997-2002 Martin R. Jones"
+#~ msgstr "(c) 1997-2002 Martin R. Jones"
+
+#, fuzzy
+#~| msgid "(c) 1997-2002 Martin R. Jones"
+#~ msgid "Martin R. Jones"
+#~ msgstr "(c) 1997-2002 Martin R. Jones"
+
+#~ msgctxt "NAME OF TRANSLATORS"
+#~ msgid "Your names"
+#~ msgstr "Renato Pavičić"
+
+#~ msgctxt "EMAIL OF TRANSLATORS"
+#~ msgid "Your emails"
+#~ msgstr "renato@translator-shop.org"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/kcmkwincompositing.po kde-l10n-hr-4.13.0/messages/kde-workspace/kcmkwincompositing.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/kcmkwincompositing.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/kcmkwincompositing.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,672 @@
+# Translation of kcmkwincompositing to Croatian
+#
+# Zarko Pintar , 2009.
+# Andrej Dundovic , 2009, 2010.
+# Marko Dimjasevic , 2009, 2011.
+# Marko Dimjašević , 2011.
+msgid ""
+msgstr ""
+"Project-Id-Version: kcmkwincompositing\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-28 03:52+0200\n"
+"PO-Revision-Date: 2011-07-12 16:57+0200\n"
+"Last-Translator: Marko Dimjašević \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 1.2\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: ktimerdialog.cpp:167
+#, kde-format
+msgid "1 second remaining:"
+msgid_plural "%1 seconds remaining:"
+msgstr[0] "%1 preostala sekunda:"
+msgstr[1] "%1 preostale sekunde:"
+msgstr[2] "%1 sekundi preostalo:"
+
+#: main.cpp:58
+msgid "Confirm Desktop Effects Change"
+msgstr "Prihvati izmjenu efekata radne površine"
+
+#: main.cpp:62
+msgid "&Accept Configuration"
+msgstr "&Prihvati konfiguraciju"
+
+#: main.cpp:63
+msgid "&Return to Previous Configuration"
+msgstr "&Vrati na prethodnu konfiguraciju"
+
+#: main.cpp:65
+msgid ""
+"Desktop effects settings have changed.\n"
+"Do you want to keep the new settings?\n"
+"They will be automatically reverted in 10 seconds."
+msgstr ""
+"Postavke efekata radne površine su izmjenjene.\n"
+"Želite li zadržati nove postavke?\n"
+"Automatski će biti vraćene na stare za 10 sekundi."
+
+#: main.cpp:88
+msgid "Use GLSL shaders"
+msgstr "Koristi sjenčanje GLSL"
+
+#: main.cpp:143
+msgid "kcmkwincompositing"
+msgstr "kcmkwincompositing"
+
+#: main.cpp:144
+msgid "KWin Desktop Effects Configuration Module"
+msgstr "KWin Desktop Effects konfiguracijski modul"
+
+#: main.cpp:145
+msgid "(c) 2007 Rivo Laks"
+msgstr "© 2007 Rivo Laks"
+
+#: main.cpp:146
+msgid "Rivo Laks"
+msgstr "Rivo Laks"
+
+#: main.cpp:177 main.cpp:183
+msgid "No Effect"
+msgstr "Bez efekta"
+
+#: main.cpp:206
+msgid ""
+"Failed to activate desktop effects using the given configuration options. "
+"Settings will be reverted to their previous values.\n"
+"\n"
+"Check your X configuration. You may also consider changing advanced options, "
+"especially changing the compositing type."
+msgstr ""
+"Ne mogu aktivirati efekte radne površine sa zadanim konfiguracijskim "
+"opcijama. Postavke će biti vraćene na stare vrijednosti.\n"
+"\n"
+"Provjerite vašu X konfiguraciju. Također možete razmotriti izmjenu naprednih "
+"opcija, posebno promjenu tipa 3D efekata."
+
+#: main.cpp:243
+msgid "Appearance"
+msgstr "Izgled"
+
+#: main.cpp:244
+msgid "Accessibility"
+msgstr "Pristupačnost"
+
+#: main.cpp:245
+msgid "Focus"
+msgstr "Fokus"
+
+#: main.cpp:246
+msgid "Window Management"
+msgstr "Upravljanje prozorima"
+
+#: main.cpp:247
+msgid "Candy"
+msgstr "Slatkiš"
+
+#: main.cpp:248
+msgid "Demos"
+msgstr "Demonstracije"
+
+#: main.cpp:249
+msgid "Tests"
+msgstr "Testovi"
+
+#: main.cpp:250
+msgid "Tools"
+msgstr "Alati"
+
+#: main.cpp:409
+msgid ""
+"Desktop effects are not available on this system due to the following "
+"technical issues:"
+msgstr ""
+"3D efekti nisu dostupni na ovom sustavu zbog sljedećih tehničkih predmeta:"
+
+#: main.cpp:619
+msgid ""
+"Your settings have been saved but as KDE is currently running in failsafe "
+"mode desktop effects cannot be enabled at this time.\n"
+"\n"
+"Please exit failsafe mode to enable desktop effects."
+msgstr ""
+"Vaše postavke biti će spremljene ali kako KDE trenutno radi u sigurnosnom "
+"načinu, efekti radne površine ne mogu biti omogućeni u ovom trenutku.\n"
+"\n"
+"Molim vas da izađite iz sigurnosnog načina rada kako bi ste omogućili efekte."
+
+#: main.cpp:655
+msgid "The following desktop effects could not be activated:"
+msgstr "Sljedeći efekti radne površine nisu mogli biti aktivirani:"
+
+#: main.cpp:719
+msgid "Desktop Effects "
+msgstr "Efekti radne površine "
+
+#: rc.cpp:1
+msgctxt "NAME OF TRANSLATORS"
+msgid "Your names"
+msgstr "Žarko Pintar, Andrej Dundović"
+
+#: rc.cpp:2
+msgctxt "EMAIL OF TRANSLATORS"
+msgid "Your emails"
+msgstr "zarko.pintar@gmail.com, adundovi@gmail.com"
+
+#. i18n: file: main.ui:21
+#. i18n: ectx: attribute (title), widget (QWidget, tab)
+#: rc.cpp:5
+msgid "General"
+msgstr "Općenito"
+
+#. i18n: file: main.ui:82
+#. i18n: ectx: property (text), widget (QLabel, label_9)
+#: rc.cpp:8
+msgid "Pressing this button can crash the desktop."
+msgstr "Pritiskanje ovog gumba može uzrokovati rušenje radne površine."
+
+#. i18n: file: main.ui:105
+#. i18n: ectx: property (text), widget (QCheckBox, rearmSafetyCheck)
+#: rc.cpp:11
+msgid "I have saved my data."
+msgstr "Spremio sam svoje podatke."
+
+#. i18n: file: main.ui:128
+#. i18n: ectx: property (text), widget (QPushButton, rearmGlSupportButton)
+#: rc.cpp:14
+msgid "Re-enable OpenGL detection"
+msgstr "Ponovno omogući otkrivanje OpenGL-a"
+
+#. i18n: file: main.ui:159
+#. i18n: ectx: property (title), widget (QGroupBox, groupBox_2)
+#: rc.cpp:17
+msgid "Activation"
+msgstr "Aktiviranje"
+
+#. i18n: file: main.ui:168
+#. i18n: ectx: property (text), widget (QCheckBox, useCompositing)
+#: rc.cpp:20
+msgctxt "@option:check"
+msgid "Enable desktop effects at startup"
+msgstr "Omogući efekte radne površine pri pokretanju"
+
+#. i18n: file: main.ui:199
+#. i18n: ectx: property (text), widget (QLabel, label_6)
+#: rc.cpp:23
+msgid "Desktop effects can be toggled anytime using this shortcut:"
+msgstr ""
+"Efekti radne površine možete bilo kada uključiti i isključiti koristeći ovaj "
+"prečac:"
+
+#. i18n: file: main.ui:230
+#. i18n: ectx: property (title), widget (QGroupBox, groupBox)
+#: rc.cpp:26
+#, fuzzy
+#| msgid "Simple effect setup"
+msgctxt "@title:group a few general options to set up desktop effects"
+msgid "Simple effect setup"
+msgstr "Postavljanje jednostavnih efekata"
+
+#. i18n: file: main.ui:239
+#. i18n: ectx: property (text), widget (QCheckBox, effectWinManagement)
+#: rc.cpp:29
+msgid "Improved window management"
+msgstr "Poboljšano upravljanje prozorima"
+
+#. i18n: file: main.ui:249
+#. i18n: ectx: property (text), widget (QCheckBox, effectAnimations)
+#: rc.cpp:32
+msgid "Various animations"
+msgstr "Razne animacije"
+
+#. i18n: file: main.ui:259
+#. i18n: ectx: property (text), widget (QLabel, label_3)
+#: rc.cpp:35
+msgid "Effect for window switching:"
+msgstr "Efekt za prebacivanje prozora:"
+
+#. i18n: file: main.ui:295
+#. i18n: ectx: property (text), widget (QLabel, label_4)
+#: rc.cpp:38
+msgid "Effect for desktop switching:"
+msgstr "efekt za prebacivanje radnih površina:"
+
+#. i18n: file: main.ui:331
+#. i18n: ectx: property (text), widget (QLabel, label_5)
+#: rc.cpp:41
+msgid "Animation speed:"
+msgstr "Brzina animacije:"
+
+#. i18n: file: main.ui:354
+#. i18n: ectx: property (text), item, widget (KComboBox, animationSpeedCombo)
+#: rc.cpp:44
+msgid "Instant"
+msgstr "Trenutno"
+
+#. i18n: file: main.ui:359
+#. i18n: ectx: property (text), item, widget (KComboBox, animationSpeedCombo)
+#: rc.cpp:47
+msgid "Very Fast"
+msgstr "Vrlo brzo"
+
+#. i18n: file: main.ui:364
+#. i18n: ectx: property (text), item, widget (KComboBox, animationSpeedCombo)
+#: rc.cpp:50
+msgid "Fast"
+msgstr "Brzo"
+
+#. i18n: file: main.ui:369
+#. i18n: ectx: property (text), item, widget (KComboBox, animationSpeedCombo)
+#: rc.cpp:53
+msgid "Normal"
+msgstr "Normalno"
+
+#. i18n: file: main.ui:374
+#. i18n: ectx: property (text), item, widget (KComboBox, animationSpeedCombo)
+#: rc.cpp:56
+msgid "Slow"
+msgstr "Sporo"
+
+#. i18n: file: main.ui:379
+#. i18n: ectx: property (text), item, widget (KComboBox, animationSpeedCombo)
+#: rc.cpp:59
+msgid "Very Slow"
+msgstr "Vrlo polako"
+
+#. i18n: file: main.ui:384
+#. i18n: ectx: property (text), item, widget (KComboBox, animationSpeedCombo)
+#: rc.cpp:62
+msgid "Extremely Slow"
+msgstr "Ekstremno sporo"
+
+#. i18n: file: main.ui:418
+#. i18n: ectx: property (text), widget (QLabel, label)
+#: rc.cpp:65
+msgid ""
+"You can find more effects, as well as effect-specific settings, in the \"All "
+"Effects\" tab above."
+msgstr ""
+"Možete pronaći još efekata, kao i postavke vezane uz efekte u \"Svi efekti\" "
+"kartici iznad."
+
+#. i18n: file: main.ui:466
+#. i18n: ectx: attribute (title), widget (QWidget, tab_2)
+#: rc.cpp:68
+msgid "All Effects"
+msgstr "Svi efekti"
+
+#. i18n: file: main.ui:472
+#. i18n: ectx: property (text), widget (QLabel, label_2)
+#: rc.cpp:71
+msgid ""
+"Hint: To find out or configure how to activate an effect, look at the "
+"effect's settings."
+msgstr ""
+"Savjet: Za pronaći gdje ili kako konfigurirati, odnosno aktivirati efekt, "
+"pogledajte na postavke efekta."
+
+#. i18n: file: main.ui:496
+#. i18n: ectx: attribute (title), widget (QWidget, tab_4)
+#: rc.cpp:74
+msgid "Advanced"
+msgstr "Napredno"
+
+#. i18n: file: main.ui:526
+#. i18n: ectx: property (text), widget (QLabel, label_7)
+#: rc.cpp:77
+msgid "Compositing type:"
+msgstr "Tip 3D efekata:"
+
+#. i18n: file: main.ui:546
+#. i18n: ectx: property (text), item, widget (KComboBox, compositingType)
+#: rc.cpp:80
+msgid "OpenGL"
+msgstr "OpenGL"
+
+#. i18n: file: main.ui:551
+#. i18n: ectx: property (text), item, widget (KComboBox, compositingType)
+#: rc.cpp:83
+msgid "XRender"
+msgstr "XRender"
+
+#. i18n: file: main.ui:580
+#. i18n: ectx: property (title), widget (QGroupBox, groupBox_3)
+#: rc.cpp:86
+msgid "General Options"
+msgstr "Opće opcije"
+
+#. i18n: file: main.ui:595
+#. i18n: ectx: property (text), widget (QLabel, label_8)
+#: rc.cpp:89
+msgid "Keep window thumbnails:"
+msgstr "Zadrži prozorske sličice:"
+
+#. i18n: file: main.ui:615
+#. i18n: ectx: property (text), item, widget (KComboBox, windowThumbnails)
+#: rc.cpp:92
+msgctxt ""
+"A window thumbnail requires to have the corresponding window mapped. To have "
+"thumbnails at all time, windows are not unmapped. This can break window "
+"minimization as it is modelled as unmapping of windows."
+msgid "Always (Breaks minimization)"
+msgstr "Uvijek (uništava minimizaciju)"
+
+#. i18n: file: main.ui:620
+#. i18n: ectx: property (text), item, widget (KComboBox, windowThumbnails)
+#: rc.cpp:95
+msgctxt ""
+"Windows are not unmapped if the window is somewhere visible on any of the "
+"virtual desktops."
+msgid "Only for Shown Windows"
+msgstr "Samo za prikazane prozore"
+
+#. i18n: file: main.ui:625
+#. i18n: ectx: property (text), item, widget (KComboBox, windowThumbnails)
+#: rc.cpp:98
+msgctxt ""
+"Windows are unmapped as they are requested. This can lead to not having "
+"updated thumbnials for windows on other desktops."
+msgid "Never"
+msgstr "Nikada"
+
+#. i18n: file: main.ui:639
+#. i18n: ectx: property (text), widget (QLabel, scaleMethodLabel)
+#: rc.cpp:101
+msgid "Scale method:"
+msgstr "Metoda rastezanja:"
+
+#. i18n: file: main.ui:666
+#. i18n: ectx: property (toolTip), widget (QComboBox, xrScaleFilter)
+#: rc.cpp:104
+msgid ""
+"\n"
+" \n"
+"Crisp:
\n"
+"XRenderSetPictureFilter(\"fast\") - Pretty fast on all "
+"GPUs but looks bricky
\n"
+""
+"p>\n"
+"
Smooth:
\n"
+"XRenderSetPictureFilter(\"good\") - linear blending.
\n"
+"Fast enough on newer "
+"nvidia GPUs and maybe others but also can be very slow, you will have to try it.
"
+msgstr ""
+"\n"
+" \n"
+"Krto:
\n"
+"XRenderSetPictureFilter(\"fast\") – Poprilično brzo na "
+"svim GPU-ovima, no izgleda kockasto
\n"
+""
+"p>\n"
+"
Uglađeno:
\n"
+"XRenderSetPictureFilter(\"good\") - linearno stapanje.
\n"
+"Dovoljno brzo na novijim "
+"nvidijinim GPU-ovima i možda i na ostali, no također može biti vrlo sporo; morat ćete isprobati."
+"p>"
+
+#. i18n: file: main.ui:673
+#. i18n: ectx: property (text), item, widget (QComboBox, xrScaleFilter)
+#. i18n: file: main.ui:706
+#. i18n: ectx: property (text), item, widget (QComboBox, glScaleFilter)
+#: rc.cpp:116 rc.cpp:138
+msgid "Crisp"
+msgstr "Krto"
+
+#. i18n: file: main.ui:678
+#. i18n: ectx: property (text), item, widget (QComboBox, xrScaleFilter)
+#: rc.cpp:119
+msgid "Smooth (slower)"
+msgstr "Uglađeno (sporije)"
+
+#. i18n: file: main.ui:699
+#. i18n: ectx: property (toolTip), widget (QComboBox, glScaleFilter)
+#: rc.cpp:122
+msgid ""
+"\n"
+"
\n"
+"Crisp:
\n"
+"GL_NEAREST - (very) fast on all GPUs but looks bricky
\n"
+""
+"p>\n"
+"
Smooth:
\n"
+"GL_LINEAR - fast on most GPUs but a little blurry
\n"
+""
+"p>\n"
+"
Accurate:
\n"
+"Lanczos filter, requires "
+"shader support (glsl or arb).
\n"
+"Might be slow on weaker "
+"GPUs and even cause various troubles with broken drivers (from "
+"overbrightening to segfaults.)
\n"
+"Fall back to \"Smooth\" if "
+"you have problems.
"
+msgstr ""
+"\n"
+" \n"
+"Kruto:
\n"
+"GL_NEAREST – (poprilično) brzo na svim GPU-ovima, no "
+"izgleda kockasto
\n"
+""
+"p>\n"
+"
Uglađeno:
\n"
+"GL_LINEAR – brzo na većini GPU-ova, no malo je zamagljeno"
+"p>\n"
+"
"
+"p>\n"
+"
Precizno:
\n"
+"Filtar Lanczos, treba "
+"podršku za sjenčanje (glsl ili arb).
\n"
+"Može biti sporo na "
+"slabijim GPU-ovima ili čak uzrokovati razne probleme s nevaljalim "
+"upravljačkim programima (od prejakog osvjetljenja do \"segfaultova\".)
\n"
+"Vratite na \"Uglađeno\" "
+"ako imate problema.
"
+
+#. i18n: file: main.ui:711
+#. i18n: ectx: property (text), item, widget (QComboBox, glScaleFilter)
+#: rc.cpp:141
+msgid "Smooth"
+msgstr "Uglađeno"
+
+#. i18n: file: main.ui:716
+#. i18n: ectx: property (text), item, widget (QComboBox, glScaleFilter)
+#: rc.cpp:144
+msgid "Accurate"
+msgstr "Precizno"
+
+#. i18n: file: main.ui:726
+#. i18n: ectx: property (text), widget (QCheckBox, unredirectFullscreen)
+#: rc.cpp:147
+msgid "Suspend desktop effects for fullscreen windows"
+msgstr ""
+"Obustavi efekte radne površine za prozore rastegnute preko cijelog zaslona"
+
+#. i18n: file: main.ui:768
+#. i18n: ectx: property (title), widget (QGroupBox, glGroup)
+#: rc.cpp:150
+msgid "OpenGL Options"
+msgstr "OpenGL opcije"
+
+#. i18n: file: main.ui:777
+#. i18n: ectx: property (text), widget (QCheckBox, glVSync)
+#: rc.cpp:153
+msgid "Use VSync"
+msgstr "Koristi VSync"
+
+#. i18n: file: main.ui:788
+#. i18n: ectx: property (toolTip), widget (QCheckBox, glShaders)
+#: rc.cpp:156
+msgid ""
+"If enabled all rendering will be performed with Shaders written in the "
+"OpenGL Shading Language.\n"
+"On legacy hardware disabling Shaders can improve the performance."
+msgstr ""
+"Ako je omogućeno, svo iscrtavanje će se izvršiti uz Sjenčanje napisano u "
+"OpenGL-ovom jeziku za sjenčanje.\n"
+" Na starom hardveru onemogućavanje Sjenčanja može poboljšati performanse."
+
+#. i18n: file: main.ui:791
+#. i18n: ectx: property (text), widget (QCheckBox, glShaders)
+#: rc.cpp:160
+msgid "Use OpenGL 2 Shaders"
+msgstr "Koristi OpenGL 2 Sjenčanje"
+
+#~ msgid "Enable direct rendering"
+#~ msgstr "Omogući direktno renderiranje"
+
+#~ msgid "Disable functionality checks"
+#~ msgstr "Onemogući provjere funkcionalnosti"
+
+#~ msgid "Desktop effects are active"
+#~ msgstr "Efekti radne površine su aktivni"
+
+#~ msgid "Suspend Desktop Effects"
+#~ msgstr "Obustavi efekte radne površine"
+
+#~ msgid "Desktop effects are temporarily disabled"
+#~ msgstr "3D efekti privremeno su onemogućeni"
+
+#~ msgid "Resume Desktop Effects"
+#~ msgstr "Vrati efekte radne površine"
+
+#~ msgid "Desktop effects are disabled"
+#~ msgstr "Efekti radne površine su onemogućeni"
+
+#~ msgid "Common Settings"
+#~ msgstr "Česte postavke"
+
+#~ msgid "Compositing State"
+#~ msgstr "Stanje 3D efekata"
+
+#~ msgid "Shadows"
+#~ msgstr "Sjene"
+
+#~ msgid "OpenGL mode:"
+#~ msgstr "OpenGL način:"
+
+#~ msgid "Texture From Pixmap"
+#~ msgstr "Teksture iz Pixmap-a"
+
+#~ msgid "Shared Memory"
+#~ msgstr "Dijeljena memorija"
+
+#~ msgid "Fallback"
+#~ msgstr "Pričuvni"
+
+#~ msgid ""
+#~ "Enabling this option allows compositing to be activated even if some of "
+#~ "the internal checks fail. Doing so may make the whole desktop unusable "
+#~ "and its use is not recommened. Use only if KWin refuses to activate "
+#~ "compositing on a system that should be capable of compositing.\n"
+#~ msgstr ""
+#~ "Omogućavanje ove opcije dozvoljava aktiviranje 3D efekata čak i ako su "
+#~ "neke od internih provjera neuspješne. Čineći ovo možete prouzročiti da je "
+#~ "cijela radna površina neupotrebljiva te se njezina upotreba ne "
+#~ "preporučuje. Ovo koristite samo ako KWin odbija aktivirati 3D efekte na "
+#~ "računalu koje je sposobno izvršavati 3D efekte.\n"
+
+#~ msgid "Texture filter:"
+#~ msgstr "Filter teksture:"
+
+#~ msgid "Nearest (fastest)"
+#~ msgstr "Najbliži (najbrže)"
+
+#~ msgid "Bilinear"
+#~ msgstr "Bilinearno"
+
+#~ msgid "Trilinear (best quality)"
+#~ msgstr "Trilinear (najbolja kvaliteta)"
+
+#~ msgid "Compositing is not supported on your system."
+#~ msgstr "3D efekti nisu podržani od strane vašeg računala."
+
+#~ msgid "Compositing is active"
+#~ msgstr "3D efekti su aktivni"
+
+#~ msgid "Suspend Compositing"
+#~ msgstr "Zaustavi 3D efekte"
+
+#~ msgid "Resume Compositing"
+#~ msgstr "Vrati 3D efekte"
+
+#~ msgid "Compositing is disabled"
+#~ msgstr "3D efekti su onemogućeni"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/kcmscreensaver.po kde-l10n-hr-4.13.0/messages/kde-workspace/kcmscreensaver.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/kcmscreensaver.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/kcmscreensaver.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,356 @@
+# Translation of kcmscreensaver to Croatian
+#
+# Translators: Denis Lackovic ,Diana Ćorluka ,Ljubomir Božić ,Robert Avilov ,Roko Roic ,Vlatko Kosturjak ,
+# Zarko Pintar , 2009.
+# Andrej Dundovic , 2009, 2010.
+msgid ""
+msgstr ""
+"Project-Id-Version: kcmscreensaver 0\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-02 05:37+0200\n"
+"PO-Revision-Date: 2010-03-18 10:58+0100\n"
+"Last-Translator: Andrej Dundovic \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 1.0\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: category_list.cpp:7
+msgctxt "Screen saver category"
+msgid "Banners & Pictures"
+msgstr "Zastavice i slike"
+
+#: category_list.cpp:8
+msgctxt "Screen saver category"
+msgid "Desktop Distortions"
+msgstr "Distorzije radne površine"
+
+#: category_list.cpp:9
+msgctxt "Screen saver category"
+msgid "Flying Things"
+msgstr "Leteći objekti"
+
+#: category_list.cpp:10
+msgctxt "Screen saver category"
+msgid "Fractals"
+msgstr "Fraktali"
+
+#: category_list.cpp:11
+msgctxt "Screen saver category"
+msgid "Gadgets & Simulations"
+msgstr "Naprave i simulacije"
+
+#: category_list.cpp:12
+msgctxt "Screen saver category"
+msgid "Illusions of Depth"
+msgstr "Iluzije dubine"
+
+#: category_list.cpp:13
+msgctxt "Screen saver category"
+msgid "Miscellaneous"
+msgstr "Razno"
+
+#: category_list.cpp:14
+msgctxt "Screen saver category"
+msgid "OpenGL Screen Savers"
+msgstr "OpenGL zaštitnik zaslona (screen saver)"
+
+#: category_list.cpp:15
+msgctxt "Screen saver category"
+msgid "Rapid Motion"
+msgstr "Brzi pomaci"
+
+#: category_list.cpp:16
+msgctxt "Screen saver category"
+msgid "Visit to Flatland"
+msgstr "Posjeti Flatland"
+
+#: rc.cpp:1
+msgctxt "NAME OF TRANSLATORS"
+msgid "Your names"
+msgstr "Žarko Pintar"
+
+#: rc.cpp:2
+msgctxt "EMAIL OF TRANSLATORS"
+msgid "Your emails"
+msgstr "zarko.pintar@gmail.com"
+
+#. i18n: file: screensaver.ui:70
+#. i18n: ectx: property (title), widget (QGroupBox, mSettingsGroup)
+#: rc.cpp:5
+msgid "Settings"
+msgstr "Postavke"
+
+#. i18n: file: screensaver.ui:76
+#. i18n: ectx: property (whatsThis), widget (QCheckBox, mEnabledCheckBox)
+#: rc.cpp:8
+msgid "Automatically start the screen saver after a period of inactivity."
+msgstr "Automatski pokreni čuvar zaslona nakon nekog vremena neaktivnosti."
+
+#. i18n: file: screensaver.ui:79
+#. i18n: ectx: property (text), widget (QCheckBox, mEnabledCheckBox)
+#: rc.cpp:11
+msgid "Start a&utomatically after:"
+msgstr "Pokreni a&utomatski nakon:"
+
+#. i18n: file: screensaver.ui:102
+#. i18n: ectx: property (whatsThis), widget (QCheckBox, mLockCheckBox)
+#: rc.cpp:14
+msgid ""
+"Prevent potential unauthorized use by requiring a password to stop the "
+"screen saver."
+msgstr ""
+"Spriječi moguće neovlašteno korištenje zahtijevajući zaporku za "
+"zaustavljanje čuvara zaslona."
+
+#. i18n: file: screensaver.ui:105
+#. i18n: ectx: property (text), widget (QCheckBox, mLockCheckBox)
+#: rc.cpp:17
+msgid "&Require password after:"
+msgstr "Zahtijevaj &zaporku nakon:"
+
+#. i18n: file: screensaver.ui:112
+#. i18n: ectx: property (whatsThis), widget (KIntSpinBox, mWaitLockEdit)
+#: rc.cpp:20
+msgid ""
+"The amount of time, after the screen saver has started, to ask for the "
+"unlock password."
+msgstr ""
+"Vrijeme, nakon kojeg će se pokrenuti čuvar zaslona, kako bi pitao za zaporku "
+"otključavanja."
+
+#. i18n: file: screensaver.ui:132
+#. i18n: ectx: property (whatsThis), widget (QCheckBox, mPlasmaCheckBox)
+#: rc.cpp:23
+msgid "Add widgets to your screensaver."
+msgstr "Dodajte widgete na vaš čuvar zaslona"
+
+#. i18n: file: screensaver.ui:135
+#. i18n: ectx: property (text), widget (QCheckBox, mPlasmaCheckBox)
+#: rc.cpp:26
+msgid "Allow widgets on screen saver"
+msgstr "Dozvoli widgete na čuvaru zaslona"
+
+#. i18n: file: screensaver.ui:160
+#. i18n: ectx: property (text), widget (KPushButton, mPlasmaSetup)
+#: rc.cpp:29
+msgid "Configure Widgets..."
+msgstr "Konfiguriraj widgete …"
+
+#. i18n: file: screensaver.ui:185
+#. i18n: ectx: property (title), widget (QGroupBox, groupBox)
+#: rc.cpp:32
+msgid "Screen Saver"
+msgstr "Čuvar zaslona"
+
+#. i18n: file: screensaver.ui:207
+#. i18n: ectx: property (whatsThis), widget (KPushButton, mTestBt)
+#: rc.cpp:35
+msgid "Show a full screen preview of the screen saver."
+msgstr "Pokaži izgled čuvara zaslona preko cijelog zaslona."
+
+#. i18n: file: screensaver.ui:210
+#. i18n: ectx: property (text), widget (KPushButton, mTestBt)
+#: rc.cpp:38
+msgid "&Test"
+msgstr "&Isprobaj"
+
+#. i18n: file: screensaver.ui:220
+#. i18n: ectx: property (whatsThis), widget (KPushButton, mSetupBt)
+#: rc.cpp:41
+msgid "Configure the screen saver's options, if any."
+msgstr "Konfigurirajte opcije čuvara zaslona, ako ih ima."
+
+#. i18n: file: screensaver.ui:223
+#. i18n: ectx: property (text), widget (KPushButton, mSetupBt)
+#: rc.cpp:44
+msgid "&Setup..."
+msgstr "&Podešavanje …"
+
+#. i18n: file: screensaver.ui:230
+#. i18n: ectx: property (whatsThis), widget (QTreeWidget, mSaverListView)
+#: rc.cpp:47
+msgid "Select the screen saver to use."
+msgstr "Odaberitee čuvar zaslona za korištenje."
+
+#: scrnsave.cpp:115
+msgid ""
+"Screen Saver This module allows you to enable and configure a "
+"screen saver. Note that you can enable a screen saver even if you have power "
+"saving features enabled for your display.
Besides providing an "
+"endless variety of entertainment and preventing monitor burn-in, a screen "
+"saver also gives you a simple way to lock your display if you are going to "
+"leave it unattended for a while. If you want the screen saver to lock the "
+"session, make sure you enable the \"Require password\" feature of the screen "
+"saver; if you do not, you can still explicitly lock the session using the "
+"desktop's \"Lock Session\" action.
"
+msgstr ""
+"Čuvar zaslona Ovaj modul omogućava vam ukjlučivanje i "
+"konfiguriranje čuvara zaslona. Imajte na umu da možete uključiti čuvar "
+"zaslona čak i ako su značajke štednje energije ztaslona uključene.
"
+"Osim toga ima ih beskrajnonzabavnih, a štite monitor od pregaranja. Čuvar "
+"zaslona vam također nudi jednostavan način da zaključate vaš ekran ako "
+"ostavljate računalo bez nadzora na neko vrijeme. Ako želite da čuvar zaslona "
+"zaključa sesiju, onda uključite značajku čuvara zaslona \"Potrebna zaporka"
+"\"; ako to ne učinite, možete još uvijek eksplicitno zaključati sesiju "
+"koristeći radnju radne površine \"Zaključaj sesiju\".
"
+
+#: scrnsave.cpp:152
+msgctxt "unit of time. minutes until the screensaver is triggered"
+msgid " minute"
+msgid_plural " minutes"
+msgstr[0] " minuta"
+msgstr[1] " minute"
+msgstr[2] " minuta"
+
+#: scrnsave.cpp:164
+msgid " second"
+msgid_plural " seconds"
+msgstr[0] "sekunda"
+msgstr[1] "sekunde"
+msgstr[2] "sekundi"
+
+#: scrnsave.cpp:181
+msgid "A preview of the selected screen saver."
+msgstr "Izgled odabranog čuvara zaslona."
+
+#: scrnsave.cpp:200
+msgid "kcmscreensaver"
+msgstr "kcmscreensaver"
+
+#: scrnsave.cpp:200
+msgid "KDE Screen Saver Control Module"
+msgstr "KDE kontrolni modul čuvara zaslona"
+
+#: scrnsave.cpp:202
+msgid ""
+"(c) 1997-2002 Martin R. Jones\n"
+"(c) 2003-2004 Chris Howells"
+msgstr ""
+"(c) 1997-2002 Martin R. Jones\n"
+"(c) 2003-2004 Chris Howells"
+
+#: scrnsave.cpp:204
+msgid "Chris Howells"
+msgstr "Chris Howells"
+
+#: scrnsave.cpp:205
+msgid "Martin R. Jones"
+msgstr "Martin R. Jones"
+
+#: scrnsave.cpp:382
+msgid "Loading..."
+msgstr "Učitavam …"
+
+#~ msgid "Advanced Options"
+#~ msgstr "Napredne opcije"
+
+#~ msgid ""
+#~ "Specify the priority that the screensaver will run at. A higher priority "
+#~ "may mean that the screensaver runs faster, though may reduce the speed "
+#~ "that other programs run at while the screensaver is active."
+#~ msgstr ""
+#~ "Odredi prioritet po kojemu će se pokrenuti čuvar zaslona. Viši prioritet "
+#~ "može značiti da će čuvar zaslona raditi brže, iako može spustiti brzinu "
+#~ "ostalih programa koji rade dok je aktivan."
+
+#~ msgid ""
+#~ "The action to take when the mouse cursor is located in the top left "
+#~ "corner of the screen for 15 seconds."
+#~ msgstr ""
+#~ "Radnja koja će se izvršiti kada se pokazivač miša nalazi na gornjem "
+#~ "lijevom kutu zaslona više od 15 sekundi."
+
+#~ msgid ""
+#~ "The action to take when the mouse cursor is located in the top right "
+#~ "corner of the screen for 15 seconds."
+#~ msgstr ""
+#~ "Radnja koja će se izvršiti kada se pokazivač miša nalazi na gornjem "
+#~ "desnom kutu zaslona više od 15 sekundi."
+
+#~ msgid ""
+#~ "The action to take when the mouse cursor is located in the bottom left "
+#~ "corner of the screen for 15 seconds."
+#~ msgstr ""
+#~ "Radnja koja će se izvršiti kada se pokazivač miša nalazi na donjem "
+#~ "lijevom kutu zaslona više od 15 sekundi."
+
+#~ msgid ""
+#~ "The action to take when the mouse cursor is located in the bottom right "
+#~ "corner of the screen for 15 seconds."
+#~ msgstr ""
+#~ "Radnja koja će se izvršiti kada se pokazivač miša nalazi na donjem desnom "
+#~ "kutu zaslona više od 15 sekundi."
+
+#~ msgid "Screen Corner Actions"
+#~ msgstr "Radnje kutova zaslona"
+
+#~ msgid "Top left:"
+#~ msgstr "Gore lijevo:"
+
+#~ msgid "No Action"
+#~ msgstr "Bez radnje"
+
+#~ msgid "Lock Screen"
+#~ msgstr "Zaključaj zaslon"
+
+#~ msgid "Prevent Locking"
+#~ msgstr "Spriječi zaključavanje"
+
+#~ msgid "Top right:"
+#~ msgstr "Gore desno:"
+
+#~ msgid "Bottom left:"
+#~ msgstr "Dolje lijevo:"
+
+#~ msgid "Bottom right:"
+#~ msgstr "Dolje desno:"
+
+#~ msgid "Screen Saver Priority"
+#~ msgstr "Prioritet čuvara zaslona"
+
+#~ msgid "Low"
+#~ msgstr "Nisko"
+
+#~ msgid "Medium"
+#~ msgstr "Srednje"
+
+#~ msgid "High"
+#~ msgstr "Visoko"
+
+#~ msgid "Advanced &Options"
+#~ msgstr "Napredne &opcije"
+
+#~ msgid "The period of inactivity after which the screen saver should start."
+#~ msgstr "Period neaktivnosti nakon kojeg če se pokrenuti čuvar zaslona."
+
+#~ msgid "After:"
+#~ msgstr "Nakon:"
+
+#~ msgid "Form"
+#~ msgstr "Oblik"
+
+#~ msgid "Choose the period after which the display will be locked. "
+#~ msgstr "Odaberite period nakon kojeg će ekran biti zaključan."
+
+#, fuzzy
+#~| msgid "&Setup..."
+#~ msgid "Setup..."
+#~ msgstr "&Podešavanje..."
+
+#, fuzzy
+#~| msgctxt "Screen saver category"
+#~| msgid "Desktop Distortions"
+#~ msgid "Desktop Widgets"
+#~ msgstr "Distorzije radne površine"
+
+#, fuzzy
+#~ msgid "Screen saver category"
+#~ msgstr "Čuvar zaslona"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/kcmsmartcard.po kde-l10n-hr-4.13.0/messages/kde-workspace/kcmsmartcard.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/kcmsmartcard.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/kcmsmartcard.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,221 @@
+# Translation of kcmsmartcard to Croatian
+#
+# DoDo , 2009.
+# Andrej Dundović , 2009.
+msgid ""
+msgstr ""
+"Project-Id-Version: kcmsmartcard\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-02 05:37+0200\n"
+"PO-Revision-Date: 2009-12-09 08:30+0100\n"
+"Last-Translator: Andrej Dundović \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"X-Generator: Lokalize 1.0\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: rc.cpp:1
+msgctxt "NAME OF TRANSLATORS"
+msgid "Your names"
+msgstr "Renato Pavičić, Nikola Gotovac"
+
+#: rc.cpp:2
+msgctxt "EMAIL OF TRANSLATORS"
+msgid "Your emails"
+msgstr "renato@translator-shop.org, nikola.gotovac@zg.hinet.hr"
+
+#. i18n: file: nosmartcardbase.ui:24
+#. i18n: ectx: property (text), widget (QLabel)
+#: rc.cpp:5
+msgid "Unable to contact the KDE smartcard service. "
+msgstr "Nije moguće kontaktirati KDE SmartCard uslugu. "
+
+#. i18n: file: nosmartcardbase.ui:35
+#. i18n: ectx: property (title), widget (QGroupBox)
+#: rc.cpp:8
+msgid "Possible Reasons"
+msgstr "Vjerojatni razlozi"
+
+#. i18n: file: nosmartcardbase.ui:49
+#. i18n: ectx: property (text), widget (QLabel)
+#: rc.cpp:11
+msgid ""
+"\n"
+"1) The KDE daemon, 'kded' is not running. You can restart it by running the "
+"command 'kdeinit' and then try reloading the KDE System Settings to see if "
+"this message goes away.\n"
+"\n"
+"2) You do not appear to have smartcard support in the KDE libraries. You "
+"will need to recompile the kdelibs package with libpcsclite installed."
+msgstr ""
+"\n"
+"1) KDE-ov servis 'kded' nije pokrenut. Možete ga ponovo pokrenuti naredbom "
+"'kdeinit' i potom pokušati s ponovnim učitavanjem KDE Postavki sustava za "
+"provjeru ispisuje li se ponovno ova poruka.\n"
+"\n"
+"2) Izgleda da u KDE bibliotekama nemate podršku za pametne kartice "
+"(smartcard). Morate ponovno sastaviti paket kdelibs uz instaliranu "
+"biblioteku libpcsclite."
+
+#. i18n: file: smartcardbase.ui:31
+#. i18n: ectx: attribute (title), widget (QWidget)
+#: rc.cpp:17
+msgid "Smartcard Support"
+msgstr "SmartCard podrška"
+
+#. i18n: file: smartcardbase.ui:42
+#. i18n: ectx: property (text), widget (QCheckBox)
+#: rc.cpp:20
+msgid "&Enable smartcard support"
+msgstr "&Omogući SmartCard podršku"
+
+#. i18n: file: smartcardbase.ui:61
+#. i18n: ectx: property (text), widget (QCheckBox)
+#: rc.cpp:23
+msgid "Enable &polling to autodetect card events"
+msgstr "Omogući &prikupljanje za autodetekciju događaja na kartici"
+
+#. i18n: file: smartcardbase.ui:64
+#. i18n: ectx: property (whatsThis), widget (QCheckBox)
+#: rc.cpp:26
+msgid ""
+"In most cases you should have this enabled. It allows KDE to automatically "
+"detect card insertion and reader hotplug events."
+msgstr ""
+"Ovu biste opciju u većini slučaje trebali omogućiti. Ona KDE-u dopušta "
+"automatsko otkrivanje umetanja kartice i događaja na čitaču."
+
+#. i18n: file: smartcardbase.ui:92
+#. i18n: ectx: property (text), widget (QCheckBox)
+#: rc.cpp:29
+msgid "Automatically &launch card manager if inserted card is unclaimed"
+msgstr ""
+"&Automatski pokreni upravitelja karticama ako umetnuta kartica nije "
+"prepoznata"
+
+#. i18n: file: smartcardbase.ui:95
+#. i18n: ectx: property (whatsThis), widget (QCheckBox)
+#: rc.cpp:32
+msgid ""
+"When you insert a smartcard, KDE can automatically launch a management tool "
+"if no other application attempts to use the card."
+msgstr ""
+"Nakon umetanja kartice KDE može automatski pokrenut alat za upravljanje ako "
+"neka druga aplikacija ne pokušava upotrijebiti karticu."
+
+#. i18n: file: smartcardbase.ui:106
+#. i18n: ectx: property (text), widget (QCheckBox)
+#: rc.cpp:35
+msgid "&Beep on card insert and removal"
+msgstr "Oglasi &zvukom pri umetanju i vađenju kartice "
+
+#. i18n: file: smartcardbase.ui:135
+#. i18n: ectx: attribute (title), widget (QWidget)
+#: rc.cpp:38
+msgid "Readers"
+msgstr "Čitači"
+
+#. i18n: file: smartcardbase.ui:152
+#. i18n: ectx: property (text), widget (K3ListView)
+#: rc.cpp:41
+msgid "Reader"
+msgstr "Čitač"
+
+#. i18n: file: smartcardbase.ui:163
+#. i18n: ectx: property (text), widget (K3ListView)
+#: rc.cpp:44
+msgid "Type"
+msgstr "Vrsta"
+
+#. i18n: file: smartcardbase.ui:174
+#. i18n: ectx: property (text), widget (K3ListView)
+#: rc.cpp:47
+msgid "Subtype"
+msgstr "Podvrsta"
+
+#. i18n: file: smartcardbase.ui:185
+#. i18n: ectx: property (text), widget (K3ListView)
+#: rc.cpp:50
+msgid "SubSubtype"
+msgstr "PodPodvrsta"
+
+#. i18n: file: smartcardbase.ui:228
+#. i18n: ectx: property (title), widget (QGroupBox)
+#: rc.cpp:53
+msgid "PCSCLite Configuration"
+msgstr "PCSCLite konfiguriranje"
+
+#. i18n: file: smartcardbase.ui:251
+#. i18n: ectx: property (text), widget (QLabel)
+#: rc.cpp:56
+msgid ""
+"To add new readers you have to modify /etc/readers.conf file and re-start "
+"pcscd"
+msgstr ""
+"Za dodavanje novih čitača potrebno je izmjeniti datoteku /etc/readers.conf i "
+"ponovo pokrenuti pcsd"
+
+#: smartcard.cpp:65
+msgid "kcmsmartcard"
+msgstr "kcmsmartcard"
+
+#: smartcard.cpp:65
+msgid "KDE Smartcard Control Module"
+msgstr "KDE SmartCard upravljački modul"
+
+#: smartcard.cpp:67
+msgid "(c) 2001 George Staikos"
+msgstr "© 2001 George Staikos"
+
+#: smartcard.cpp:69
+msgid "George Staikos"
+msgstr "George Staikos"
+
+#: smartcard.cpp:79
+msgid "Change Module..."
+msgstr "Promijeni modul …"
+
+#: smartcard.cpp:134
+msgid "Unable to launch KCardChooser"
+msgstr "Nije moguće pokrenuti KCardChooser"
+
+#: smartcard.cpp:183
+msgid "No card inserted"
+msgstr "Kartica nije umetnuta"
+
+#: smartcard.cpp:224
+msgid "Smart card support disabled"
+msgstr "SmartCard podrška je onemogućena"
+
+#: smartcard.cpp:235
+msgid "No readers found. Check 'pcscd' is running"
+msgstr "Čitač nije pronađen. Provjerite je li 'pcscd' pokrenut."
+
+#: smartcard.cpp:260 smartcard.cpp:280
+msgid "NO ATR or no card inserted"
+msgstr "NO ATR ili kartica nije umetnuta"
+
+#: smartcard.cpp:292
+msgid "Managed by: "
+msgstr "Upravljač:"
+
+#: smartcard.cpp:302
+msgid "No module managing this card"
+msgstr "Nema modula koji upravlja ovom karticom"
+
+#: smartcard.cpp:395
+msgid ""
+"smartcard This module allows you to configure KDE support for "
+"smartcards. These can be used for various tasks such as storing SSL "
+"certificates and logging in to the system."
+msgstr ""
+"SmartCard Ovaj modul omogućava konfiguriranje KDE podrške za "
+"SmartCard kartice. One se mogu upotrebljavati za razne namjene, poput "
+"čuvanja SSL potvrda i prijavljivanja na sustav."
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/kcmworkspaceoptions.po kde-l10n-hr-4.13.0/messages/kde-workspace/kcmworkspaceoptions.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/kcmworkspaceoptions.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/kcmworkspaceoptions.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,123 @@
+# Translation of kcmworkspaceoptions to Croatian
+#
+# Andrej Dundovic , 2009, 2010.
+# Marko Dimjasevic , 2010, 2011.
+# Marko Dimjašević , 2011.
+msgid ""
+msgstr ""
+"Project-Id-Version: \n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-02 05:37+0200\n"
+"PO-Revision-Date: 2011-07-13 17:37+0200\n"
+"Last-Translator: Marko Dimjašević \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"X-Generator: Lokalize 1.2\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: rc.cpp:1
+msgctxt "NAME OF TRANSLATORS"
+msgid "Your names"
+msgstr "Andrej Dundović"
+
+#: rc.cpp:2
+msgctxt "EMAIL OF TRANSLATORS"
+msgid "Your emails"
+msgstr "andrej@dundovic.com.hr"
+
+#. i18n: file: mainpage.ui:17
+#. i18n: ectx: property (text), widget (QLabel, label_3)
+#: rc.cpp:5
+msgid "Workspace Type:"
+msgstr "Vrsta radnog prostora:"
+
+#. i18n: file: mainpage.ui:28
+#. i18n: ectx: property (text), item, widget (QComboBox, formFactor)
+#: rc.cpp:8
+msgctxt "Form factor: desktop computer"
+msgid "Desktop"
+msgstr "Stolno računalo"
+
+#. i18n: file: mainpage.ui:33
+#. i18n: ectx: property (text), item, widget (QComboBox, formFactor)
+#: rc.cpp:11
+msgctxt "Form factor: netbook computer"
+msgid "Netbook"
+msgstr "Netbook"
+
+#. i18n: file: mainpage.ui:41
+#. i18n: ectx: property (text), widget (QLabel, dashboardLabel)
+#: rc.cpp:14
+msgid "Dashboard:"
+msgstr "Nadzorna ploča:"
+
+#. i18n: file: mainpage.ui:52
+#. i18n: ectx: property (text), item, widget (QComboBox, dashboardMode)
+#: rc.cpp:17
+msgid "Show Desktop Widgets"
+msgstr "Prikaži widgete radne površine"
+
+#. i18n: file: mainpage.ui:57
+#. i18n: ectx: property (text), item, widget (QComboBox, dashboardMode)
+#: rc.cpp:20
+msgid "Show an Independent Widget Set"
+msgstr "Prikaži neovisan skup widgeta"
+
+#. i18n: file: mainpage.ui:65
+#. i18n: ectx: property (text), widget (QLabel, tooltipDelayLabel)
+#: rc.cpp:23
+msgid "Show Informational Tips:"
+msgstr "Prikaži informativne savjete:"
+
+#: workspaceoptions.cpp:49
+msgid "Global options for the Plasma Workspace"
+msgstr "Globalne opcije za Plasmin radni prostor"
+
+#: workspaceoptions.cpp:51
+msgid "(c) 2009 Marco Martin"
+msgstr "© 2009 Marco Martin"
+
+#: workspaceoptions.cpp:53
+msgid "Marco Martin"
+msgstr "Marco Martin"
+
+#: workspaceoptions.cpp:53
+msgid "Maintainer"
+msgstr "Održavatelj"
+
+#: workspaceoptions.cpp:306
+msgid ""
+"Turning off the show independent widget set feature will result in all "
+"widgets that were on the dashboard to be removed. Are you sure you wish to "
+"make this change?"
+msgstr ""
+"Isključivanjem prikaza neovisnog skupa widgeta uklonit ćete sve widgete koji "
+"su bili na ploči s widgetima. Jeste li sigurni da želite napraviti tu "
+"promjenu?"
+
+#: workspaceoptions.cpp:310
+msgid "Turn off independent widgets?"
+msgstr "Isključiti neovisne widgete?"
+
+#: workspaceoptions.cpp:311
+msgid "Turn off independent widgets"
+msgstr "Isključi neovisne widgete"
+
+#~ msgid "Do not show"
+#~ msgstr "Ne prikazuj"
+
+#~ msgid "Show after "
+#~ msgstr "Prikaži nakon "
+
+#~ msgid " seconds"
+#~ msgstr " sekundi"
+
+#~ msgid "Form factor:"
+#~ msgstr "Vrsta računala:"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/kdmconfig.po kde-l10n-hr-4.13.0/messages/kde-workspace/kdmconfig.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/kdmconfig.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/kdmconfig.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,1139 @@
+# Translation of kdmconfig to Croatian
+#
+# Translators: Danko Butorac ,Denis Lackovic ,Diana Ćorluka ,Drazen Djimoti <>,Mato Kutlić ,Sasa Poznanovic ,sime essert ,Slobodan Milinovic <>,Vedran Rodic ,Vlatko Kosturjak ,
+# Zarko Pintar , 2009.
+# Andrej Dundović , 2009.
+# Marko Dimjasevic , 2010, 2011.
+msgid ""
+msgstr ""
+"Project-Id-Version: kdmconfig 0\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-02 05:37+0200\n"
+"PO-Revision-Date: 2011-03-04 19:15+0100\n"
+"Last-Translator: Marko Dimjasevic \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 1.2\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: background.cpp:39
+msgid "E&nable background"
+msgstr "Omogućava&nje pozadine"
+
+#: background.cpp:41
+msgid ""
+"If this is checked, KDM will use the settings below for the background. If "
+"it is disabled, you have to look after the background yourself. This is done "
+"by running some program (possibly xsetroot) in the script specified in the "
+"Setup= option in kdmrc (usually Xsetup)."
+msgstr ""
+"Ako je ovo uključeno, KDM će koristiti doljnje postavke za pozadinu. Ako je "
+"isključeno, moraćete se pobrinuti za pozadinu sami. To se postiže "
+"pokretanjem nekog programa ( npr. xsetroot ) u skripti navedenoj u Setup= "
+"opciji u kdmrc ( najčešće Xsetup ). "
+
+#: kdm-conv.cpp:49
+msgid "Attention Read help "
+msgstr "Pažnja Pročitajte pomoć "
+
+#: kdm-conv.cpp:59
+msgid "Enable Au&to-Login"
+msgstr "Omogući au&tomatsku prijavu"
+
+#: kdm-conv.cpp:65
+msgid ""
+"Turn on the auto-login feature. This applies only to KDM's graphical login. "
+"Think twice before enabling this!"
+msgstr ""
+"Uključuje auto-prijavljivanje. To vrijedi samo za KDM grafički login. Dobro "
+"promislite prije nego što ovo omogućite!"
+
+#: kdm-conv.cpp:72
+msgid "Use&r:"
+msgstr "&Korisnik:"
+
+#: kdm-conv.cpp:81
+msgid "Select the user to be logged in automatically."
+msgstr "Odaberite korisnika s popisa koji će automatski biti prijavljen."
+
+#: kdm-conv.cpp:84
+msgid "Loc&k session"
+msgstr "Za&ključaj sesiju"
+
+#: kdm-conv.cpp:88
+msgid ""
+"The automatically started session will be locked immediately (provided it is "
+"a KDE session). This can be used to obtain a super-fast login restricted to "
+"one user."
+msgstr ""
+"Automatski pokrenuta sesija biti će odmah zaključana (pod uvjetom da je KDE "
+"sesija). Ovvo se može koristiti za dobivanje super-brze prijave ograničene "
+"na jednog korisnika."
+
+#: kdm-conv.cpp:92
+msgctxt "@title:group"
+msgid "Preselect User"
+msgstr "Pred-odabir korisnika"
+
+#: kdm-conv.cpp:96
+msgctxt "@option:radio preselected user"
+msgid "&None"
+msgstr "&Ništa"
+
+#: kdm-conv.cpp:97
+msgctxt "@option:radio preselected user"
+msgid "Prev&ious"
+msgstr "Prethodn&i"
+
+#: kdm-conv.cpp:99
+msgid ""
+"Preselect the user that logged in previously. Use this if this computer is "
+"usually used several consecutive times by one user."
+msgstr ""
+"Unaprijed odaberi korisnika koji se prijavio zadnji put. Koristite ovu "
+"opciju ako jedan korisnik više puta uzastopno koristi računalo. "
+
+#: kdm-conv.cpp:101
+msgctxt "@option:radio preselected user"
+msgid "Specifi&ed:"
+msgstr "Nave&deno:"
+
+#: kdm-conv.cpp:103
+msgid ""
+"Preselect the user specified in the combo box to the right. Use this if this "
+"computer is predominantly used by a certain user."
+msgstr ""
+"Unaprijed odaberi korisnika određenog u padajućem izborniku desno. Koristite "
+"ovu opciju ako računalo uglavnom koristi određeni korisnik. "
+
+#: kdm-conv.cpp:120
+msgid ""
+"Select the user to be preselected for login. This box is editable, so you "
+"can specify an arbitrary non-existent user to mislead possible attackers."
+msgstr ""
+"Izaberite korisnika koji će biti unaprijed odabran za prijavu. Ovo polje "
+"možete mijenjati, pa možete navesti nepostojećeg korisnika zbog zavaravanja "
+"mogućih napadača. "
+
+#: kdm-conv.cpp:135
+msgctxt "@option:check action"
+msgid "Focus pass&word"
+msgstr "Fokus na za&porku"
+
+#: kdm-conv.cpp:138
+msgid ""
+"When this option is on, KDM will place the cursor in the password field "
+"instead of the user field after preselecting a user. Use this to save one "
+"key press per login, if the preselection usually does not need to be changed."
+msgstr ""
+"Kada je ta mogućnost uključena, KDM će postaviri kursor na polje za šifru "
+"umjesto na polje za naziv korisnika, nakon odabira korisnika. Koristite ovo "
+"da bi sačuvali unešene tipke, ako ne morate često mjenjati naziv korisnika."
+
+#: kdm-conv.cpp:144
+msgid "Enable Password-&Less Logins"
+msgstr "Omogući prijavu &bez zaporke"
+
+#: kdm-conv.cpp:151
+msgid ""
+"When this option is checked, the checked users from the list below will be "
+"allowed to log in without entering their password. This applies only to "
+"KDM's graphical login. Think twice before enabling this!"
+msgstr ""
+"Kada je ovdje omogućeno, korisnici na popisu ispod moći će početi rad bez "
+"unošenja zaporke. To se naravno odnosi samo na KDM grafički dijalog za "
+"početak rada, no dobro razmislite prije nego što se odlučite za ovu mogućost!"
+
+#: kdm-conv.cpp:158
+msgid "No password re&quired for:"
+msgstr "Zaporka nij&e potrebna za:"
+
+#: kdm-conv.cpp:164
+msgid ""
+"Check all users you want to allow a password-less login for. Entries denoted "
+"with '@' are user groups. Checking a group is like checking all users in "
+"that group."
+msgstr ""
+"Označite sve korisnike za koje želite da se prijavljuju bez lozinke. Unosi "
+"koji počinju sa '@' označavaju korisničke grupe. Označivanjem grupe "
+"označujete sve korisnike u toj grupi."
+
+#: kdm-conv.cpp:168 kdm-shut.cpp:95
+msgctxt "@title:group"
+msgid "Miscellaneous"
+msgstr "Razno"
+
+#: kdm-conv.cpp:172
+msgid "Automatically log in again after &X server crash"
+msgstr "Automatski se prijavi nakon rušenja &X poslužitelja"
+
+#: kdm-conv.cpp:174
+msgid ""
+"When this option is on, a user will be logged in again automatically when "
+"their session is interrupted by an X server crash; note that this can open a "
+"security hole: if you use a screen locker than KDE's integrated one, this "
+"will make circumventing a password-secured screen lock possible."
+msgstr ""
+"Kada je ovo uključeno, korisnik će biti automatski ponovno prijavljen nakon "
+"što je njegova seansa prekinuta padom X poslužitelja. Pazite, ovdje postoji "
+"mogućnost siguronosne rupe: ako koristite neki drugi progam za zaključavanje "
+"zaslona, koji nije dio KDE-a, tada postoji mogućnost zaobilaženja zaporkom "
+"zaključanog zaslona."
+
+#: kdm-dlg.cpp:64
+msgid "&Greeting:"
+msgstr "Po&zdrav:"
+
+#: kdm-dlg.cpp:71
+msgid ""
+"This is the \"headline\" for KDM's login window. You may want to put some "
+"nice greeting or information about the operating system here.
KDM will "
+"substitute the following character pairs with the respective contents:"
+"p>
%d -> current display %h -> host name, possibly with "
+"domain name %n -> node name, most probably the host name without "
+"domain name %s -> the operating system %r -> the operating "
+"system's version %m -> the machine (hardware) type %% -> a "
+"single % "
+msgstr ""
+"Ovo je \"zaglavlje\" KDM-ovog prijavnog prozora. Možda želite ovdje "
+"postaviti neku lijepu pozdravnu poruku ili informaciju o operacijskom "
+"sustavu.
KDM će zamjeniti slijedeće parove znakaovaa sa odgovrajućim "
+"sadržajem:
%d → trenutni ekran %h → naziv računala, po "
+"mogućnosti sa nazivom domene %n ->naziv čvora, najvjerojatnije sa "
+"nazivom računala bez naziva domene %s → operacijski sustav %"
+"r → verzija operacijskog sustava %m → tip računala (hardvera)"
+"li> %% → jedan znak % "
+
+#: kdm-dlg.cpp:92
+msgid "Logo area:"
+msgstr "Područje za logo:"
+
+#: kdm-dlg.cpp:97
+msgctxt "logo area"
+msgid "&None"
+msgstr "&Ništa"
+
+#: kdm-dlg.cpp:98
+msgid "Show cloc&k"
+msgstr "Pri&kaži sat"
+
+#: kdm-dlg.cpp:99
+msgid "Sho&w logo"
+msgstr "Prikaž&i logo:"
+
+#: kdm-dlg.cpp:110
+msgid ""
+"You can choose to display a custom logo (see below), a clock or no logo at "
+"all."
+msgstr ""
+"Vi možete izabrati koji logo (pogedajte dolje) ili sat ili pak nijedno od "
+"toga želite koristiti"
+
+#: kdm-dlg.cpp:116
+msgid "&Logo:"
+msgstr "&Logo:"
+
+#: kdm-dlg.cpp:127
+msgid ""
+"Click here to choose an image that KDM will display. You can also drag and "
+"drop an image onto this button (e.g. from Konqueror)."
+msgstr ""
+"Klikinite ovdje za izbor slike koju će KDM prikazivati. Također možete vući "
+"i ispustiti sliku na ovaj gumb (npr. iz Konquerora)."
+
+#: kdm-dlg.cpp:138
+msgid "Dialog &position:"
+msgstr "&Položaj dijaloga:"
+
+#: kdm-dlg.cpp:221
+#, kde-format
+msgid ""
+"There was an error loading the image:\n"
+"%1\n"
+"It will not be saved."
+msgstr ""
+"Javila se greška prilikom pospremanja slike:\n"
+"%1\n"
+"Stoga ona neće biti spremljena."
+
+#: kdm-dlg.cpp:257 kdm-dlg.cpp:285
+#, c-format
+msgid "Welcome to %s at %n"
+msgstr "Dobrodošli na %s u %n"
+
+#: kdm-dlg.cpp:295
+msgid ""
+"KDM - Dialog Here you can configure the basic appearance of the KDM "
+"login manager in dialog mode, i.e. a greeting string, an icon etc."
+msgstr ""
+"KDM – Dijalog Ovdje možete podesiti osnovni izgled KDM upravitelja "
+"prijavom u dijaloškom modu, npr. pozdravnu poruku, ikonu itd."
+
+#: kdm-gen.cpp:47
+msgctxt "@title:group 'man locale' ..."
+msgid "Locale"
+msgstr "Lokalno"
+
+#: kdm-gen.cpp:56
+msgid "&Language:"
+msgstr "&Jezik:"
+
+#: kdm-gen.cpp:58
+msgid ""
+"Here you can choose the language used by KDM. This setting does not affect a "
+"user's personal settings; that will take effect after login."
+msgstr ""
+"Ovdje možete izabrati jezik koji će KDM upotrebljavati. Postavka jezika "
+"ovdje se neće odraziti na korisnikove osobne postavke nakon prijave."
+
+#: kdm-gen.cpp:65
+msgctxt "@title:group"
+msgid "Appearance"
+msgstr "&Izgled"
+
+#: kdm-gen.cpp:70
+msgid ""
+"&Use themed greeter\n"
+"(Warning: poor accessibility)"
+msgstr ""
+
+#: kdm-gen.cpp:73
+msgid ""
+"Enable this if you would like to use a themed Login Manager. Note that "
+"the themed greeter is challenged accessibility-wise (keyboard usage), and "
+"themes may lack support for features like a user list or alternative "
+"authentication methods."
+msgstr ""
+
+#: kdm-gen.cpp:80 kdm-gen.cpp:91 kdm-users.cpp:114
+msgid "default "
+msgstr "zadano "
+
+#: kdm-gen.cpp:85
+msgid "GUI s&tyle:"
+msgstr "&Stil GUIa:"
+
+#: kdm-gen.cpp:87
+msgid "You can choose a basic GUI style here that will be used by KDM only."
+msgstr "Možete odabrati osnovni GUI koji će kroistiti samo KDM."
+
+#: kdm-gen.cpp:95
+msgid "Color sche&me:"
+msgstr "Shema &boja:"
+
+#: kdm-gen.cpp:97
+msgid "You can choose a basic Color Scheme here that will be used by KDM only."
+msgstr "Možete odabrati osnovni skup boja koji će koristiti samo KDM."
+
+#: kdm-gen.cpp:100
+msgctxt "@title:group"
+msgid "Fonts"
+msgstr "&Pismo"
+
+#: kdm-gen.cpp:107
+msgid ""
+"This changes the font which is used for all the text in the login manager "
+"except for the greeting and failure messages."
+msgstr ""
+"Ovo mijenja pismo koji će biti korišten za sav tekst u uraditelju za "
+"prijavljivanje osim za poruke pozdrava i poruke o greškama."
+
+#: kdm-gen.cpp:110
+msgctxt "... font"
+msgid "&General:"
+msgstr "&Općenito:"
+
+#: kdm-gen.cpp:114
+msgid ""
+"This changes the font which is used for failure messages in the login "
+"manager."
+msgstr ""
+"Ovo mijenja pismo koji se koristi za poruke o greškama u upravitelju za "
+"prijavljivanje."
+
+#: kdm-gen.cpp:116
+msgctxt "font for ..."
+msgid "&Failure:"
+msgstr "&Kvar:"
+
+#: kdm-gen.cpp:120
+msgid "This changes the font which is used for the login manager's greeting."
+msgstr ""
+"Ovo mijenja pismo koji se koristi za pozdrave u upravitelju za "
+"prijavljivanje."
+
+#: kdm-gen.cpp:122
+msgctxt "font for ..."
+msgid "Gree&ting:"
+msgstr "&Pozdrav:"
+
+#: kdm-gen.cpp:124
+msgid "Use anti-aliasing for fonts"
+msgstr "Koristi anti-aliasing za pisma"
+
+#: kdm-gen.cpp:126
+msgid ""
+"If you check this box and your X-Server has the Xft extension, fonts will be "
+"antialiased (smoothed) in the login dialog."
+msgstr ""
+"Ako odaberete ovdje i vaš X poslužitelj ima Xft dodatak, pisma će biti "
+"zaglađena (antialiasing) u prijavnom dijalogu."
+
+#: kdm-shut.cpp:45
+msgid "Allow Shutdown"
+msgstr "Dozvoli gašenje"
+
+#: kdm-shut.cpp:49
+msgctxt "shutdown request origin"
+msgid "&Local:"
+msgstr "&Lokalno:"
+
+#: kdm-shut.cpp:51 kdm-shut.cpp:59
+msgctxt "@item:inlistbox allow shutdown"
+msgid "Everybody"
+msgstr "Svi korisnici"
+
+#: kdm-shut.cpp:52 kdm-shut.cpp:60
+msgctxt "@item:inlistbox allow shutdown"
+msgid "Only Root"
+msgstr "Samo root korisnik"
+
+#: kdm-shut.cpp:53 kdm-shut.cpp:61
+msgctxt "@item:inlistbox allow shutdown"
+msgid "Nobody"
+msgstr "Nitko"
+
+#: kdm-shut.cpp:57
+msgctxt "shutdown request origin"
+msgid "&Remote:"
+msgstr "&Udaljeno:"
+
+#: kdm-shut.cpp:64
+msgid ""
+"Here you can select who is allowed to shutdown the computer using KDM. You "
+"can specify different values for local (console) and remote displays. "
+"Possible values are: Everybody: everybody can shutdown the "
+"computer using KDM Only root: KDM will only allow shutdown "
+"after the user has entered the root password Nobody: "
+"nobody can shutdown the computer using KDM "
+msgstr ""
+"Ovdje možete odabrati tko ima dopuštenje isključiti računalo koristeći KDM. "
+"MOžete odrediti razne vrijednosti za lokalne (konzolne) i udaljene ekrane. "
+"Moguće vrijednosti su: Svatko: Svatko može isključiti "
+"računalo koristeći KDM Samo root: KDM će dozvoliti "
+"isključivanje samo nakon što korisnik unese root zaporku Nitko:"
+" Nitko ne može isključiti računalo koristeći KDM "
+
+#: kdm-shut.cpp:74
+msgctxt "@title:group shell commands for shutdown"
+msgid "Commands"
+msgstr "Naredbe"
+
+#: kdm-shut.cpp:77
+msgctxt "command for ..."
+msgid "H&alt:"
+msgstr "Z&austavi:"
+
+#: kdm-shut.cpp:81
+msgid "Command to initiate the system halt. Typical value: /sbin/halt"
+msgstr ""
+"Naredba koja inicira gašenje sustava. Uobičajena vrijednost: /sbin/halt"
+
+#: kdm-shut.cpp:86
+msgctxt "command for ..."
+msgid "Reb&oot:"
+msgstr "Ponovo p&okreni:"
+
+#: kdm-shut.cpp:90
+msgid "Command to initiate the system reboot. Typical value: /sbin/reboot"
+msgstr ""
+"Naredba koja započinje ponovno pokretanje sustava. Uobičajena vrijednost: /"
+"sbin/reboot"
+
+#: kdm-shut.cpp:98
+msgctxt "boot manager"
+msgid "None"
+msgstr "Ništa"
+
+#: kdm-shut.cpp:99
+msgid "Grub"
+msgstr "Grub"
+
+#: kdm-shut.cpp:100
+#, fuzzy
+#| msgid "Grub"
+msgid "Grub2"
+msgstr "Grub"
+
+#: kdm-shut.cpp:102
+msgid "Lilo"
+msgstr "Lilo"
+
+#: kdm-shut.cpp:104
+msgid "Boot manager:"
+msgstr "Upravitelj podizanja:"
+
+#: kdm-shut.cpp:107
+msgid "Enable boot options in the \"Shutdown...\" dialog."
+msgstr "Omogući postavke podizanja u \"Isključi...\" dijalogu."
+
+#: kdm-theme.cpp:98
+msgctxt "@title:column"
+msgid "Theme"
+msgstr "Tema"
+
+#: kdm-theme.cpp:99
+msgctxt "@title:column"
+msgid "Author"
+msgstr "Autor"
+
+#: kdm-theme.cpp:103
+msgid ""
+"This is a list of installed themes.\n"
+"Click the one to be used."
+msgstr ""
+"Ovo je lista instaliranih tema.\n"
+"Kliknite na onu koju želite koristiti."
+
+#: kdm-theme.cpp:111
+msgid "This is a screen shot of what KDM will look like."
+msgstr "Ovo je prikaz zaslona kako će KDM izgledati."
+
+#: kdm-theme.cpp:119
+msgid "This contains information about the selected theme."
+msgstr "Ovo sadrži informacije o odabranoj temi."
+
+#: kdm-theme.cpp:123
+msgctxt "@action:button"
+msgid "Install &new theme"
+msgstr "Instaliraj &novu temu"
+
+#: kdm-theme.cpp:124
+msgid "This will install a theme into the theme directory."
+msgstr "Ovo će instalirati temu u direktorij tema."
+
+#: kdm-theme.cpp:128
+msgctxt "@action:button"
+msgid "&Remove theme"
+msgstr "&Ukloni temu"
+
+#: kdm-theme.cpp:129
+msgid "This will remove the selected theme."
+msgstr "Ovo će ukloniti odabranu temu."
+
+#: kdm-theme.cpp:133
+msgctxt "@action:button"
+msgid "&Get New Themes"
+msgstr "&Preuzmi nove teme"
+
+#: kdm-theme.cpp:216
+#, kde-format
+msgid "Copyright: %1 "
+msgstr "Copyright: %1 "
+
+#: kdm-theme.cpp:219
+#, kde-format
+msgid "Description: %1 "
+msgstr "Opis: %1 "
+
+#: kdm-theme.cpp:236 kdm-users.cpp:339
+#, kde-format
+msgid "Unable to create folder %1"
+msgstr "Ne mogu napraviti mapu %1"
+
+#: kdm-theme.cpp:244
+msgid "Drag or Type Theme URL"
+msgstr "Povucite ili upišite URL adresu teme"
+
+#: kdm-theme.cpp:263
+#, kde-format
+msgid "Unable to find the KDM theme archive %1."
+msgstr "Ne mogu pronaći arhivu KDM teme %1"
+
+#: kdm-theme.cpp:265
+#, kde-format
+msgid ""
+"Unable to download the KDM theme archive;\n"
+"please check that address %1 is correct."
+msgstr ""
+"Ne mogu preuzeti arhivu KDE teme;\n"
+"molim vas provjerite da li je adresa %1 u redu."
+
+#: kdm-theme.cpp:288
+msgid "The file is not a valid KDM theme archive."
+msgstr "Datoteka nije valjana arhiva KDE teme."
+
+#: kdm-theme.cpp:291
+msgctxt "@title:window"
+msgid "Installing KDM themes"
+msgstr "Instaliranje KDE tema"
+
+#: kdm-theme.cpp:303
+#, fuzzy, kde-format
+#| msgctxt "@info:progress"
+#| msgid "Installing %1 theme "
+msgctxt "@info:progress"
+msgid "Unpacking %1 theme "
+msgstr "Instaliranje %1 teme "
+
+#: kdm-theme.cpp:315
+#, fuzzy
+#| msgctxt "@info:progress"
+#| msgid "Installing %1 theme "
+msgctxt "@info:progress"
+msgid "Installing the themes "
+msgstr "Instaliranje %1 teme "
+
+#: kdm-theme.cpp:324
+#, fuzzy
+#| msgid ""
+#| "There was an error saving the image:\n"
+#| "%1"
+msgid "There were errors while installing the following themes:\n"
+msgstr ""
+"Javila se greška prilikom pospremanja slike:\n"
+"%1"
+
+#: kdm-theme.cpp:363
+msgid "Are you sure you want to remove the following themes?"
+msgstr "Da li ste sigurni da želite ukloniti slijedeće teme?"
+
+#: kdm-theme.cpp:364
+msgctxt "@title:window"
+msgid "Remove themes?"
+msgstr "Ukloniti teme?"
+
+#: kdm-theme.cpp:377
+#, fuzzy
+#| msgid "Are you sure you want to remove the following themes?"
+msgid "There were errors while deleting the following themes:\n"
+msgstr "Da li ste sigurni da želite ukloniti slijedeće teme?"
+
+#: kdm-users.cpp:111
+msgid ""
+"User 'nobody' does not exist. Displaying user images will not work in KDM."
+msgstr ""
+"Korisnik 'nitko' ne postoji. Prikazivanje korisničkih slika neće raditi u "
+"KDM-u."
+
+#: kdm-users.cpp:117
+msgctxt "@title:group UIDs belonging to system users like 'cron'"
+msgid "System U&IDs"
+msgstr "Sustavski &UID-ovi"
+
+#: kdm-users.cpp:119
+msgid ""
+"Users with a UID (numerical user identification) outside this range will not "
+"be listed by KDM and this setup dialog. Note that users with the UID 0 "
+"(typically root) are not affected by this and must be explicitly excluded in "
+"\"Inverse selection\" mode."
+msgstr ""
+"Korisnici sa UID-om (brojčanom oznakom korisnika) izvan ovog raspona neće "
+"biti prikazani u KDM-u i ovom prozoru za podešavanje. Primjetite da se to ne "
+"odnosi na korisnike sa UID-om 0 (najčešće root) koji moraju biti izričito "
+"skriveni u \"Obrnuti odabir\" modu."
+
+#: kdm-users.cpp:125
+msgctxt "UIDs"
+msgid "Below:"
+msgstr "Ispod:"
+
+#: kdm-users.cpp:132
+msgctxt "UIDs"
+msgid "Above:"
+msgstr "Iznad:"
+
+#: kdm-users.cpp:145
+msgctxt "@title:group"
+msgid "Users"
+msgstr "Korisnici"
+
+#: kdm-users.cpp:146
+msgctxt "... of users"
+msgid "Show list"
+msgstr "Prikaži popis"
+
+#: kdm-users.cpp:148
+msgid ""
+"If this option is checked, KDM will show a list of users, so users can click "
+"on their name or image rather than typing in their login."
+msgstr ""
+"Ako je ovdje odabrano, KDM će pokazati popis korisnika, tako da korisnici "
+"mogu kliknuti na svoje ime ili sliku umjesto utipkavanja svojeg korisničkog "
+"imena."
+
+#: kdm-users.cpp:150
+msgctxt "user ..."
+msgid "Autocompletion"
+msgstr "Automatsko dovršavanje"
+
+#: kdm-users.cpp:152
+msgid ""
+"If this option is checked, KDM will automatically complete user names while "
+"they are typed in the line edit."
+msgstr ""
+"Ako ovdje označite, KDM će automatski dopunjavati imena korisnika "
+"prilikomutipkavanja."
+
+#: kdm-users.cpp:155
+msgctxt "@option:check mode of the user selection"
+msgid "Inverse selection"
+msgstr "Obrnuti odabir"
+
+#: kdm-users.cpp:157
+msgid ""
+"This option specifies how the users for \"Show list\" and \"Autocompletion\" "
+"are selected in the \"Select users and groups\" list: If not checked, select "
+"only the checked users. If checked, select all non-system users, except the "
+"checked ones."
+msgstr ""
+"Ova opcija određuje kako će se korisnici za \"Prikaži popis\" i \"Automatsko "
+"nastavljanje\" odabrati u popisu \"Odaberi korisnike i grupe\". Ukoliko "
+"nije označena, odaberite samo označene korisnike. Ukoliko je označeno, "
+"odabrani su svi nesustavski korisnici osim označenih."
+
+#: kdm-users.cpp:161
+msgid "Sor&t users"
+msgstr "S&ortiraj korisnike "
+
+#: kdm-users.cpp:163
+msgid ""
+"If this is checked, KDM will alphabetically sort the user list. Otherwise "
+"users are listed in the order they appear in the password file."
+msgstr ""
+"Ako ovdje označite, KDM će sortirati listu korisnika. Inače, korisnici će "
+"biti izlistani redosljedom koji se pojavljuju u datoteci sa lozinkama."
+
+#: kdm-users.cpp:180
+msgid "S&elect users and groups:"
+msgstr "Odab&eri korisnike i grupe:"
+
+#: kdm-users.cpp:184
+msgid "Selected Users"
+msgstr "&Izabrani korisnici"
+
+#: kdm-users.cpp:186
+msgid ""
+"KDM will show all checked users. Entries denoted with '@' are user groups. "
+"Checking a group is like checking all users in that group."
+msgstr ""
+"KDM će prikazati sve označene korisnike. Unosi označeni sa '@' su korisničke "
+"grupe.Označavanje grupe je kao označavanje svih korisnika u navedenoj grupi."
+
+#: kdm-users.cpp:195
+msgid "Excluded Users"
+msgstr "&Isključeni korisnici"
+
+#: kdm-users.cpp:197
+msgid ""
+"KDM will show all non-checked non-system users. Entries denoted with '@' are "
+"user groups. Checking a group is like checking all users in that group."
+msgstr ""
+"KDM će pokazati sve neprovjerene nesistemske korisnike. Ulazi označeni sa "
+"'@' su grupe korisnika. Provjera grupa je kao promjena svih korisnika unutar "
+"te grupe."
+
+#: kdm-users.cpp:206
+msgctxt "@title:group source for user faces"
+msgid "User Image Source"
+msgstr "Izvor korisničke slike"
+
+#: kdm-users.cpp:208
+msgid ""
+"Here you can specify where KDM will obtain the images that represent users. "
+"\"System\" represents the global folder; these are the pictures you can set "
+"below. \"User\" means that KDM should read the user's $HOME/.face.icon file. "
+"The two selections in the middle define the order of preference if both "
+"sources are available."
+msgstr ""
+"Ovdje možete odrediti gdje će KDM pronaći slike koje predstavljaju korisnike."
+"\"Sustav\" predstavlja globalnu mapu; ovo su slike koje možete postaviti "
+"ispod. \"Korisnik\" znači da KDM treba čitati korisnikovu $HOME/.face.icon "
+"datoteku. Dva odabira u sredini definiraju red podešenja ako su oba izvora "
+"dostupna."
+
+#: kdm-users.cpp:212
+msgctxt "@option:radio image source"
+msgid "System"
+msgstr "Sustav"
+
+#: kdm-users.cpp:213
+msgctxt "@option:radio image source"
+msgid "System, user"
+msgstr "Sustav, korisnik"
+
+#: kdm-users.cpp:214
+msgctxt "@option:radio image source"
+msgid "User, system"
+msgstr "Korisnik, sustav"
+
+#: kdm-users.cpp:215
+msgctxt "@option:radio image source"
+msgid "User"
+msgstr "Korisnik"
+
+#: kdm-users.cpp:230
+msgctxt "@title:group user face assignments"
+msgid "User Images"
+msgstr "Korisničke slike"
+
+#: kdm-users.cpp:232
+msgid "The user the image below belongs to."
+msgstr "Korisnik kojem pripada slika ispod."
+
+#: kdm-users.cpp:235
+msgid "User:"
+msgstr "Korisnik:"
+
+#: kdm-users.cpp:244
+msgid "Click or drop an image here"
+msgstr "Klikni ili ispusti sliku ovdje"
+
+#: kdm-users.cpp:246
+msgid ""
+"Here you can see the image assigned to the user selected in the combo box "
+"above. Click on the image button to select from a list of images or drag and "
+"drop your own image on to the button (e.g. from Konqueror)."
+msgstr ""
+"Ovdje možete vidjeti ime trenutno odabranog korisnika i sliku koja mu je "
+"dodjeljena. Kliknite na gumb slike ako želite odabrati drugu ili je "
+"jednostavno povucite iz drugog programa (npr Konqueror-a)."
+
+#: kdm-users.cpp:250
+msgctxt "@action:button assign default user face"
+msgid "R&eset"
+msgstr "R&eset"
+
+#: kdm-users.cpp:252
+msgid ""
+"Click this button to make KDM use the default image for the selected user."
+msgstr ""
+"Pritisnite ovaj gumb kako bi KDM koristio uobičajenu sliku za odabranog "
+"korisnika."
+
+#: kdm-users.cpp:351
+msgid "Save image as default?"
+msgstr "Pospremi kao zadanu sliku?"
+
+#: kdm-users.cpp:360
+#, fuzzy, kde-format
+#| msgid ""
+#| "There was an error loading the image\n"
+#| "%1"
+msgid ""
+"There was an error while loading the image\n"
+"%1"
+msgstr ""
+"Javila se greška prilikom učitavanja slike:\n"
+"%1"
+
+#: kdm-users.cpp:379
+#, fuzzy, kde-format
+#| msgid ""
+#| "There was an error saving the image:\n"
+#| "%1"
+msgid ""
+"There was an error while saving the image:\n"
+"%1"
+msgstr ""
+"Javila se greška prilikom pospremanja slike:\n"
+"%1"
+
+#: kdm-users.cpp:408
+#, fuzzy, kde-format
+#| msgid ""
+#| "There was an error loading the image\n"
+#| "%1"
+msgid ""
+"There was an error while removing the image:\n"
+"%1"
+msgstr ""
+"Javila se greška prilikom učitavanja slike:\n"
+"%1"
+
+#: main.cpp:73
+#, kde-format
+msgid "Unable to authenticate/execute the action: %1 (code %2)"
+msgstr ""
+
+#: main.cpp:96
+#, kde-format
+msgid ""
+"%1 does not appear to be an image file.\n"
+"Please use files with these extensions:\n"
+"%2"
+msgstr ""
+"Žalim, međutim %1 ne izgleda kao datoteka sa slikom.\n"
+"Molim upotrijebiti datoteke sa slijedećim nastavcima:\n"
+"%2"
+
+#: main.cpp:115
+msgid "KDE Login Manager Config Module"
+msgstr "KDE modul za podešavanje voditelja prijavljivanja"
+
+#: main.cpp:117
+msgid "(c) 1996-2010 The KDM Authors"
+msgstr "© 1996. – 20180. Autori KDM-a"
+
+#: main.cpp:120
+msgid "Thomas Tanghus"
+msgstr "Thomas Tanghus"
+
+#: main.cpp:120
+msgid "Original author"
+msgstr "Izvorni autor"
+
+#: main.cpp:121
+msgid "Steffen Hansen"
+msgstr "Steffen Hansen"
+
+#: main.cpp:122
+msgid "Oswald Buddenhagen"
+msgstr "Oswald Buddenhagen"
+
+#: main.cpp:122
+msgid "Current maintainer"
+msgstr "Sada održava"
+
+#: main.cpp:123
+msgid "Stephen Leaf"
+msgstr "Stephen Leaf"
+
+#: main.cpp:124
+msgid "Igor Krivenko"
+msgstr ""
+
+#: main.cpp:127
+#, fuzzy
+#| msgid ""
+#| "Login Manager In this module you can configure the various "
+#| "aspects of the KDE Login Manager. This includes the look and feel as well "
+#| "as the users that can be selected for login. Note that you can only make "
+#| "changes if you run the module with superuser rights. If you have not "
+#| "started the KDE System Settings with superuser rights (which is "
+#| "absolutely the right thing to do, by the way), click on the Modify"
+#| "em> button to acquire superuser rights. You will be asked for the "
+#| "superuser password.General On this tab page, you can configure "
+#| "parts of the Login Manager's look, and which language it should use. The "
+#| "language settings made here have no influence on the user's language "
+#| "settings.Dialog Here you can configure the look of the \"classical"
+#| "\" dialog based mode if you have chosen to use it. Background If "
+#| "you want to set a special background for the dialog based login screen, "
+#| "this is where to do it.Themes Here you can specify a theme to be "
+#| "used by the Login Manager.Shutdown Here you can specify who is "
+#| "allowed to shutdown/reboot the machine and whether a boot manager should "
+#| "be used.Users On this tab page, you can select which users the "
+#| "Login Manager will offer you for logging in.Convenience Here you "
+#| "can specify a user to be logged in automatically, users not needing to "
+#| "provide a password to log in, and other convenience features. Note, "
+#| "that these settings are security holes by their nature, so use them very "
+#| "carefully."
+msgid ""
+"Login Manager In this module you can configure the various aspects "
+"of the KDE Login Manager. This includes the look and feel as well as the "
+"users that can be selected for login. Note that you can only make changes if "
+"you run the module with superuser rights.General On this tab page, "
+"you can configure parts of the Login Manager's look, and which language it "
+"should use. The language settings made here have no influence on the user's "
+"language settings.Dialog Here you can configure the look of the "
+"\"classical\" dialog based mode if you have chosen to use it. "
+"Background If you want to set a special background for the dialog-"
+"based login screen, this is where to do it.Themes Here you can "
+"specify the theme to be used by the Login Manager.Shutdown Here you "
+"can specify who is allowed to shutdown/reboot the machine and whether a boot "
+"manager should be used.Users On this tab page, you can select which "
+"users the Login Manager will offer you for logging in.Convenience "
+"Here you can specify a user to be logged in automatically, users not needing "
+"to provide a password to log in, and other convenience features. Note "
+"that by their nature, these settings are security holes, so use them very "
+"carefully."
+msgstr ""
+"Upravitelj prijava U ovom modulu možete podesiti razne aspekte KDE "
+"Upravitelja prijava. To uključuje izgled te koje korisnike želite odabrati "
+"za prijavljivanje. Uočite da možete raditi izmjene samo ako ste pokrenuli "
+"modul s administratorskim pravima. Ako niste pokrenuli KDE Postavke sustava "
+"s administratorskim pravima (što je usput, sasvim dobra stvar za učiniti), "
+"kliknite na gumb Izmijeni za stjecanje administratorskih prava. "
+"Tražit će vas se administratorska zaporka.Opće Na ovoj kartici "
+"možete konfigurirati dijelove izgleda upravitelja prijava, te koji ćete "
+"jezik koristiti. Ove postavke jezika nemaju utjecaja na korisnikove jezične "
+"postavke.Dijalog Ovdje možete podesiti izgled \"klasično\" baziranog "
+"dijaloga, ako ste ga odabrali za korištenje. Pozadina Ako želite "
+"podesiti određenu pozadinu za dijaloški bazirani zaslon prijave, onda to "
+"činite ovdje.Teme Ovdje možete odrediti temu koju će koristiti "
+"upravitelj prijavom.Isključivanje Ovdje možete podesiti tko ima "
+"dopuštenje za isključiti/ponovo pokrenuti računalo i koji će se upravitelj "
+"podizanja koristiti.Korisnici Na ovoj kartici možete odabrati koje "
+"će korisnike će upravitelj prijavom ponuditi prilikom prijave."
+"Pogodnosti Ovdje možete odabrati korisnika koji će biti automatski "
+"prijavljen, korisnike koji ne trebaju zaporku za prijavu, te ostale "
+"pogodnosti. Uočite da su ove postavke sigurnosni propusti u svojoj "
+"prirodi, stoga ih koristite vrlo oprezno."
+
+#: main.cpp:212
+msgid "&General"
+msgstr "&Općenito"
+
+#: main.cpp:218
+msgid "&Dialog"
+msgstr "&Dijalog"
+
+#: main.cpp:223
+msgid "There is no login dialog window in themed mode."
+msgstr "Ovdje nema prijavnog dijaloga u tematskom modu."
+
+#: main.cpp:229
+msgid "&Background"
+msgstr "&Pozadina"
+
+#: main.cpp:234
+msgid "The background cannot be configured separately in themed mode."
+msgstr "Pozadina se ne može podesiti odovjeno u tematskom modu."
+
+#: main.cpp:240
+msgid "&Theme"
+msgstr "&Tema"
+
+#: main.cpp:242
+msgid "Themed mode is disabled. See \"General\" tab."
+msgstr "Tematski mod je onemogućen. Pogledajte karticu \"Općenito\"."
+
+#: main.cpp:251
+msgid "&Shutdown"
+msgstr "&Isključi"
+
+#: main.cpp:255
+msgid "&Users"
+msgstr "&Korisnici"
+
+#: main.cpp:265
+msgid "&Convenience"
+msgstr "Pogod&nosti"
+
+#: main.cpp:361
+#, kde-format
+msgid ""
+"Unable to install new kdmrc file from\n"
+"%1"
+msgstr ""
+"Nije moguće instalirati novu datoteku kdmrc iz\n"
+"%1"
+
+#: main.cpp:366
+#, kde-format
+msgid ""
+"Unable to install new backgroundrc file from\n"
+"%1"
+msgstr ""
+
+#: main.cpp:371
+#, kde-format
+msgid ""
+"Unable to install new kdmrc file from\n"
+"%1\n"
+"and new backgroundrc file from\n"
+"%2"
+msgstr ""
+
+#: positioner.cpp:98
+msgid ""
+"Drag the anchor to move the center of the dialog to the desired position. "
+"Keyboard control is possible as well: Use the arrow keys or Home to center. "
+"Note that the actual proportions of the dialog are probably different."
+msgstr ""
+"Povucite sidro za pomicanje centra dialoga na željeni položaj. Tipkovničke "
+"kontrole su također dostupne: Koristite strelice ili Home za centriranje. "
+"Uočite da su aktualne proporcije dialoga vjerojatno različite."
+
+#: rc.cpp:1
+msgctxt "NAME OF TRANSLATORS"
+msgid "Your names"
+msgstr ""
+"Danko Butorac, Denis Lackovic, Diana Ćorluka, Drazen Djimoti, Mato Kutlić, "
+"Sasa Poznanovic, sime essert, Slobodan Milinovic, Vedran Rodic, Vlatko "
+"Kosturjak, Žarko Pintar"
+
+#: rc.cpp:2
+msgctxt "EMAIL OF TRANSLATORS"
+msgid "Your emails"
+msgstr ""
+"lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, "
+"lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, "
+"lokalizacija@linux.hr, lokalizacija@linux.hr, lokalizacija@linux.hr, "
+"lokalizacija@linux.hr, zarko.pintar@gmail.com"
+
+#~ msgid "&Use themed greeter"
+#~ msgstr "&koristi tematski pozdrav"
+
+#~ msgid "Enable this if you would like to use a themed Login Manager."
+#~ msgstr "Omogućite ovo ako želite koristiti tematski upravitelj prijavama."
+
+#~ msgid "Us&er:"
+#~ msgstr "&Korisnik:"
+
+#, fuzzy
+#~ msgid "General (&1)"
+#~ msgstr "&Opće:"
+
+#, fuzzy
+#~ msgid "Users (&6)"
+#~ msgstr "Korisnici"
+
+#~ msgid "Admin"
+#~ msgstr "Admin"
+
+#~ msgid "Admin, user"
+#~ msgstr "Admin, korisnik"
+
+#~ msgid "Unset"
+#~ msgstr "Ukloni"
+
+#~ msgid "kcmkdm"
+#~ msgstr "kcmkdm"
+
+#~ msgid "Hidden Users"
+#~ msgstr "Skriveni korisnici"
+
+#~ msgid ""
+#~ msgstr ""
+
+#~ msgid "Choose Image"
+#~ msgstr "Izaberite sliku"
+
+#~ msgid "without name"
+#~ msgstr "bez imena"
+
+#~ msgid "&X:"
+#~ msgstr "&X:"
+
+#~ msgid "&Y:"
+#~ msgstr "&Y:"
+
+#, fuzzy
+#~ msgid ""
+#~ "Here you specify the relative coordinates (in percent) of the login "
+#~ "dialog's center ."
+#~ msgstr "Ovdje navodite koordinate centra dijaloga."
+
+#~ msgid "No Echo"
+#~ msgstr "Bez echoa"
+
+#~ msgid "One Star"
+#~ msgstr "Jedna zvjezidca"
+
+#~ msgid "Three Stars"
+#~ msgstr "Tri zvjezidce"
+
+#~ msgid "Echo &mode:"
+#~ msgstr "&Način reagiranja:"
+
+#~ msgid ""
+#~ "You can choose whether and how KDM shows your password when you type it."
+#~ msgstr "Možete odabrati kako i hoće li KDM ispisivati šifru koju unosite."
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/kdmgreet.po kde-l10n-hr-4.13.0/messages/kde-workspace/kdmgreet.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/kdmgreet.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/kdmgreet.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,668 @@
+# Translation of kdmgreet to Croatian
+#
+# Translators: Andrija Piličić ,Danko Butorac ,Denis Lackovic ,Goran Žugelj ,Mato Kutlić ,Robert Sedak ,sime essert ,Vedran Rodic ,Vlatko Kosturjak ,
+# Zarko Pintar , 2009.
+# Andrej Dundovic , 2010.
+msgid ""
+msgstr ""
+"Project-Id-Version: kdmgreet 0\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-09-08 04:07+0200\n"
+"PO-Revision-Date: 2010-03-19 13:30+0100\n"
+"Last-Translator: Andrej Dundovic \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 1.0\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: kchooser.cpp:59
+msgctxt "@action:inmenu"
+msgid "&Local Login"
+msgstr "&Lokalna prijava"
+
+#: kchooser.cpp:63
+msgid "XDMCP Host Menu"
+msgstr "Izbornik XDMCP računala"
+
+#: kchooser.cpp:73
+msgctxt "@title:column"
+msgid "Hostname"
+msgstr "Ime računala"
+
+#: kchooser.cpp:74
+msgctxt "@title:column ... of named host"
+msgid "Status"
+msgstr "Stanje"
+
+#: kchooser.cpp:82
+msgctxt "XDMCP server"
+msgid "Hos&t:"
+msgstr "&Ime računala:"
+
+#: kchooser.cpp:84
+msgctxt "@action:button"
+msgid "A&dd"
+msgstr "&Dodaj"
+
+#: kchooser.cpp:93
+msgctxt "@action:button"
+msgid "&Accept"
+msgstr "&Prihvati"
+
+#: kchooser.cpp:95
+msgctxt "@action:button"
+msgid "&Refresh"
+msgstr "&Osvježi"
+
+#: kchooser.cpp:105 kgreeter.cpp:802
+msgctxt "@action:button"
+msgid "&Menu"
+msgstr "&Izbornik"
+
+#: kchooser.cpp:203
+msgctxt "hostname or status"
+msgid ""
+msgstr ""
+
+#: kchooser.cpp:242
+#, kde-format
+msgid "Unknown host %1"
+msgstr "Nepoznato računalo %1"
+
+#: kconsole.cpp:70
+msgid "*** Cannot connect to console log ***"
+msgstr "*** Ne mogu se spojiti na dnevnik konzole ***"
+
+#: kconsole.cpp:154
+msgid ""
+"\n"
+"*** Lost connection with console log ***"
+msgstr ""
+"\n"
+"*** Izgubljena je veza sa dnevnikom konzole ***"
+
+#: kdmconfig.cpp:131
+msgctxt ""
+"@item:intext substitution for an undefined %X placeholder wrongly given in "
+"the config file 'kdmrc', telling the user to fix it"
+msgid "[fix kdmrc]"
+msgstr "[popravi kdmrc]"
+
+#: kdmshutdown.cpp:90
+msgid "Root authorization required."
+msgstr "Potrebna je administratorska autorizacija."
+
+#: kdmshutdown.cpp:122
+msgctxt "@action:inmenu verb"
+msgid "&Schedule..."
+msgstr "&Raspored …"
+
+#: kdmshutdown.cpp:264
+msgid "Shutdown Type"
+msgstr "Vrsta isključenja"
+
+#: kdmshutdown.cpp:268
+msgid "&Turn off computer"
+msgstr "&Isključi računalo"
+
+#: kdmshutdown.cpp:272
+msgid "&Restart computer"
+msgstr "&Ponovo pokreni računalo"
+
+#: kdmshutdown.cpp:298
+msgctxt "@title:group ... of shutdown"
+msgid "Scheduling"
+msgstr "Raspoređivanje"
+
+#: kdmshutdown.cpp:302
+msgid "&Start:"
+msgstr "&Start:"
+
+#: kdmshutdown.cpp:306
+msgid "T&imeout:"
+msgstr "Z&avršetak:"
+
+#: kdmshutdown.cpp:309
+msgid "&Force after timeout"
+msgstr "&Prisili nakon završetka"
+
+#: kdmshutdown.cpp:357
+msgid "Entered start date is invalid."
+msgstr "Unešeni datum početka je nevažeći."
+
+#: kdmshutdown.cpp:366
+msgid "Entered timeout date is invalid."
+msgstr "Uneseni datum završetka je nevažeći."
+
+#: kdmshutdown.cpp:480
+msgid "&Turn Off Computer"
+msgstr "&Isključi računalo"
+
+#: kdmshutdown.cpp:487
+msgid "&Restart Computer"
+msgstr "&Ponovo pokreni računalo"
+
+#: kdmshutdown.cpp:497
+#, kde-format
+msgctxt "current option in boot loader"
+msgid "%1 (current)"
+msgstr "%1 (trenutno)"
+
+#: kdmshutdown.cpp:508
+msgctxt "@action:button verb"
+msgid "&Schedule..."
+msgstr "&Raspored …"
+
+#: kdmshutdown.cpp:587
+msgid ""
+" Switching to console mode will terminate all local X servers and leave "
+"you with console logins only. Graphical mode is automatically resumed 10 "
+"seconds after the last console session ends or after 40 seconds if no-one "
+"logs in in the first place. "
+msgstr ""
+" Prebacivanje u konzolni način prekinut će sve lokalne X poslužitelje i "
+"ostavit će vas samo s konzolnom prijavom. Grafički će se način automatski "
+"nastaviti 10 sekundi nakon što posljednja konzolna sesija završi ili nakon "
+"40 sekundi ako se nitko nije tada ni prijavio. "
+
+#: kdmshutdown.cpp:608
+msgid "Turn Off Computer"
+msgstr "Isključi računalo"
+
+#: kdmshutdown.cpp:611
+msgid "Switch to Console"
+msgstr "Prebaci na konzolu"
+
+#: kdmshutdown.cpp:613
+msgid "Restart Computer"
+msgstr "&Ponovo pokreni računalo"
+
+#: kdmshutdown.cpp:615
+#, kde-format
+msgid " (Next boot: %1)"
+msgstr " (Slijedeće pokretanje: %1)"
+
+#: kdmshutdown.cpp:633
+msgid "Abort active sessions:"
+msgstr "Odustani od aktivnih sesija:"
+
+#: kdmshutdown.cpp:634
+msgid "No permission to abort active sessions:"
+msgstr "Nema dopuštenja za odustajanje od aktivnih sesija:"
+
+#: kdmshutdown.cpp:645
+msgctxt "@title:column"
+msgid "Session"
+msgstr "Sesija"
+
+#: kdmshutdown.cpp:646
+msgctxt "@title:column ... of session"
+msgid "Location"
+msgstr "Lokacija"
+
+#: kdmshutdown.cpp:688
+msgid "Cancel pending shutdown:"
+msgstr "Prekini čekanje isključivanja:"
+
+#: kdmshutdown.cpp:689
+msgid "No permission to cancel pending shutdown:"
+msgstr "Nema dozvole za prekidanje čekanja na isključivanje:"
+
+#: kdmshutdown.cpp:695
+msgctxt "start of shutdown:"
+msgid "now"
+msgstr "sada"
+
+#: kdmshutdown.cpp:701
+msgctxt "timeout of shutdown:"
+msgid "infinite"
+msgstr "beskonačno"
+
+#: kdmshutdown.cpp:712
+msgctxt "owner of shutdown:"
+msgid "console user"
+msgstr "korisnik konzole"
+
+#: kdmshutdown.cpp:714
+msgctxt "owner of shutdown:"
+msgid "control socket"
+msgstr "kontrolna utičnica"
+
+#: kdmshutdown.cpp:717
+msgid "turn off computer"
+msgstr "Isključi računalo"
+
+#: kdmshutdown.cpp:718
+msgid "restart computer"
+msgstr "&Ponovo pokreni računalo"
+
+#: kdmshutdown.cpp:721
+#, kde-format
+msgid ""
+"\n"
+"Next boot: %1"
+msgstr ""
+"\n"
+"Slijedeće pokretanje: %1"
+
+#: kdmshutdown.cpp:707
+#, kde-format
+msgid ""
+"Owner: %1\n"
+"Type: %2%5\n"
+"Start: %3\n"
+"Timeout: %4"
+msgstr ""
+"Vlasnik: %1\n"
+"Tip: %2%5\n"
+"Početak: %3\n"
+"Završetak: %4"
+
+#: kdmshutdown.cpp:726
+msgctxt "after timeout:"
+msgid "abort all sessions"
+msgstr "odustani od svih sesija"
+
+#: kdmshutdown.cpp:728
+msgctxt "after timeout:"
+msgid "abort own sessions"
+msgstr "odustani od vlastite sesije"
+
+#: kdmshutdown.cpp:729
+msgctxt "after timeout:"
+msgid "cancel shutdown"
+msgstr "prekini isključivanje"
+
+#: kdmshutdown.cpp:724
+#, kde-format
+msgid ""
+"\n"
+"After timeout: %1"
+msgstr ""
+"\n"
+"Nakon završetka: %1"
+
+#: kgdialog.cpp:57
+msgid "Sw&itch User"
+msgstr "Prebac&i korisnika"
+
+#: kgdialog.cpp:72
+msgid "Canc&el Session"
+msgstr "Pre&kini sesiju"
+
+#: kgdialog.cpp:73
+msgid "R&estart X Server"
+msgstr "Ponovo pokreni X-&e"
+
+#: kgdialog.cpp:74
+msgid "Clos&e Connection"
+msgstr "Zatvori ve&zu"
+
+#: kgdialog.cpp:85
+msgid "Co&nsole Login"
+msgstr "&Prijava na terminal"
+
+#: kgdialog.cpp:88
+msgid "&Shutdown..."
+msgstr "&Gašenje …"
+
+#: kgdialog.cpp:228
+#, kde-format
+msgctxt "session (location)"
+msgid "%1 (%2)"
+msgstr "%1 (%2)"
+
+#: kgreeter.cpp:482
+msgctxt "@item:inlistbox session type"
+msgid "Default"
+msgstr "Zadano"
+
+#: kgreeter.cpp:483
+msgctxt "@item:inlistbox session type"
+msgid "Custom"
+msgstr "Prilagođeno"
+
+#: kgreeter.cpp:484
+msgctxt "@item:inlistbox session type"
+msgid "Failsafe"
+msgstr "Sigurno"
+
+#: kgreeter.cpp:560
+#, kde-format
+msgctxt "@item:inmenu session type"
+msgid "%1 (previous)"
+msgstr "%1 (prethodno)"
+
+#: kgreeter.cpp:622
+#, kde-format
+msgid ""
+"Your saved session type '%1' is not valid any more.\n"
+"Please select a new one, otherwise 'default' will be used."
+msgstr ""
+"Vaša snimljena vrsta sesije „%1“ više nije valjana.\n"
+"Odaberite drugu ili će biti korištena uobičajena."
+
+#: kgreeter.cpp:745
+msgid "Warning: this is an unsecured session"
+msgstr "Upozorenje: ovo je nezaštićena sesija"
+
+#: kgreeter.cpp:747
+msgid ""
+"This display requires no X authorization.\n"
+"This means that anybody can connect to it,\n"
+"open windows on it or intercept your input."
+msgstr ""
+"Ovaj ekran ne zahtjeva X autorizaciju.\n"
+"To znači da se bilo tko može spojiti na nju,\n"
+"otvarati prozore u njoj i presresti vaš unos."
+
+#: kgreeter.cpp:799
+msgctxt "@action:button"
+msgid "L&ogin"
+msgstr "&Prijava"
+
+#: kgreeter.cpp:833 kgreeter.cpp:970
+msgctxt "@title:menu"
+msgid "Session &Type"
+msgstr "&Tip sesije"
+
+#: kgreeter.cpp:838 kgreeter.cpp:976
+msgctxt "@title:menu"
+msgid "&Authentication Method"
+msgstr "&Metoda ovjere autentičnosti"
+
+#: kgreeter.cpp:843 kgreeter.cpp:981
+msgctxt "@action:inmenu"
+msgid "&Remote Login"
+msgstr "P&rijava na udaljeno računalo"
+
+#: kgreeter.cpp:921 kgverify.cpp:1085
+msgid "Login failed"
+msgstr "Prijava nije uspjela"
+
+#: kgverify.cpp:187
+msgid "No greeter widget plugin loaded. Check the configuration."
+msgstr "Nije učitan kontrolni umetak za pozdravljanje. Provjerite podešavanja."
+
+#: kgverify.cpp:496
+#, kde-format
+msgid ""
+"Logging in %1...\n"
+"\n"
+msgstr ""
+"Prijava u %1...\n"
+"\n"
+
+#: kgverify.cpp:500
+msgid "You are required to change your password immediately (password aged)."
+msgstr "Morate odmah promijeniti lozinku (zastarjela lozinka)."
+
+#: kgverify.cpp:501
+msgid "You are required to change your password immediately (root enforced)."
+msgstr "Morate odmah promijeniti lozinku (administrator je naredio)."
+
+#: kgverify.cpp:502
+msgid "You are not allowed to login at the moment."
+msgstr "Prijavljivanje vam trenutno nije dozvoljeno."
+
+#: kgverify.cpp:503
+msgid "Home folder not available."
+msgstr "Početna mapa nije dostupna."
+
+#: kgverify.cpp:504
+msgid ""
+"Logins are not allowed at the moment.\n"
+"Try again later."
+msgstr ""
+"Prijavljivanje trenutno nije dozvoljeno.\n"
+"Milim pokušajte kasnije."
+
+#: kgverify.cpp:505
+msgid "Your login shell is not listed in /etc/shells."
+msgstr "Vaša prijavna ljuska nije navedena u /etc/shells."
+
+#: kgverify.cpp:506
+msgid "Root logins are not allowed."
+msgstr "Prijava root-a nije dozvoljena."
+
+#: kgverify.cpp:507
+msgid "Your account has expired; please contact your system administrator."
+msgstr ""
+"Vaš račun je istekao; molim vas da kontaktirate vašeg administratora sustava."
+
+#: kgverify.cpp:517
+msgid ""
+"A critical error occurred.\n"
+"Please look at KDM's logfile(s) for more information\n"
+"or contact your system administrator."
+msgstr ""
+"Dogodila se kritična greška.\n"
+"Molim pogledajte u KDM-ov dnevnik za detaljnije informacije\n"
+"ili pitajte vašeg adminsitratora sustava."
+
+#: kgverify.cpp:542
+#, kde-format
+msgid "Your account expires tomorrow."
+msgid_plural "Your account expires in %1 days."
+msgstr[0] "Vaš račun istječe za %1 dan."
+msgstr[1] "Vaš račun istječe za %1 dana."
+msgstr[2] "Vaš račun istječe za %1 dana."
+
+#: kgverify.cpp:544
+msgid "Your account expires today."
+msgstr "Vaš račun istječe danas."
+
+#: kgverify.cpp:550
+#, kde-format
+msgid "Your password expires tomorrow."
+msgid_plural "Your password expires in %1 days."
+msgstr[0] "Vaša zaporka istječe za %1 dan."
+msgstr[1] "Vaša zaporka istječe za %1 dana."
+msgstr[2] "Vaša zaporka istječe za %1 dana."
+
+#: kgverify.cpp:552
+msgid "Your password expires today."
+msgstr "Vaša šifra istječe danas."
+
+#: kgverify.cpp:626 kgverify.cpp:1086
+msgid "Authentication failed"
+msgstr "Neuspješna identifikacija"
+
+#: kgverify.cpp:776
+#, kde-format
+msgid "Authenticated user (%1) does not match requested user (%2).\n"
+msgstr "Autenticirani korisnik (%1) nije jednak traženom korisniku (%2).\n"
+
+#: kgverify.cpp:1067
+#, kde-format
+msgid "Automatic login in 1 second..."
+msgid_plural "Automatic login in %1 seconds..."
+msgstr[0] "Automatska prijava za %1 sekundu …"
+msgstr[1] "Automatska prijava za %1 sekunde …"
+msgstr[2] "Automatska prijava za %1 sekundi …"
+
+#: kgverify.cpp:1079
+msgid "Warning: Caps Lock is on"
+msgstr "Upozorenje: Uključena su velika slova"
+
+#: kgverify.cpp:1083
+msgid "Change failed"
+msgstr "Promijena nije uspjela"
+
+#: kgverify.cpp:1136
+#, kde-format
+msgid "Theme not usable with authentication method '%1'."
+msgstr "Tema nije iskoristiva sa metodom ovjere '%1'."
+
+#: kgverify.cpp:1173
+msgctxt "@title:window"
+msgid "Changing authentication token "
+msgstr "Mijenjam oznaku ovjere "
+
+#: krootimage.cpp:330
+msgid "KRootImage"
+msgstr "KRootImage"
+
+#: krootimage.cpp:331
+msgid "Fancy desktop background for kdm"
+msgstr "Zgodna pozadina radne površine za kdm"
+
+#: krootimage.cpp:334
+msgid "Name of the configuration file"
+msgstr "Naziv konfiguracijske datoteke"
+
+#: themer/kdmlabel.cpp:247
+msgctxt "@action:button"
+msgid "Lan_guage"
+msgstr "Je_zik"
+
+#: themer/kdmlabel.cpp:248
+msgctxt "@action:button"
+msgid "Session _Type"
+msgstr "Tip_sesije"
+
+#: themer/kdmlabel.cpp:249
+msgctxt "@action:button"
+msgid "_Menu"
+msgstr "_Izbornik"
+
+#. i18n("Actions");
+#: themer/kdmlabel.cpp:250
+msgctxt "@action:button ... from XDMCP server"
+msgid "Disconn_ect"
+msgstr "Pr_ekini"
+
+#: themer/kdmlabel.cpp:251
+msgctxt "@action:button"
+msgid "_Quit"
+msgstr "_Izlaz"
+
+#: themer/kdmlabel.cpp:252
+msgctxt "@action:button"
+msgid "Power o_ff"
+msgstr "Isklj_uči"
+
+#: themer/kdmlabel.cpp:254
+msgctxt "@action:button"
+msgid "Re_boot"
+msgstr "P_okreni ponovo"
+
+#: themer/kdmlabel.cpp:255
+msgctxt "@action:button"
+msgid "_Remote login"
+msgstr "_Prijava na udaljeno računalo"
+
+#: themer/kdmlabel.cpp:256
+msgid "Caps Lock is enabled"
+msgstr "Omogućena su velika slova"
+
+#: themer/kdmlabel.cpp:257
+msgid "User %u will log in in %t"
+msgstr "Korisnik %u će se prijaviti za %t"
+
+#: themer/kdmlabel.cpp:258
+msgid "Welcome to %h"
+msgstr "Dobrodošli na %h"
+
+#: themer/kdmlabel.cpp:259
+msgid "_Domain:"
+msgstr "_Domena:"
+
+#: themer/kdmlabel.cpp:260
+msgid "_Username:"
+msgstr "_Korisničko ime:"
+
+#: themer/kdmlabel.cpp:261
+msgid "_Password:"
+msgstr "_Zaporka:"
+
+#: themer/kdmlabel.cpp:262
+msgctxt "@action:button"
+msgid "_Login"
+msgstr "_Prijava"
+
+#: themer/kdmlabel.cpp:293
+#, kde-format
+msgctxt "will login in ..."
+msgid "1 second"
+msgid_plural "%1 seconds"
+msgstr[0] "%1 sekunda"
+msgstr[1] "%1 sekunde"
+msgstr[2] "%1 sekundi"
+
+#: themer/kdmlabel.cpp:301
+#, no-c-format
+msgctxt "date format"
+msgid "%a %d %B"
+msgstr "%a %d %B"
+
+#: themer/kdmthemer.cpp:67
+#, kde-format
+msgid "Cannot open theme file %1"
+msgstr "Ne mogu otvoriti datoteku teme %1"
+
+#: themer/kdmthemer.cpp:72
+#, kde-format
+msgid "Cannot parse theme file %1"
+msgstr "Ne mogu raščlaniti datoteku teme %1"
+
+#: themer/kdmthemer.cpp:79
+#, kde-format
+msgid "%1 does not seem to be a correct theme file"
+msgstr "%1 izgleda da nije ispravna datoteka teme"
+
+#: utils.cpp:87
+#, kde-format
+msgctxt "user: ..."
+msgid "%2: TTY login"
+msgid_plural "%2: %1 TTY logins"
+msgstr[0] "%2: %1 TTY prijava"
+msgstr[1] "%2: %1 TTY prijave"
+msgstr[2] "%2: %1 TTY prijava"
+
+#: utils.cpp:99
+msgctxt "... session"
+msgid "Unused"
+msgstr "Neiskorišteno"
+
+#: utils.cpp:101
+#, kde-format
+msgctxt "user: session type"
+msgid "%1: %2"
+msgstr "%1: %2"
+
+#: utils.cpp:103
+#, kde-format
+msgctxt "... host"
+msgid "X login on %1"
+msgstr "X prijava na %1"
+
+#, fuzzy
+#~ msgid "Abort S&ession"
+#~ msgstr "Vrs&ta sesije"
+
+#, fuzzy
+#~ msgid "Login Failed."
+#~ msgstr "Prijava nije uspjela"
+
+#~ msgid "Cannot open console"
+#~ msgstr "Ne mogu otvoriti konzolu"
+
+#, fuzzy
+#~ msgid "XDMCP Choose_r"
+#~ msgstr "Izbornik XDMCP računala"
+
+#, fuzzy
+#~ msgid ""
+#~ "Authenticating %1 ...\n"
+#~ "\n"
+#~ msgstr ""
+#~ "Autentikacija %1 ...\n"
+#~ "\n"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/kgreet_classic.po kde-l10n-hr-4.13.0/messages/kde-workspace/kgreet_classic.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/kgreet_classic.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/kgreet_classic.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,55 @@
+# Translation of kgreet_classic to Croatian
+#
+# Andrej Dundović , 2009.
+msgid ""
+msgstr ""
+"Project-Id-Version: kgreet_classic\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-02 05:38+0200\n"
+"PO-Revision-Date: 2009-07-01 09:01+0200\n"
+"Last-Translator: Andrej Dundović \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 0.3\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: kgreet_classic.cpp:93
+msgid "&Username:"
+msgstr "&Korisničko ime:"
+
+#: kgreet_classic.cpp:99
+msgid "Username:"
+msgstr "Korisničko ime:"
+
+#: kgreet_classic.cpp:112
+msgid "&Password:"
+msgstr "&Zaporka:"
+
+#: kgreet_classic.cpp:113
+msgid "Current &password:"
+msgstr "&Trenutna zaporka: "
+
+#: kgreet_classic.cpp:126
+msgid "&New password:"
+msgstr "&Nova zaporka: "
+
+#: kgreet_classic.cpp:129
+msgid "Con&firm password:"
+msgstr "&Potvrdite zaporku:"
+
+#: kgreet_classic.cpp:267
+#, kde-format
+msgid "Unrecognized prompt \"%1\""
+msgstr "Neprepoznati odaziv \"%1\""
+
+#: kgreet_classic.cpp:481
+msgctxt "@item:inmenu authentication method"
+msgid "Username + password (classic)"
+msgstr "Korisničko ime + zaporka (klasično)"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/kgreet_generic.po kde-l10n-hr-4.13.0/messages/kde-workspace/kgreet_generic.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/kgreet_generic.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/kgreet_generic.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,25 @@
+# Translation of kgreet_generic to Croatian
+#
+msgid ""
+msgstr ""
+"Project-Id-Version: kgreet_generic\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-02 05:38+0200\n"
+"PO-Revision-Date: 2009-08-17 13:10+0200\n"
+"Last-Translator: \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"X-Generator: Lokalize 0.3\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: kgreet_generic.cpp:350
+msgctxt "@item:inmenu authentication method"
+msgid "Generic"
+msgstr "Opći"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/kgreet_winbind.po kde-l10n-hr-4.13.0/messages/kde-workspace/kgreet_winbind.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/kgreet_winbind.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/kgreet_winbind.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,63 @@
+# Translation of kgreet_winbind to Croatian
+#
+# Andrej Dundović , 2009.
+msgid ""
+msgstr ""
+"Project-Id-Version: kgreet_winbind\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-02 05:38+0200\n"
+"PO-Revision-Date: 2009-07-01 09:12+0200\n"
+"Last-Translator: Andrej Dundović \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 0.3\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: kgreet_winbind.cpp:126
+msgid "&Domain:"
+msgstr "&Domena:"
+
+#: kgreet_winbind.cpp:128
+msgid "&Username:"
+msgstr "&Korisničko ime:"
+
+#: kgreet_winbind.cpp:142
+msgid "Domain:"
+msgstr "Domena:"
+
+#: kgreet_winbind.cpp:145
+msgid "Username:"
+msgstr "Korisničko ime:"
+
+#: kgreet_winbind.cpp:159
+msgid "&Password:"
+msgstr "&Zaporka:"
+
+#: kgreet_winbind.cpp:160
+msgid "Current &password:"
+msgstr "&Trenutna zaporka: "
+
+#: kgreet_winbind.cpp:174
+msgid "&New password:"
+msgstr "&Nova zaporka: "
+
+#: kgreet_winbind.cpp:177
+msgid "Con&firm password:"
+msgstr "&Potvrdite zaporka:"
+
+#: kgreet_winbind.cpp:348
+#, kde-format
+msgid "Unrecognized prompt \"%1\""
+msgstr "Neprepoznati odziv \"%1\""
+
+#: kgreet_winbind.cpp:631
+msgctxt "@item:inmenu authentication method"
+msgid "Winbind / Samba"
+msgstr "Winbind / Samba"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/krandr.po kde-l10n-hr-4.13.0/messages/kde-workspace/krandr.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/krandr.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/krandr.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,602 @@
+# Translation of krandr to Croatian
+#
+# DoDo , 2009.
+# Andrej Dundovic , 2009, 2010.
+# Marko Dimjasevic , 2011.
+msgid ""
+msgstr ""
+"Project-Id-Version: krandr\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-02 05:37+0200\n"
+"PO-Revision-Date: 2011-03-11 10:02+0100\n"
+"Last-Translator: Marko Dimjasevic \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 1.2\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: krandrmodule.cpp:47
+msgid ""
+"Your X server does not support resizing and rotating the display. Please "
+"update to version 4.3 or greater. You need the X Resize, Rotate, and Reflect "
+"extension (RANDR) version 1.1 or greater to use this feature."
+msgstr ""
+"Vaš poslužitelj X ne podržava promjenu veličine i zaokretanje zaslona. Molim "
+"nadogradite na verziju 4.3 ili noviju. Potrebna su vam prošitrenja X Resize, "
+"Rotate i Reflect (RANDR) verzije 1.1 ili veće kako bi ste koristli ovu "
+"mogućnost."
+
+#: krandrtray.cpp:94
+msgid "Required X Extension Not Available"
+msgstr "Potrebno proširenje X-a nije dostupno"
+
+#: krandrtray.cpp:111 legacyrandrconfig.cpp:38
+#, kde-format
+msgid "Screen %1"
+msgstr "Zaslon %1"
+
+#: krandrtray.cpp:134
+msgid "Configure Display..."
+msgstr "Podesi zaslon…"
+
+#: krandrtray.cpp:152
+msgid "Display"
+msgstr "Zaslon"
+
+#: krandrtray.cpp:153
+msgid "Resize, rotate and configure screens."
+msgstr "Promijeni veličinu, rotiraj i podesi ekrane."
+
+#: krandrtray.cpp:170
+#, kde-format
+msgid "Resolution: %1 x %2"
+msgstr "Rezolucija: %1 x %2"
+
+#: krandrtray.cpp:185
+#, kde-format
+msgid "Rotation: %1"
+msgstr "Rotacija: %1"
+
+#: krandrtray.cpp:200
+msgid "Disabled"
+msgstr "Onemogućeno"
+
+#: krandrtray.cpp:218
+#, kde-format
+msgid "Resolution: %1 x %2 "
+msgstr "Rezolucija: %1 x %2 "
+
+#: krandrtray.cpp:224
+msgid "Refresh: "
+msgstr "Osvježavanje: "
+
+#: krandrtray.cpp:225 krandrtray.cpp:512 legacyrandrconfig.cpp:274
+#: legacyrandrscreen.cpp:246 outputconfig.cpp:484
+#, kde-format
+msgid "%1 Hz"
+msgstr "%1 Hz"
+
+#: krandrtray.cpp:233
+msgid "Rotation: "
+msgstr "Rotacija: "
+
+#: krandrtray.cpp:270
+msgid "Screen configuration has changed"
+msgstr "Konfiguracija zaslona je promijenjena"
+
+#: krandrtray.cpp:305 krandrtray.cpp:430
+msgid "Screen Size"
+msgstr "Veličina zaslona"
+
+#: krandrtray.cpp:313 krandrtray.cpp:379 krandrtray.cpp:443
+msgid "Orientation"
+msgstr "Orijentacija"
+
+#: krandrtray.cpp:330
+msgid "Outputs"
+msgstr "Izlazi"
+
+#: krandrtray.cpp:346
+#, kde-format
+msgid "%1 - Screen Size"
+msgstr "%1 – Veličina zaslona"
+
+#: krandrtray.cpp:363
+msgid "Disable"
+msgstr "Onemogući"
+
+#: krandrtray.cpp:389 krandrtray.cpp:452
+msgid "Refresh Rate"
+msgstr "Učestalost osvježavanja"
+
+#: krandrtray.cpp:400
+msgctxt "(checkbox) designate this output as the primary output"
+msgid "Primary output"
+msgstr "Primarni izlaz"
+
+#: krandrtray.cpp:418
+msgid "Unify Outputs"
+msgstr "Ujedini izlaze"
+
+#: krandrtray.cpp:606
+msgid "Configure Display"
+msgstr "Konfiguriraj zaslon"
+
+#: ktimerdialog.cpp:167
+#, kde-format
+msgid "1 second remaining:"
+msgid_plural "%1 seconds remaining:"
+msgstr[0] "preostaje %1 sekunda:"
+msgstr[1] "preostaju %1 sekunde:"
+msgstr[2] "preostaje %1 sekundi:"
+
+#: legacyrandrscreen.cpp:140
+#, kde-format
+msgid ""
+"New configuration:\n"
+"Resolution: %1 x %2\n"
+"Orientation: %3"
+msgstr ""
+"Nova konfiguracija:\n"
+"Rezolucija: %1 x %2\n"
+"Orijentacija: %3"
+
+#: legacyrandrscreen.cpp:145
+#, kde-format
+msgid ""
+"New configuration:\n"
+"Resolution: %1 x %2\n"
+"Orientation: %3\n"
+"Refresh rate: %4"
+msgstr ""
+"Nova konfiguracija:\n"
+"Rezolucija: %1 x %2\n"
+"Orijentacija: %3\n"
+"Učestalost osvježavanja: %4"
+
+#: legacyrandrscreen.cpp:236 legacyrandrscreen.cpp:241
+#, kde-format
+msgctxt "Refresh rate in Hertz (Hz)"
+msgid "%1 Hz"
+msgstr "%1 Hz"
+
+#: main.cpp:33
+msgid "Resize and Rotate"
+msgstr "Promjena veličine i zaokretanje"
+
+#: main.cpp:34
+msgid "X Resize and Rotate System Tray App"
+msgstr "Aplikacija sustavske trake za zaokretanje i promjenu veličine X-a"
+
+#: main.cpp:35
+msgid "(c) 2007 Gustavo Pichorim Boiko, 2002-2003 Hamish Rodda"
+msgstr "© 2007 Gustavo Pichorim Boiko, 2002-2003 Hamish Rodda"
+
+#: main.cpp:36
+msgid "Gustavo Pichorim Boiko"
+msgstr "Gustavo Pichorim Boiko"
+
+#: main.cpp:36
+msgid "Maintainer"
+msgstr "Održavatelj"
+
+#: main.cpp:37
+msgid "Hamish Rodda"
+msgstr "Hamish Rodda"
+
+#: main.cpp:37
+msgid "Original Author"
+msgstr "Izvorni autor"
+
+#: main.cpp:38
+msgid "Lubos Lunak"
+msgstr "Lubos Lunak"
+
+#: main.cpp:38
+msgid "Many fixes"
+msgstr "Mnogo popravaka"
+
+#: main.cpp:39
+msgid "Harry Bock"
+msgstr "Harry Bock"
+
+#: main.cpp:39
+msgid "Many fixes, multi-head support"
+msgstr "Mnogo popravaka, podrška za više zaslona"
+
+#: main.cpp:46
+msgid "Application is being auto-started at KDE session start"
+msgstr "Aplikacija se automatski pokreće pri početku KDE sjednice"
+
+#: outputconfig.cpp:220
+msgid "Left of"
+msgstr "Lijevo od"
+
+#: outputconfig.cpp:221
+msgid "Right of"
+msgstr "Desno od"
+
+#: outputconfig.cpp:222
+msgctxt "Output is placed above another one"
+msgid "Above"
+msgstr "Iznad"
+
+#: outputconfig.cpp:223
+msgctxt "Output is placed below another one"
+msgid "Below"
+msgstr "Ispod"
+
+#: outputconfig.cpp:224
+msgid "Clone of"
+msgstr "Kopija od"
+
+#: outputconfig.cpp:225
+msgctxt "Fixed, abitrary position"
+msgid "Absolute"
+msgstr "Apsolutna"
+
+#: outputconfig.cpp:228
+msgid "No relative position"
+msgstr "Nema relativne pozicije"
+
+#: outputconfig.cpp:433
+msgctxt "Screen size"
+msgid "Disabled"
+msgstr "Onemogućeno"
+
+#: outputconfig.cpp:439
+#, kde-format
+msgctxt "Automatic screen size (native resolution)"
+msgid "%1 (Auto)"
+msgstr "%1 (Automatski)"
+
+#: outputconfig.cpp:477
+msgctxt "Automatic refresh rate configuration"
+msgid "Auto"
+msgstr "Automatski"
+
+#: outputgraphicsitem.cpp:72
+#, kde-format
+msgctxt "Configuration options. Output name, width x height (refresh rate Hz)"
+msgid ""
+"%1\n"
+"%2x%3 (%4 Hz)"
+msgstr ""
+
+#. i18n: file: randrconfigbase.ui:81
+#. i18n: ectx: property (text), widget (QPushButton, saveAsDefaultButton)
+#: randrconfig.cpp:61 rc.cpp:71
+msgid "Save as Default"
+msgstr "Spremi kao zadano"
+
+#: randrconfig.cpp:62
+msgid "Reset"
+msgstr "Poništi"
+
+#: randrconfig.cpp:125
+msgctxt "No display selected"
+msgid "None"
+msgstr "Nijedan"
+
+#: randrconfig.cpp:140 randrconfig.cpp:185
+#, kde-format
+msgid "%1 (Connected)"
+msgstr "%1 (Spojen)"
+
+#: randrconfig.cpp:329
+msgid "Configuration has been set as the desktop default."
+msgstr "Konfiguracija je postavljena kao zadana za radnu površinu."
+
+#: randrconfig.cpp:338
+msgid "Default desktop setup has been reset."
+msgstr "Zadane postavke radne površine su poništene."
+
+#: randrconfig.cpp:456
+msgid ""
+"Insufficient virtual size for the total screen size.\n"
+"The configured virtual size of your X server is insufficient for this setup. "
+"This configuration needs to be adjusted.\n"
+"Do you wish to run a tool to adjust the configuration?"
+msgstr ""
+"Nedovoljna virtualna veličina za cijelu veličinu zaslona.\n"
+"Podešena virtualna veličina za vaš poslužitelj X nije dovoljna za ovaj "
+"postav. Ova konfiguracija mora biti prilagođena.\n"
+"Želute li pokrenuti alat za prilagodbu konfiguracije?"
+
+#: randrconfig.cpp:464
+msgid ""
+"Configuration has been adjusted. Please restart your session for this change "
+"to take effect."
+msgstr ""
+"Konfiguracija je podešena. Molim vas da ponovno pokrenete sesiju kako bi se "
+"odabrana promjena primijenila."
+
+#: randrconfig.cpp:467
+msgid "Changing configuration failed. Please adjust your xorg.conf manually."
+msgstr ""
+"Promjena konfiguracije nije uspjela. Molim vas da ručno uredite vaš xorg."
+"conf."
+
+#: randr.cpp:32
+msgid "No Rotation"
+msgstr "Nema zaokretanja"
+
+#: randr.cpp:34
+msgid "Left (90 degrees)"
+msgstr "Lijevo (90 stupnjeva)"
+
+#: randr.cpp:36
+msgid "Upside-Down (180 degrees)"
+msgstr "Naopako (180 stupnjeva)"
+
+#: randr.cpp:38
+msgid "Right (270 degrees)"
+msgstr "Desno (270 stupnjeva)"
+
+#: randr.cpp:40
+msgid "Mirror Horizontally"
+msgstr "Vodoravno zrcaljenje"
+
+#: randr.cpp:42
+msgid "Mirror Vertically"
+msgstr "Vertikalno zrcaljenje"
+
+#: randr.cpp:44 randr.cpp:75
+msgid "Unknown Orientation"
+msgstr "Nepoznata orijentacija"
+
+#: randr.cpp:49
+msgid "Not Rotated"
+msgstr "Nije zaokrenut"
+
+#: randr.cpp:51
+msgid "Rotated 90 Degrees Counterclockwise"
+msgstr "Zaokrenut 90 stupnjeva u smjeru suprotnom od kazaljke na satu"
+
+#: randr.cpp:53
+msgid "Rotated 180 Degrees Counterclockwise"
+msgstr "Zaokrenut 180 stupnjeva u smjeru suprotnom od kazaljke na satu"
+
+#: randr.cpp:55
+msgid "Rotated 270 Degrees Counterclockwise"
+msgstr "Zaokrenut 270 stupnjeva u smjeru suprotnom od kazaljke na satu"
+
+#: randr.cpp:60
+msgid "Mirrored Horizontally And Vertically"
+msgstr "Zrcaljen vodoravno i okomito"
+
+#: randr.cpp:62
+msgid "mirrored horizontally and vertically"
+msgstr "zrcaljen vodoravno i okomito"
+
+#: randr.cpp:65
+msgid "Mirrored Horizontally"
+msgstr "Zrcaljen vodoravno"
+
+#: randr.cpp:67
+msgid "mirrored horizontally"
+msgstr "zrcaljen vodoravno"
+
+#: randr.cpp:70
+msgid "Mirrored Vertically"
+msgstr "Zrcaljen okomito"
+
+#: randr.cpp:72
+msgid "mirrored vertically"
+msgstr "zrcaljen okomito"
+
+#: randr.cpp:77
+msgid "unknown orientation"
+msgstr "nepoznata orijentacija"
+
+#: randr.cpp:129
+msgid "Confirm Display Setting Change"
+msgstr "Potvrdi promjenu postavki zaslona"
+
+#: randr.cpp:133
+msgid "&Accept Configuration"
+msgstr "&Prihvati konfiguraciju"
+
+#: randr.cpp:134
+msgid "&Revert to Previous Configuration"
+msgstr "&Vrati na prethodnu konfiguraciju"
+
+#: randr.cpp:136
+msgid ""
+"Your screen configuration has been changed to the requested settings. Please "
+"indicate whether you wish to keep this configuration. In 15 seconds the "
+"display will revert to your previous settings."
+msgstr ""
+"Konfiguracija Vašeg zaslona je promijenjena prema zahtijevanim postavkama. "
+"Molim odlučite želite li zadržati konfiguraciju. Nakon 15 sekundi će se "
+"zaslon postaviti na prethodne postavke."
+
+#: randrdisplay.cpp:49
+#, kde-format
+msgid "X Resize and Rotate extension version %1.%2"
+msgstr "Proširenje X-a za promjenu veličine i zaokretanje verzija %1.%2"
+
+#: rc.cpp:1
+msgctxt "NAME OF TRANSLATORS"
+msgid "Your names"
+msgstr "Nenad Mikšam, Andrej Dundović"
+
+#: rc.cpp:2
+msgctxt "EMAIL OF TRANSLATORS"
+msgid "Your emails"
+msgstr "DoDoEntertainment@gmail.com, andrej@dundovic.com.hr"
+
+#. i18n: file: legacyrandrconfigbase.ui:14
+#. i18n: ectx: property (windowTitle), widget (QWidget, LegacyRandRConfigBase)
+#: rc.cpp:5
+msgid "Screen Resize and Rotate Settings"
+msgstr "Postavke Zaokretanja i promjene veličine zaslona"
+
+#. i18n: file: legacyrandrconfigbase.ui:17
+#. i18n: ectx: property (whatsThis), widget (QWidget, LegacyRandRConfigBase)
+#: rc.cpp:8
+msgid ""
+"If this option is enabled, options set by the system tray applet will be "
+"saved and loaded when KDE starts instead of being temporary."
+msgstr ""
+"Ako je ova opcija omogućena, opcije koje postavi programčić sustavske trake "
+"će biti spremljene i ponovo učitane kada se KDE ponovo pokrene, te stoga "
+"neće biti privremene."
+
+#. i18n: file: legacyrandrconfigbase.ui:25
+#. i18n: ectx: property (text), widget (QLabel, screenLabel)
+#: rc.cpp:11
+msgid "Settings for screen:"
+msgstr "Postavke zaslona:"
+
+#. i18n: file: legacyrandrconfigbase.ui:38
+#. i18n: ectx: property (whatsThis), widget (KComboBox, screenCombo)
+#: rc.cpp:14
+msgid ""
+"The screen whose settings you would like to change can be selected using "
+"this drop-down list."
+msgstr ""
+"Zaslon čije postavke želite mijenjati može biti odabran iz ovog padajućeg "
+"izbornika."
+
+#. i18n: file: legacyrandrconfigbase.ui:49
+#. i18n: ectx: property (text), widget (QLabel, sizeLabel)
+#: rc.cpp:17
+msgid "Screen size:"
+msgstr "Veličina zaslona:"
+
+#. i18n: file: legacyrandrconfigbase.ui:62
+#. i18n: ectx: property (whatsThis), widget (KComboBox, sizeCombo)
+#: rc.cpp:20
+msgid ""
+"The size, otherwise known as the resolution, of your screen can be selected "
+"from this drop-down list."
+msgstr ""
+"Veličina, poznatija kao rezolucija, Vašeg zaslona može biti odabrana iz ovog "
+"padajućeg izbornika."
+
+#. i18n: file: legacyrandrconfigbase.ui:73
+#. i18n: ectx: property (text), widget (QLabel, rateLabel)
+#: rc.cpp:23
+msgid "Refresh rate:"
+msgstr "Učestalost osvježavanja:"
+
+#. i18n: file: legacyrandrconfigbase.ui:83
+#. i18n: ectx: property (whatsThis), widget (KComboBox, rateCombo)
+#: rc.cpp:26
+msgid ""
+"The refresh rate of your screen can be selected from this drop-down list."
+msgstr ""
+"Učestalost osvježavanja Vašeg zaslona može biti odabrana iz ovog padajućeg "
+"izbornika."
+
+#. i18n: file: legacyrandrconfigbase.ui:98
+#. i18n: ectx: property (whatsThis), widget (QGroupBox, rotationGroup)
+#: rc.cpp:29
+msgid ""
+"The options in this section allow you to change the rotation of your screen."
+msgstr ""
+"Opcije u ovom dijelu Vam omogućuju promjenu zaokrenutosti Vašeg zaslona."
+
+#. i18n: file: legacyrandrconfigbase.ui:101
+#. i18n: ectx: property (title), widget (QGroupBox, rotationGroup)
+#: rc.cpp:32
+msgid "Orientation (degrees counterclockwise)"
+msgstr "Orijentacija (stupnjeva u smjeru suprotnom od kazaljke na satu)"
+
+#. i18n: file: legacyrandrconfigbase.ui:108
+#. i18n: ectx: property (whatsThis), widget (QCheckBox, applyOnStartup)
+#: rc.cpp:35
+msgid ""
+"If this option is enabled the size and orientation settings will be used "
+"when KDE starts."
+msgstr ""
+"Ako je ova opcija uključena, postavke veličine i orijentacije će biti "
+"korištene kada se KDE pokrene."
+
+#. i18n: file: legacyrandrconfigbase.ui:111
+#. i18n: ectx: property (text), widget (QCheckBox, applyOnStartup)
+#: rc.cpp:38
+msgid "Apply settings on KDE startup"
+msgstr "Primijeni postavke pri pokretanju KDE-a"
+
+#. i18n: file: legacyrandrconfigbase.ui:118
+#. i18n: ectx: property (text), widget (QCheckBox, syncTrayApp)
+#: rc.cpp:41
+msgid "Allow tray application to change startup settings"
+msgstr ""
+"Dozvoli aplikaciji sustavske trake promjenu postavki pokretanja uz sustav"
+
+#. i18n: file: outputconfigbase.ui:26
+#. i18n: ectx: property (windowTitle), widget (QWidget, OutputConfigBase)
+#: rc.cpp:44
+msgid "Output Config"
+msgstr "Izlazna konfiguracija"
+
+#. i18n: file: outputconfigbase.ui:32
+#. i18n: ectx: property (text), widget (QLabel, label_2)
+#: rc.cpp:47
+msgid "Size:"
+msgstr "Veličina:"
+
+#. i18n: file: outputconfigbase.ui:48
+#. i18n: ectx: property (text), widget (QLabel, rateLabel)
+#: rc.cpp:50
+msgid "Refresh:"
+msgstr "Osvježavanje:"
+
+#. i18n: file: outputconfigbase.ui:64
+#. i18n: ectx: property (text), widget (QLabel, orientationLabel)
+#: rc.cpp:53
+msgid "Orientation:"
+msgstr "Orijentacija:"
+
+#. i18n: file: outputconfigbase.ui:80
+#. i18n: ectx: property (text), widget (QLabel, positionLabel)
+#: rc.cpp:56
+msgctxt "Position of the screen"
+msgid "Position:"
+msgstr "Pozicija:"
+
+#. i18n: file: randrconfigbase.ui:14
+#. i18n: ectx: property (windowTitle), widget (QWidget, RandRConfigBase)
+#: rc.cpp:59
+msgid "Display Configuration (X11 Resize, Rotate and Reflect)"
+msgstr ""
+"Konfiguracija zaslona (X11 promjena veličine, zaokretanje i zrcaljenje)"
+
+#. i18n: file: randrconfigbase.ui:27
+#. i18n: ectx: property (text), widget (QCheckBox, unifyOutputs)
+#: rc.cpp:62
+#, fuzzy
+#| msgid "Unify Outputs"
+msgid "Unify outputs"
+msgstr "Ujedini izlaze"
+
+#. i18n: file: randrconfigbase.ui:52
+#. i18n: ectx: property (text), widget (QLabel, label)
+#: rc.cpp:65
+msgid "Primary output:"
+msgstr "Primarni izlaz:"
+
+#. i18n: file: randrconfigbase.ui:74
+#. i18n: ectx: property (text), widget (QPushButton, identifyOutputsButton)
+#: rc.cpp:68
+msgid "Identify Outputs"
+msgstr "Odredi izlaze"
+
+#~ msgid "Screen Settings"
+#~ msgstr "Postavke zaslona"
+
+#~ msgid "KRandR"
+#~ msgstr "KRandR"
+
+#~ msgid "Screen resize & rotate"
+#~ msgstr "Promjena veličine i zaokretanje zaslona"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/krunner.po kde-l10n-hr-4.13.0/messages/kde-workspace/krunner.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/krunner.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/krunner.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,460 @@
+# Translation of krunner to Croatian
+#
+# Andrej Dundovic , 2009, 2010.
+# Andrej Dundović , 2009.
+# Marko Dimjasevic , 2010, 2011.
+msgid ""
+msgstr ""
+"Project-Id-Version: krunner\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-09-08 04:07+0200\n"
+"PO-Revision-Date: 2011-07-31 23:12+0200\n"
+"Last-Translator: Marko Dimjašević \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 1.2\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: configdialog.cpp:52
+msgid "Plugins"
+msgstr "Priključci"
+
+#: configdialog.cpp:81
+msgid "User Interface"
+msgstr "Korisničko sučelje"
+
+#: configdialog.cpp:87
+msgid "Available Features"
+msgstr "Dostupne mogućnosti"
+
+#: interfaces/default/interface.cpp:90 interfaces/default/interface.cpp:91
+#: interfaces/quicksand/qs_dialog.cpp:59 interfaces/quicksand/qs_dialog.cpp:60
+msgid "Settings"
+msgstr "Postavke"
+
+#: interfaces/default/interface.cpp:112
+msgid "Help"
+msgstr "Pomoć"
+
+#: interfaces/default/interface.cpp:113
+msgid "Information on using this application"
+msgstr "Informacije o korištenju ove aplikacije"
+
+#: interfaces/default/interface.cpp:264 interfaces/quicksand/qs_dialog.cpp:317
+#, kde-format
+msgctxt "tooltip, shortcut"
+msgid "%1 (%2)"
+msgstr "%1 (%2)"
+
+#: interfaces/default/interface.cpp:416
+#, kde-format
+msgid "(From %1, %2)"
+msgstr "(Iz %1, %2)"
+
+#: interfaces/quicksand/qs_dialog.cpp:108
+msgid "Actions"
+msgstr "Radnje"
+
+#: interfaces/quicksand/qs_matchview.cpp:193
+msgid "Type to search."
+msgstr "Tipkaj za pretragu"
+
+#: interfaces/quicksand/qs_matchview.cpp:274
+#, kde-format
+msgid "1 item"
+msgid_plural "%1 items"
+msgstr[0] "%1 stavka"
+msgstr[1] "%1 stavke"
+msgstr[2] "%1 stavki"
+
+#: interfaces/quicksand/qs_matchview.cpp:276
+#, kde-format
+msgid "1 action"
+msgid_plural "%1 actions"
+msgstr[0] "%1 radnja"
+msgstr[1] "%1 radnje"
+msgstr[2] "%1 radnji"
+
+#: interfaces/quicksand/qs_matchview.cpp:361
+msgid "Loading..."
+msgstr "Učitavanje …"
+
+#: interfaces/quicksand/qs_matchview.cpp:446
+msgid "No results found."
+msgstr "Bez nađenih rezultata"
+
+#: interfaces/quicksand/qs_statusbar.cpp:57
+#, kde-format
+msgctxt "%1 current item number, %2 total number of items"
+msgid "%1 of %2"
+msgstr "%1 od %2"
+
+#: krunnerapp.cpp:127 krunnerdialog.cpp:73
+msgid "Run Command"
+msgstr "Pokreni naredbu"
+
+#: krunnerapp.cpp:132
+msgid "Run Command on clipboard contents"
+msgstr "Pokreni naredbu na sadržaju odlagališta"
+
+#: krunnerapp.cpp:138
+msgid "Show System Activity"
+msgstr "Prikaži Aktivnost sustava"
+
+#: krunnerapp.cpp:144
+msgid "Switch User"
+msgstr "Zamijeni korisnika"
+
+#: krunnerapp.cpp:154
+msgid "Lock Session"
+msgstr "Zaključaj sjednicu"
+
+#: krunnerapp.cpp:194
+#, kde-format
+msgctxt "Run krunner restricting the search only to runner %1"
+msgid "Run Command (runner \"%1\" only)"
+msgstr "Pokreni naredbu (samo pokretač \"%1\")"
+
+#: ksystemactivitydialog.cpp:40
+msgid "System Activity"
+msgstr "Aktivnost sustava"
+
+#: lock/autologout.cc:38
+msgid "Automatic Log Out "
+msgstr "Automatsko odjavljivanje "
+
+#: lock/autologout.cc:39
+msgid ""
+"To prevent being logged out, resume using this session by moving the "
+"mouse or pressing a key. "
+msgstr ""
+"Da bi spriječili odjavljivanje nastavite koristiti ovu sjednicu micanjem "
+"mišta ili pritiskom na tipku. "
+
+#: lock/autologout.cc:44
+msgid "Time Remaining:"
+msgstr "Preostalo vrijeme:"
+
+#: lock/autologout.cc:77
+#, kde-format
+msgid "You will be automatically logged out in 1 second "
+msgid_plural ""
+"You will be automatically logged out in %1 seconds "
+msgstr[0] "Bit ćete automatski odjavljeni za %1 sekundu "
+msgstr[1] "Bit ćete automatski odjavljeni za %1 sekunde "
+msgstr[2] "Bit ćete automatski odjavljeni za %1 sekundi "
+
+#: lock/lockdlg.cc:100
+msgid "The session is locked "
+msgstr "Sjednica je zaključana "
+
+#: lock/lockdlg.cc:101
+#, kde-format
+msgid "The session was locked by %1 "
+msgstr "Sjednicu je zaključao %1 "
+
+#: lock/lockdlg.cc:114
+msgid "Unl&ock"
+msgstr "Ot&ključaj"
+
+#: lock/lockdlg.cc:116
+msgid "Sw&itch User..."
+msgstr "Zamijeni korisnika …"
+
+#: lock/lockdlg.cc:187
+msgid "Unlocking failed "
+msgstr "Otključavanje nije uspjelo "
+
+#: lock/lockdlg.cc:195
+msgid "Warning: Caps Lock on "
+msgstr "Upozorenje: Caps Lock je uključen "
+
+#: lock/lockdlg.cc:432
+#, kde-format
+msgid ""
+"Cannot unlock the session because the authentication system failed to work;\n"
+"you must kill kscreenlocker (pid %1) manually."
+msgstr ""
+"Nije moguće otključati sjednicu jer authentifikacijski sustav ne radi "
+"ispravno;\n"
+"morate ručno uništiti kscreenlocker (pid %1)."
+
+#: lock/lockdlg.cc:520
+msgid "&Start New Session"
+msgstr "Pokreni novu &sjednicu"
+
+#: lock/lockdlg.cc:528
+#, kde-format
+msgid ""
+"You have chosen to open another desktop session instead of resuming the "
+"current one.\n"
+"The current session will be hidden and a new login screen will be "
+"displayed.\n"
+"An F-key is assigned to each session; F%1 is usually assigned to the first "
+"session, F%2 to the second session and so on. You can switch between "
+"sessions by pressing Ctrl, Alt and the appropriate F-key at the same time. "
+"Additionally, the KDE Panel and Desktop menus have actions for switching "
+"between sessions."
+msgstr ""
+"Odabrali ste otvoriti još jednu desktop sjednicu umjesto nastavljanja s "
+"trenutnom.\n"
+"Trenutna sjednica bit će skrivena i pojavit će se novi ekran za prijavu.\n"
+"Svaka F-tipka je pridružena jednoj sjednici; F%1 je obično pridružena prvoj "
+"sjednici, F%2 drugoj i tako dalje. Možete se prebacivati između sjednica "
+"istovremenim pritiskom na Ctrl, Alt i pripadajuću F-tipku. Dodatno, KDE "
+"Panel i izbornici radne površine imaju akcije za prebacivanje između "
+"sjednica."
+
+#: lock/lockdlg.cc:541
+msgid "&Do not ask again"
+msgstr "Ne &pitaj ponovno"
+
+#: lock/lockdlg.cc:597
+msgid "Session"
+msgstr "Sjednica"
+
+#: lock/lockdlg.cc:597
+msgid "Location"
+msgstr "Lokacija"
+
+#: lock/lockdlg.cc:625
+msgctxt "session"
+msgid "&Activate"
+msgstr "&Aktiviraj"
+
+#: lock/lockdlg.cc:634
+msgid "Start &New Session"
+msgstr "Pokreni &novu sjednicu"
+
+#: lock/lockprocess.cc:834
+msgid "Will not lock the session, as unlocking would be impossible:\n"
+msgstr "Sjednica se neće zaključati pošto bi je bilo nemoguće otključati:\n"
+
+#: lock/lockprocess.cc:838
+msgid "Cannot start kcheckpass ."
+msgstr "Nije moguće pokrenuti kcheckpass ."
+
+#: lock/lockprocess.cc:839
+msgid "kcheckpass is unable to operate. Possibly it is not setuid root."
+msgstr ""
+"kcheckpass ne može funkcionirati. Moguće je da nije postavljen s "
+"setuid root."
+
+#: lock/lockprocess.cc:902
+msgid "No appropriate greeter plugin configured."
+msgstr "Nije podešen odgovarajući pozdravni priključk."
+
+#: lock/main.cc:61
+msgid "KDE Screen Locker"
+msgstr "KDE ključar ekrana"
+
+#: lock/main.cc:62
+msgid "Session Locker for KDE Workspace"
+msgstr "Ključar sjednice za KDE-ov radni prostor"
+
+#: lock/main.cc:65
+msgid "Force session locking"
+msgstr "Prisiljavaj zaključavanje sjednice"
+
+#: lock/main.cc:66
+msgid "Only start screen saver"
+msgstr "Pokreni samo čuvar zaslona"
+
+#: lock/main.cc:67
+msgid "Immediately show the unlock dialog"
+msgstr "Odmah prikaži dijalog za otključavanje"
+
+#: lock/main.cc:68
+msgid "Only use the blank screen saver"
+msgstr "Koristi samo prazan čuvar ekrana"
+
+#: lock/main.cc:69
+msgid "start with plasma unlocked for configuring"
+msgstr "pokreni s plasmom otključanom za podešavanje"
+
+#: lock/main.cc:70
+msgid "Fork into the background after starting up"
+msgstr "Preseli u pozadinu nakon pokretanja"
+
+#: main.cpp:38
+msgid "KDE run command interface"
+msgstr "KDE-ovo sučelje za pokretanje naredbi"
+
+#: main.cpp:50
+msgid "Run Command Interface"
+msgstr "Sučelje za pokretanje naredbi"
+
+#: main.cpp:52
+msgid "(c) 2006, Aaron Seigo"
+msgstr "© 2006 Aaron Seigo"
+
+#: main.cpp:53
+msgid "Aaron J. Seigo"
+msgstr "Aaron J. Seigo"
+
+#: main.cpp:54
+msgid "Author and maintainer"
+msgstr "Autor i održavatelj"
+
+#: rc.cpp:1
+msgctxt "NAME OF TRANSLATORS"
+msgid "Your names"
+msgstr "Žarko Pintar, Andrej Dundović"
+
+#: rc.cpp:2
+msgctxt "EMAIL OF TRANSLATORS"
+msgid "Your emails"
+msgstr "zarko.pintar@gmail.com, adundovi@gmail.com"
+
+#. i18n: file: kcfg/krunner.kcfg:13
+#. i18n: ectx: label, entry, group (General)
+#: rc.cpp:5
+msgid "The interface style to use in KRunner"
+msgstr "Stil sučelja koji se koristi u KRunneru"
+
+#. i18n: file: kcfg/krunner.kcfg:21
+#. i18n: ectx: label, entry, group (General)
+#: rc.cpp:8
+msgid ""
+"Set to true to show the interface in a freely floating dialog instead of at "
+"the top of the screen"
+msgstr ""
+"Postavite na istinu kako bi sučetelje bilo slobodno gibajući dijaloški "
+"okvir, umjesto pričvršćeno na vrh zaslona."
+
+#. i18n: file: kcfg/krunner.kcfg:26
+#. i18n: ectx: label, entry, group (General)
+#: rc.cpp:11
+msgid "Completion mode used for the query text."
+msgstr "Koristi način dovršavanja za tekstualne upite."
+
+#. i18n: file: kcfg/krunner.kcfg:31
+#. i18n: ectx: label, entry (PastQueries), group (General)
+#: rc.cpp:14
+msgid "History if past queries successfully completed"
+msgstr "Upamti ako su prošli upiti uspješno dovršeni"
+
+#. i18n: file: kcfg/krunner.kcfg:40
+#. i18n: ectx: label, entry (KeepTaskDialogAbove), group (TaskDialog)
+#: rc.cpp:17
+msgid "Whether to keep the tasks dialog above other windows when shown."
+msgstr "Da li držati dijalog zadataka iznad ostalih prozora kad se prikaže."
+
+#. i18n: file: kcfg/kscreensaversettings.kcfg:11
+#. i18n: ectx: label, entry (ScreenSaverEnabled), group (ScreenSaver)
+#: rc.cpp:23
+msgid "Enable screen saver"
+msgstr "Omogući čuvar ekrana"
+
+#. i18n: file: kcfg/kscreensaversettings.kcfg:12
+#. i18n: ectx: whatsthis, entry (ScreenSaverEnabled), group (ScreenSaver)
+#: rc.cpp:26
+msgid "Enables the screen saver."
+msgstr "Omogućuje čuvar ekrana"
+
+#. i18n: file: kcfg/kscreensaversettings.kcfg:16
+#. i18n: ectx: label, entry, group (ScreenSaver)
+#: rc.cpp:29
+msgid "Screen saver timeout"
+msgstr "Vremensko ograničenje čuvara ekrana"
+
+#. i18n: file: kcfg/kscreensaversettings.kcfg:17
+#. i18n: ectx: whatsthis, entry, group (ScreenSaver)
+#: rc.cpp:32
+msgid "Sets the seconds after which the screen saver is started."
+msgstr "Postavlja broj sekundi nakon kojih se pokreće čuvar ekrana."
+
+#. i18n: file: kcfg/kscreensaversettings.kcfg:21
+#. i18n: ectx: label, entry (SuspendWhenInvisible), group (ScreenSaver)
+#: rc.cpp:35
+msgid "Suspend screen saver when DPMS kicks in"
+msgstr "Zaustavi čuvar ekrana kada upadne DPMS"
+
+#. i18n: file: kcfg/kscreensaversettings.kcfg:24
+#. i18n: ectx: whatsthis, entry (SuspendWhenInvisible), group (ScreenSaver)
+#: rc.cpp:38
+msgid ""
+"Usually the screen saver is suspended when display power saving kicks in,\n"
+" as nothing can be seen on the screen anyway, obviously. However, some "
+"screen savers\n"
+" actually perform useful computations, so it is not desirable to "
+"suspend them."
+msgstr ""
+"Obično je čuvar ekrana zaustavljen kada upadne ekransko čuvanje energije,\n"
+"jer očito ništa ne može biti vidljivo na ekranu. Međutim, neki čuvari ekrana "
+"provode korisne izračune stoga ih nije poželjno zaustavljati."
+
+#. i18n: file: interfaceOptions.ui:17
+#. i18n: ectx: property (text), widget (QLabel, label_2)
+#: rc.cpp:43
+msgid "Positioning:"
+msgstr "Pozicioniranje:"
+
+#. i18n: file: interfaceOptions.ui:27
+#. i18n: ectx: property (text), widget (QRadioButton, topEdgeButton)
+#: rc.cpp:46
+msgid "Top edge of screen"
+msgstr "Gornji rub zaslona"
+
+#. i18n: file: interfaceOptions.ui:37
+#. i18n: ectx: property (text), widget (QRadioButton, freeFloatingButton)
+#: rc.cpp:49
+msgid "Free floating window"
+msgstr "Slobodno gibajući prozor"
+
+#. i18n: file: interfaceOptions.ui:57
+#. i18n: ectx: property (text), widget (QLabel, label)
+#: rc.cpp:52
+msgid "Style:"
+msgstr "Stil:"
+
+#. i18n: file: interfaceOptions.ui:67
+#. i18n: ectx: property (text), widget (QRadioButton, commandButton)
+#: rc.cpp:55
+msgid "Command oriented"
+msgstr "Okrenut naredbama"
+
+#. i18n: file: interfaceOptions.ui:77
+#. i18n: ectx: property (text), widget (QRadioButton, taskButton)
+#: rc.cpp:58
+msgid "Task oriented"
+msgstr "Okrenut zadacima"
+
+#. i18n: file: interfaceOptions.ui:97
+#. i18n: ectx: property (text), widget (QPushButton, previewButton)
+#: rc.cpp:61
+msgid "Preview"
+msgstr "Pregled"
+
+#~ msgid "Log Out"
+#~ msgstr "Odjava"
+
+#~ msgid "Log Out Without Confirmation"
+#~ msgstr "Odjava bez potvrde"
+
+#~ msgid "Halt Without Confirmation"
+#~ msgstr "Zaustavljanje bez potvrde"
+
+#~ msgid "Reboot Without Confirmation"
+#~ msgstr "Ponovno pokreni bez potvrde"
+
+#~ msgid ""
+#~ "Could not log out properly.\n"
+#~ "The session manager cannot be contacted. You can try to force a shutdown "
+#~ "by pressing Ctrl+Alt+Backspace; note, however, that your current session "
+#~ "will not be saved with a forced shutdown."
+#~ msgstr ""
+#~ "Odjava nije prošla pravilno.\n"
+#~ "Upravitelj sjednice ne može biti kontaktiran. Možete probati prisilno "
+#~ "isključivanje pritiskom na Ctrl+Alt+Backspace; primjetite međutim da vaša "
+#~ "trenutna sjednica neće biti sačuvana prilikom prisilnog isključivanja."
+
+#~ msgid "KRunner Settings"
+#~ msgstr "Postavke KRunnera"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/kscreensaver.po kde-l10n-hr-4.13.0/messages/kde-workspace/kscreensaver.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/kscreensaver.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/kscreensaver.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,72 @@
+# Translation of kscreensaver to Croatian
+#
+msgid ""
+msgstr ""
+"Project-Id-Version: kscreensaver 0\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-02 05:38+0200\n"
+"PO-Revision-Date: 2006-05-11 15:24+0100\n"
+"Last-Translator: Renato Pavicic \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: TransDict server\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: random.cpp:45
+#, kde-format
+msgid ""
+"Usage: %1 [-setup] [args]\n"
+"Starts a random screen saver.\n"
+"Any arguments (except -setup) are passed on to the screen saver."
+msgstr ""
+"Upotreba: %1 [-setup] [args]\n"
+"Pokreće nasumičan čuvar zaslona.\n"
+"Bilo koji argumenti (osim -setup) proslijeđuju se čuvaru zaslona."
+
+#: random.cpp:52
+msgid "Start a random KDE screen saver"
+msgstr "Pokreni nasumični KDE čuvar zaslona"
+
+#: random.cpp:67
+msgid "Random screen saver"
+msgstr "Nasumičan čuvar zaslona"
+
+#: random.cpp:73
+msgid "Setup screen saver"
+msgstr "Postavke čuvara zaslona"
+
+#: random.cpp:75
+msgid "Run in the specified XWindow"
+msgstr "Pokreni u određenom X prozoru"
+
+#: random.cpp:77
+msgid "Run in the root XWindow"
+msgstr "Pokreni u root X prozoru"
+
+#: random.cpp:179
+msgid "Setup Random Screen Saver"
+msgstr "Postavke nasumičnog čuvara zaslona"
+
+#: random.cpp:187
+msgid "Use OpenGL screen savers"
+msgstr "Upotrijebi OpenGL čuvare zaslona"
+
+#: random.cpp:190
+msgid "Use screen savers that manipulate the screen"
+msgstr "Upotrijebi čuvare zaslona koji upravljaju zaslonom"
+
+#~ msgid "KBlankScreen"
+#~ msgstr "KBlankScreen"
+
+#~ msgid "Setup Blank Screen Saver"
+#~ msgstr "Postavke praznog čuvara zaslona"
+
+#~ msgid "Color:"
+#~ msgstr "Boja:"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/ksystraycmd.po kde-l10n-hr-4.13.0/messages/kde-workspace/ksystraycmd.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/ksystraycmd.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/ksystraycmd.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,147 @@
+# Translation of ksystraycmd to Croatian
+#
+# Previous translators: Nikola Gotovac,
+msgid ""
+msgstr ""
+"Project-Id-Version: ksystraycmd\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-02 05:38+0200\n"
+"PO-Revision-Date: 2009-08-20 14:06+0200\n"
+"Last-Translator: \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"X-Generator: Lokalize 0.3\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: ksystraycmd.cpp:80
+#, kde-format
+msgid "No window matching pattern '%1' and no command specified.\n"
+msgstr "Nema prozora koji odgovara uzorku '%1' i nema navedene naredbe.\n"
+
+#: ksystraycmd.cpp:87
+msgid "KSysTrayCmd: K3ShellProcess cannot find a shell."
+msgstr "KSysTrayCmd: KShellProcess ne može pronaći ljusku."
+
+#: ksystraycmd.cpp:248 main.cpp:26
+msgid "KSysTrayCmd"
+msgstr "KSysTrayCmd"
+
+#: ksystraycmd.cpp:249
+msgid "&Hide"
+msgstr "&Sakrij"
+
+#: ksystraycmd.cpp:249
+msgid "&Restore"
+msgstr "&Obnovi"
+
+#: ksystraycmd.cpp:250
+msgid "&Undock"
+msgstr "&Otkači"
+
+#: ksystraycmd.cpp:251
+msgid "&Quit"
+msgstr "&Izađi"
+
+#: main.cpp:28
+msgid "Allows any application to be kept in the system tray"
+msgstr "Svakoj aplikaciji dopusti zadržavanje u traci sustava"
+
+#: main.cpp:30
+msgid "(C) 2001-2002 Richard Moore (rich@kde.org)"
+msgstr "© 2001–2002 Richard Moore (rich@kde.org)"
+
+#: main.cpp:31
+msgid "Richard Moore"
+msgstr "Richard Moore"
+
+#: main.cpp:36
+msgid "Command to execute"
+msgstr "Naredba za izvršavanje"
+
+#: main.cpp:38
+msgid ""
+"A regular expression matching the window title\n"
+"If you do not specify one, then the very first window\n"
+"to appear will be taken - not recommended."
+msgstr ""
+"Uobičajeni izraz koji odgovara naslovu prozora.\n"
+"Ako ne navedete neki izraz, uzima se prvi prozor\n"
+"koji se pojavi. Nije preporučljivo."
+
+#: main.cpp:41
+msgid ""
+"The window id of the target window\n"
+"Specifies the id of the window to use. If the id starts with 0x\n"
+"it is assumed to be in hex."
+msgstr ""
+"ID oznaka ciljnog prozora.\n"
+"Određuje ID oznaku prozora koji se upotrebljava.\n"
+"Ako započinje sa \"0x\", pretpostavlja se da je heksadecimalan broj."
+
+#: main.cpp:44
+msgid "Hide the window to the tray on startup"
+msgstr "Kod pokretanja, prozor sakrij u traku"
+
+#: main.cpp:45
+msgid ""
+"Wait until we are told to show the window before\n"
+"executing the command"
+msgstr ""
+"Čekaj dok se ne odredi potreba prikazivanja prozora\n"
+"prije izvršavanja naredbe."
+
+#: main.cpp:47
+msgid "Sets the initial tooltip for the tray icon"
+msgstr "Zadavanje početnog savjeta alata ikone u traci"
+
+#: main.cpp:48
+msgid ""
+"Keep the tray icon even if the client exits. This option\n"
+"has no effect unless startonshow is specified."
+msgstr ""
+"Zadrži ikonu u traci sustava čak i kad program završi.\n"
+"(Ova opcija nema učinak ako nije određena opcija 'startonshow'.)"
+
+#: main.cpp:50
+msgid ""
+"Use ksystraycmd's icon instead of the window's icon in the systray\n"
+"(should be used with --icon to specify ksystraycmd icon)"
+msgstr ""
+"U traci sustava upotrijebi ikonu aplikacije ksystraycmd umjesto ikone "
+"prozora.\n"
+"(potrebno je upotrijebiti uz argument --icon radi određivanja ikone "
+"ksystraycmda)"
+
+#: main.cpp:52
+msgid "Try to keep the window above other windows"
+msgstr "Pokušaj s održavanjem prozora iznad ostalih prozora."
+
+#: main.cpp:53
+msgid ""
+"Quit the client when we are told to hide the window.\n"
+"This has no effect unless startonshow is specified and implies keeprunning."
+msgstr ""
+"Prekini klijenta kad se odredi skrivanje prozora.\n"
+"(Nema učinka ako opcija 'startonshow' nije određena, a podrazumijeva "
+"pokrenutost opcije 'keepruning')"
+
+#: main.cpp:91
+msgid "No command or window specified"
+msgstr "Nije određena naredba ili prozor"
+
+#: rc.cpp:1
+msgctxt "NAME OF TRANSLATORS"
+msgid "Your names"
+msgstr "Renato Pavičić, Andrej Dundović"
+
+#: rc.cpp:2
+msgctxt "EMAIL OF TRANSLATORS"
+msgid "Your emails"
+msgstr "renato@translator-shop.org, adundovi@gmail.com"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/libkscreensaver.po kde-l10n-hr-4.13.0/messages/kde-workspace/libkscreensaver.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/libkscreensaver.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/libkscreensaver.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,47 @@
+# Translation of libkscreensaver to Croatian
+#
+# Andrej Dundović , 2009.
+msgid ""
+msgstr ""
+"Project-Id-Version: libkscreensaver\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-02 05:38+0200\n"
+"PO-Revision-Date: 2009-06-21 07:09+0200\n"
+"Last-Translator: Andrej Dundović \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"X-Generator: Lokalize 0.3\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: main.cpp:133
+msgid "Setup screen saver"
+msgstr "Postavke čuvara zaslona"
+
+#: main.cpp:135
+msgid "Run in the specified XWindow"
+msgstr "Pokreni u određenom XWindow-u"
+
+#: main.cpp:137
+msgid "Run in the root XWindow"
+msgstr "Pokrenu u korijenskom XWindow-u"
+
+#: main.cpp:139
+msgid "Start screen saver in demo mode"
+msgstr "Čuvar zaslona pokreni u probnom načinu"
+
+#: rc.cpp:1
+msgctxt "NAME OF TRANSLATORS"
+msgid "Your names"
+msgstr "Andrej Dundovic"
+
+#: rc.cpp:2
+msgctxt "EMAIL OF TRANSLATORS"
+msgid "Your emails"
+msgstr "adundovi@gmail.com"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/libplasmaclock.po kde-l10n-hr-4.13.0/messages/kde-workspace/libplasmaclock.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/libplasmaclock.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/libplasmaclock.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,321 @@
+# Translation of libplasmaclock to Croatian
+#
+# DoDo , 2009.
+# Andrej Dundovic , 2009, 2010.
+# Marko Dimjasevic , 2010, 2011.
+# Marko Dimjašević , 2011.
+msgid ""
+msgstr ""
+"Project-Id-Version: libplasmaclock\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-17 03:40+0200\n"
+"PO-Revision-Date: 2011-07-12 17:57+0200\n"
+"Last-Translator: Marko Dimjašević \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 1.2\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: calendartable.cpp:657
+#, kde-format
+msgctxt "Day off: Holiday name (holiday region)"
+msgid "Holiday : %1 (%2)"
+msgstr "Praznik : %1 (%2)"
+
+#: calendartable.cpp:663
+#, kde-format
+msgctxt "Not day off: Holiday name (holiday region)"
+msgid "%1 (%2)"
+msgstr "%1 (%2)"
+
+#: calendartable.cpp:672
+#, kde-format
+msgid "Event : %1"
+msgstr "Događaj : %1"
+
+#: calendartable.cpp:679
+#, kde-format
+msgid "Todo : %1"
+msgstr "Za napraviti : %1"
+
+#: calendartable.cpp:694
+#, kde-format
+msgctxt "All-day calendar event summary"
+msgid " %1"
+msgstr " %1"
+
+#: calendartable.cpp:696
+#, kde-format
+msgctxt "Time and summary for a calendarevent"
+msgid "%1 %2"
+msgstr "%1 %2"
+
+#: calendartable.cpp:701
+#, kde-format
+msgctxt "Start and end time and summary for a calendar event"
+msgid "%1 - %2 %3"
+msgstr "%1 – %2 %3"
+
+#: calendartable.cpp:886 clockapplet.cpp:576
+msgid "Calendar"
+msgstr "Kalendar"
+
+#: calendartable.cpp:889
+msgid "Local"
+msgstr "Lokalni"
+
+#: clockapplet.cpp:182
+msgid "Starting Jovie Text-to-Speech Service Failed"
+msgstr "Neuspjelo pokretanje usluge Jovie za pretvorbu teksta u govor"
+
+#: clockapplet.cpp:195
+#, kde-format
+msgctxt "Text sent to the text to speech service when minutes==0 and it is AM"
+msgid "It is 1 o clock a m"
+msgid_plural "It is %1 o clock a m"
+msgstr[0] "Sada je %1 ujutro"
+msgstr[1] "Sada je %1 ujutro"
+msgstr[2] "Sada je %1 ujutro"
+
+#: clockapplet.cpp:201
+#, kde-format
+msgctxt "Text sent to the text to speech service when minutes==0 and it is PM"
+msgid "It is 1 o clock p m"
+msgid_plural "It is %1 o clock p m"
+msgstr[0] "Sada je %1 popodne"
+msgstr[1] "Sada je %1 popodne"
+msgstr[2] "Sada je %1 popodne"
+
+#: clockapplet.cpp:208
+#, kde-format
+msgctxt ""
+"Text sent to the text to speech service when minutes==0 and it is the 24 "
+"hour clock"
+msgid "It is 1 o clock"
+msgid_plural "It is %1 o clock"
+msgstr[0] "Sada je %1"
+msgstr[1] "Sada je %1"
+msgstr[2] "Sada je %1"
+
+#: clockapplet.cpp:216
+#, kde-format
+msgctxt "Text sent to the text to speech service for AM"
+msgid "It is %1:%2 a m"
+msgstr "Sada je %1:%2 ujutro"
+
+#: clockapplet.cpp:221
+#, kde-format
+msgctxt "Text sent to the text to speech service for PM"
+msgid "It is %1:%2 p m"
+msgstr "Sada je %1:%2 popodne"
+
+#: clockapplet.cpp:227
+#, kde-format
+msgctxt "Text sent to the text to speech service for the 24 hour clock"
+msgid "It is %1:%2"
+msgstr "Sada je %1:%2"
+
+#: clockapplet.cpp:349
+msgctxt "General configuration page"
+msgid "General"
+msgstr "Opće"
+
+#: clockapplet.cpp:360
+msgid "Time Zones"
+msgstr "Vremenske zone"
+
+#: clockapplet.cpp:491
+msgid "C&opy to Clipboard"
+msgstr "Kopiraj u međuspremnik"
+
+#: clockapplet.cpp:499
+msgid "Adjust Date and Time..."
+msgstr "Uskladi datum i vrijeme…"
+
+#: clockapplet.cpp:658
+msgctxt "Local time zone"
+msgid "Local"
+msgstr "Lokalno"
+
+#: clockapplet.cpp:707
+msgctxt "@item:inmenu Submenu for alternative calendar dates"
+msgid "Other Calendars"
+msgstr "Drugi kalendari"
+
+#. i18n: file: calendarConfig.ui:33
+#. i18n: ectx: property (text), widget (QLabel, label_2)
+#. i18n: file: calendarHolidaysConfig.ui:33
+#. i18n: ectx: property (text), widget (QLabel, label_2)
+#: rc.cpp:3 rc.cpp:9
+msgid "Calendar system:"
+msgstr "Kalendarski sustav:"
+
+#. i18n: file: calendarConfig.ui:76
+#. i18n: ectx: property (text), widget (QLabel, label)
+#. i18n: file: calendarHolidaysConfig.ui:76
+#. i18n: ectx: property (text), widget (QLabel, label)
+#: rc.cpp:6 rc.cpp:12
+msgid "Display events:"
+msgstr "Prikaži događaje:"
+
+#. i18n: file: calendarHolidaysConfig.ui:119
+#. i18n: ectx: property (text), widget (QLabel, label_7)
+#: rc.cpp:15
+msgid "Holidays"
+msgstr "Praznici"
+
+#. i18n: file: generalConfig.ui:23
+#. i18n: ectx: property (text), widget (QLabel, label_4)
+#: rc.cpp:18
+msgid "Text to Speech"
+msgstr "Tekst u govor"
+
+#. i18n: file: generalConfig.ui:46
+#. i18n: ectx: property (text), widget (QLabel, label_5)
+#: rc.cpp:21
+msgid "Speak time:"
+msgstr "Izgovori vrijeme:"
+
+#. i18n: file: generalConfig.ui:61
+#. i18n: ectx: property (specialValueText), widget (KIntSpinBox, interval)
+#: rc.cpp:24
+msgid "Never"
+msgstr "Nikad"
+
+#. i18n: file: generalConfig.ui:64
+#. i18n: ectx: property (suffix), widget (KIntSpinBox, interval)
+#: rc.cpp:27
+msgid "th minute"
+msgstr "-u minutu"
+
+#. i18n: file: generalConfig.ui:67
+#. i18n: ectx: property (prefix), widget (KIntSpinBox, interval)
+#: rc.cpp:30
+msgid "Every "
+msgstr "Svaki"
+
+#. i18n: file: timezonesConfig.ui:20
+#. i18n: ectx: property (clickMessage), widget (KTreeWidgetSearchLine, searchLine)
+#: rc.cpp:33
+msgid "Search"
+msgstr "Traži"
+
+#. i18n: file: timezonesConfig.ui:33
+#. i18n: ectx: property (toolTip), widget (KTimeZoneWidget, timeZones)
+#: rc.cpp:36
+msgid "Select one or several time zones."
+msgstr "Označi jednu ili više vremenskih zona."
+
+#. i18n: file: timezonesConfig.ui:43
+#. i18n: ectx: property (whatsThis), widget (KTimeZoneWidget, timeZones)
+#: rc.cpp:39
+msgid ""
+"\n"
+" \n"
+"Your Local time and time zone are defined in System "
+"Settings, in the Date and Time tab. As default, your plasma clock will use "
+"this setting.
\n"
+"The plasma clock tooltip "
+"can display the time in several other time zones: to do so, select one or "
+"several more time zones in the list. Click on a line to select it and click "
+"on it again to deselect it.
\n"
+"After you validate your "
+"choices with the OK button, when your mouse is over the clock, a tooltip "
+"will display the time in all the selected time zones.
\n"
+"To select a Default time zone: you can either scroll over the "
+"clock with your mouse wheel and set the one you want or you can set it with "
+"\"Clock defaults to:\". .
"
+msgstr ""
+"\n"
+" \n"
+"Vaše lokalno vrijeme i vremenska zona su definirane u "
+"Postavkama sustava, u kartici Datum i vrijeme. Uobičajeno će plasma-sat "
+"koristiti te postavke.
\n"
+"Iskočna pomoć plasma-sata "
+"može prikazivati vrijeme iz nekoliko drugih vremenskih zona: da biste to "
+"postigli, odaberite jednu ili više vremenskih zona iz popisa. Kliknite na "
+"liniju za odabir iste i kliknite ponovo na nju da biste uklonili odabir "
+"iste.
\n"
+"Nakon što potvrdite svoj "
+"odabir gumbom 'U redu', svaki put kad se pokazivač miša nađe iznad sata, "
+"pojavit će se iskočna pomoć s prikazom vremena u odabranim vremenskim zonama."
+"
\n"
+"Za odabrati uobičajenu vremensku zonu: kotačićem miša možete "
+"klizati iznad sata i postaviti vremensku zonu koju želite ili je postaviti s "
+"\"Uobičajena vremenska zona:\".
"
+
+#. i18n: file: timezonesConfig.ui:73
+#. i18n: ectx: property (text), widget (QLabel, label)
+#: rc.cpp:49
+msgid "Clock defaults to:"
+msgstr "Uobičajena vremenska zona:"
+
+#. i18n: file: timezonesConfig.ui:89
+#. i18n: ectx: property (toolTip), widget (QComboBox, clockDefaultsTo)
+#: rc.cpp:52
+msgid "The time the clock will display"
+msgstr "Vrijeme koje će sat prikazivati"
+
+#. i18n: file: timezonesConfig.ui:93
+#. i18n: ectx: property (whatsThis), widget (QComboBox, clockDefaultsTo)
+#: rc.cpp:55
+msgid ""
+"The clock will display the time for the selected default zone.\n"
+"Local is the time you set in System Settings."
+msgstr ""
+"Sat će prikazivati vrijeme za odabranu uobičajenu vremensku zonu.\n"
+"Lokalno je vrijeme koje postavite u Postavkama Sustava."
+
+#~ msgid "Today"
+#~ msgstr "Danas"
+
+#~ msgctxt "Not day off: Holiday name (holiday region)"
+#~ msgid "Other : %1 (%2)"
+#~ msgstr "Drugo : %1 (%2)"
+
+#~ msgid "Do not show holidays"
+#~ msgstr "Ne prikazuj praznike"
+
+#~ msgid "Starting KTTSD Failed"
+#~ msgstr "Pokretanje KTTSD-a nije uspjelo"
+
+#~ msgid "Area"
+#~ msgstr "Područje"
+
+#~ msgid "Region"
+#~ msgstr "Regija"
+
+#~ msgid "Comment"
+#~ msgstr "Komentar"
+
+#~ msgid "Use holiday region:"
+#~ msgstr "Koristi blagdansku regiju:"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_battery.po kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_battery.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_battery.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_battery.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,214 @@
+# Translation of plasma_applet_battery to Croatian
+#
+# Andrej Dundović , 2009.
+# Andrej Dundovic , 2009, 2010.
+# Marko Dimjasevic , 2010, 2011.
+msgid ""
+msgstr ""
+"Project-Id-Version: plasma_applet_battery\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-02 05:39+0200\n"
+"PO-Revision-Date: 2011-02-15 16:36+0100\n"
+"Last-Translator: Marko Dimjasevic \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"X-Generator: Lokalize 1.2\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: battery.cpp:199
+msgid "Battery: "
+msgstr "Baterija: "
+
+#: battery.cpp:206
+#, kde-format
+msgctxt "tooltip: placeholder is the battery ID"
+msgid "Battery %1: "
+msgstr "Baterija %1: "
+
+#: battery.cpp:217
+msgctxt "tooltip"
+msgid "AC Adapter: "
+msgstr "AC adapter: "
+
+#: battery.cpp:218
+msgctxt "tooltip"
+msgid "Plugged in"
+msgstr "Priključen"
+
+#: battery.cpp:218
+msgctxt "tooltip"
+msgid "Not plugged in"
+msgstr "Nije priključen"
+
+#: battery.cpp:354
+msgid "General"
+msgstr "Općenito"
+
+#: battery.cpp:536
+msgctxt "Label for remaining time"
+msgid "Time Remaining:"
+msgstr "Preostalo vrijeme:"
+
+#: battery.cpp:556
+msgid "Power Profile:"
+msgstr "Energetski profil:"
+
+#: battery.cpp:571
+msgid "Screen Brightness:"
+msgstr "Osvjetljenje zaslona:"
+
+#: battery.cpp:598
+msgctxt "Suspend the computer to RAM; translation should be short"
+msgid "Sleep"
+msgstr "Spavaj"
+
+#: battery.cpp:605
+msgctxt "Suspend the computer to disk; translation should be short"
+msgid "Hibernate"
+msgstr "Hiberniraj"
+
+#: battery.cpp:614
+msgctxt "tooltip on the config button in the popup"
+msgid "Configure Power Management..."
+msgstr "Podešavanje upravitelja potrošnje energije…"
+
+#: battery.cpp:616
+msgid "Power Settings"
+msgstr "Postavke potrošnje energije"
+
+#: battery.cpp:672
+#, kde-format
+msgid "%1% (charged)"
+msgstr "%1% (napunjena)"
+
+#: battery.cpp:674
+#, kde-format
+msgid "%1% (discharging)"
+msgstr "%1% (pražnjenje)"
+
+#: battery.cpp:676
+#, kde-format
+msgid "%1% (charging)"
+msgstr "%1% (punjenje)"
+
+#: battery.cpp:680
+msgctxt "Battery is not plugged in"
+msgid "Not present"
+msgstr "Nije prisutna"
+
+#: battery.cpp:696 battery.cpp:729
+msgid "Battery:"
+msgstr "Baterija:"
+
+#: battery.cpp:703
+#, kde-format
+msgctxt "Placeholder is the battery ID"
+msgid "Battery %1:"
+msgstr "Baterija %1:"
+
+#: battery.cpp:710
+msgid "AC Adapter:"
+msgstr "AC adapter:"
+
+#: battery.cpp:712
+msgid "Plugged in "
+msgstr "Priključen "
+
+#: battery.cpp:714
+msgid "Not plugged in "
+msgstr "Nije priključen "
+
+#: battery.cpp:730
+msgctxt "Battery is not plugged in"
+msgid "Not present "
+msgstr "Nije prisutna "
+
+#: battery.cpp:988 battery.cpp:1019 battery.cpp:1031
+#, kde-format
+msgctxt "overlay on the battery, needs to be really tiny"
+msgid "%1%"
+msgstr "%1%"
+
+#. i18n: file: batteryConfig.ui:14
+#. i18n: ectx: property (windowTitle), widget (QWidget, batteryConfig)
+#: rc.cpp:3
+msgid "Configure Battery Monitor"
+msgstr "Podesi nadzornika baterije"
+
+#. i18n: file: batteryConfig.ui:23
+#. i18n: ectx: property (text), widget (QCheckBox, showBatteryStringCheckBox)
+#: rc.cpp:6
+msgid "Show charge &information"
+msgstr "Pokaži &informaciju o punjenju"
+
+#. i18n: file: batteryConfig.ui:33
+#. i18n: ectx: property (text), widget (QCheckBox, showMultipleBatteriesCheckBox)
+#: rc.cpp:9
+msgid "Show the state for &each battery present"
+msgstr "Pokaži stanj&e za svaku prisutnu bateriju"
+
+#~ msgid "AC Adapter: "
+#~ msgstr "AC adapter: "
+
+#~ msgid "Power Management"
+#~ msgstr "Upravljanje potrošnjom energije"
+
+#~ msgid "Battery: "
+#~ msgstr "Baterija: "
+
+#~ msgid "Screen Brightness"
+#~ msgstr "Osvjetljenje zaslona"
+
+#~ msgctxt "Shown when a time estimate is not available"
+#~ msgid "%1% (discharging)"
+#~ msgstr "%1% (pražnjenje)"
+
+#~ msgctxt "state of battery"
+#~ msgid "%1% (charged)"
+#~ msgstr "%1% (napunjena)"
+
+#~ msgctxt "state of battery"
+#~ msgid "%1% (discharging)"
+#~ msgstr "%1% (pražnjenje)"
+
+#~ msgctxt "state of battery"
+#~ msgid "%1% (charging)"
+#~ msgstr "%1% (punjenje)"
+
+#~ msgid "%2% (discharging)"
+#~ msgstr "%2% (pražnjenje)"
+
+#~ msgid "%2% (charging)"
+#~ msgstr "%2% (punjenje)"
+
+#~ msgid "Configure..."
+#~ msgstr "Podesi …"
+
+#~ msgid "Actions"
+#~ msgstr "Radnje"
+
+#~ msgid "%1% (fully charged)"
+#~ msgstr "%1% (potpuno napunjen)"
+
+#~ msgctxt "Shown when a time estimate is not available"
+#~ msgid "Battery: %1% (discharging) "
+#~ msgstr "Baterija: %1% (prazni se) "
+
+#~ msgid "Battery: %1% (charging) "
+#~ msgstr "Baterija: %1% (puni se) "
+
+#~ msgid "Battery %1: %2% (fully charged) "
+#~ msgstr "Baterija %1: %2% (potpuno puna) "
+
+#~ msgid "Battery %1: %2% (discharging) "
+#~ msgstr "Baterija %1: %2% (prazni se) "
+
+#~ msgid "AC Adapter: Not plugged in"
+#~ msgstr "Punjač: Nije priključen"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_clock.po kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_clock.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_clock.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_clock.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,60 @@
+# Translation of plasma_applet_clock to Croatian
+#
+msgid ""
+msgstr ""
+"Project-Id-Version: plasma_applet_clock\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-02 05:39+0200\n"
+"PO-Revision-Date: 2009-08-18 08:53+0200\n"
+"Last-Translator: \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"X-Generator: Lokalize 0.3\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: clock.cpp:185
+msgid "Appearance"
+msgstr "Izgled"
+
+#. i18n: file: clockConfig.ui:22
+#. i18n: ectx: property (toolTip), widget (QCheckBox, showSecondHandCheckBox)
+#: rc.cpp:3
+msgid "Show the seconds"
+msgstr "Pokaži sekunde"
+
+#. i18n: file: clockConfig.ui:25
+#. i18n: ectx: property (whatsThis), widget (QCheckBox, showSecondHandCheckBox)
+#: rc.cpp:6
+msgid "Check this if you want to show the seconds."
+msgstr "Uključite ovo ako želite vidjeti sekunde."
+
+#. i18n: file: clockConfig.ui:28
+#. i18n: ectx: property (text), widget (QCheckBox, showSecondHandCheckBox)
+#: rc.cpp:9
+msgid "Show &seconds hand"
+msgstr "Pokaži kazaljku &sekundi"
+
+#. i18n: file: clockConfig.ui:35
+#. i18n: ectx: property (toolTip), widget (QCheckBox, showTimezoneStringCheckBox)
+#: rc.cpp:12
+msgid "Show the Timezone in text"
+msgstr "Pokaži vremensku zonu u tekstu"
+
+#. i18n: file: clockConfig.ui:38
+#. i18n: ectx: property (whatsThis), widget (QCheckBox, showTimezoneStringCheckBox)
+#: rc.cpp:15
+msgid "Check this if you want to display Timezone in text."
+msgstr "Uključite ovo ako želite vidjeti vremensku zonu u tekstu"
+
+#. i18n: file: clockConfig.ui:41
+#. i18n: ectx: property (text), widget (QCheckBox, showTimezoneStringCheckBox)
+#: rc.cpp:18
+msgid "Show &time zone"
+msgstr "Pokaži &vremensku zonu"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_currentappcontrol.po kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_currentappcontrol.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_currentappcontrol.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_currentappcontrol.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,50 @@
+# Translation of plasma_applet_currentappcontrol to Croatian
+#
+# Zarko Pintar , 2009.
+# Andrej Dundovic , 2009, 2010.
+msgid ""
+msgstr ""
+"Project-Id-Version: \n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-02 05:40+0200\n"
+"PO-Revision-Date: 2010-05-25 10:43+0200\n"
+"Last-Translator: Andrej Dundovic \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 1.0\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: currentappcontrol.cpp:191
+msgid "Click here to have an overview of all the running applications"
+msgstr ""
+"Kliknite ovdje kako bi ste dobili pregled nad svim pokrenutim aplikacijama"
+
+#: currentappcontrol.cpp:198
+#, kde-format
+msgid "%1 running app"
+msgid_plural "%1 running apps"
+msgstr[0] "%1 pokrenuta aplikacija"
+msgstr[1] "%1 pokrenute aplikacije"
+msgstr[2] "%1 pokrenutih aplikacija"
+
+#: currentappcontrol.cpp:200
+msgid "No running apps"
+msgstr "Nema pokrenutih aplikacija"
+
+#: currentappcontrol.cpp:383
+msgctxt "General configuration page"
+msgid "General"
+msgstr "Općenito"
+
+#. i18n: file: general.ui:17
+#. i18n: ectx: property (text), widget (QLabel, label)
+#: rc.cpp:3
+msgid "Always list the applications in a menu"
+msgstr "Uvijek izlistaj aplikacije u izborniku"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_dig_clock.po kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_dig_clock.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_dig_clock.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_dig_clock.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,268 @@
+# Translation of plasma_applet_dig_clock to Croatian
+#
+# Marko Dimjasevic , 2010, 2011.
+msgid ""
+msgstr ""
+"Project-Id-Version: plasma_applet_dig_clock\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-02 05:39+0200\n"
+"PO-Revision-Date: 2011-02-15 16:38+0100\n"
+"Last-Translator: Marko Dimjasevic \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"X-Generator: Lokalize 1.2\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: clock.cpp:253
+msgid "Appearance"
+msgstr "Izgled"
+
+#: clock.cpp:268
+msgctxt "A kind of date representation"
+msgid "No date"
+msgstr "Bez datuma"
+
+#: clock.cpp:269
+msgctxt "A kind of date representation"
+msgid "Compact date"
+msgstr "Skraćeni datum"
+
+#: clock.cpp:270
+msgctxt "A kind of date representation"
+msgid "Short date"
+msgstr "Kratki datum"
+
+#: clock.cpp:271
+msgctxt "A kind of date representation"
+msgid "Long date"
+msgstr "Dugački datum"
+
+#: clock.cpp:272
+msgctxt "A kind of date representation"
+msgid "ISO date"
+msgstr "ISO datum"
+
+#: clock.cpp:470
+#, kde-format
+msgctxt "@label Compact date: %1 day in the month, %2 month number"
+msgid "%1/%2"
+msgstr "%1/%2"
+
+#: clock.cpp:485
+#, kde-format
+msgctxt ""
+"@label Date with currentTimezone: %1 day of the week with date, %2 "
+"currentTimezone"
+msgid "%1 %2"
+msgstr "%1 %2"
+
+#. i18n: file: clockConfig.ui:26
+#. i18n: ectx: property (text), widget (QLabel, label_6)
+#: rc.cpp:3
+msgid "Font"
+msgstr "Pismo"
+
+#. i18n: file: clockConfig.ui:33
+#. i18n: ectx: property (text), widget (QLabel, label)
+#: rc.cpp:6
+msgid "Font style:"
+msgstr "Stil pisma:"
+
+#. i18n: file: clockConfig.ui:69
+#. i18n: ectx: property (toolTip), widget (QCheckBox, plainClockFontBold)
+#: rc.cpp:9
+msgid "Check if you want the font in bold"
+msgstr "Uključite ako želite podebljano pismo"
+
+#. i18n: file: clockConfig.ui:72
+#. i18n: ectx: property (whatsThis), widget (QCheckBox, plainClockFontBold)
+#: rc.cpp:12
+msgid "When this is checked, the clock font will be bold."
+msgstr "Kada je uključeno, pismo sata biti će podebljano."
+
+#. i18n: file: clockConfig.ui:75
+#. i18n: ectx: property (text), widget (QCheckBox, plainClockFontBold)
+#: rc.cpp:15
+msgid "&Bold"
+msgstr "Pode&bljano"
+
+#. i18n: file: clockConfig.ui:82
+#. i18n: ectx: property (toolTip), widget (QCheckBox, plainClockFontItalic)
+#: rc.cpp:18
+msgid "Check if you want the font in italic"
+msgstr "Uključite ako želite kurziv pismo"
+
+#. i18n: file: clockConfig.ui:85
+#. i18n: ectx: property (whatsThis), widget (QCheckBox, plainClockFontItalic)
+#: rc.cpp:21
+msgid "When this is checked, the clock font will be in italic."
+msgstr "Kada je uključeno, pismo sata biti će u kurzivu."
+
+#. i18n: file: clockConfig.ui:88
+#. i18n: ectx: property (text), widget (QCheckBox, plainClockFontItalic)
+#: rc.cpp:24
+msgid "&Italic"
+msgstr "Kurz&iv"
+
+#. i18n: file: clockConfig.ui:111
+#. i18n: ectx: property (text), widget (QLabel, label_2)
+#: rc.cpp:27
+msgid "Custom font color:"
+msgstr "Prilagođene boje pisma:"
+
+#. i18n: file: clockConfig.ui:136
+#. i18n: ectx: property (toolTip), widget (KColorButton, plainClockColor)
+#: rc.cpp:30
+msgid "Color chooser"
+msgstr "Izbornik boje"
+
+#. i18n: file: clockConfig.ui:139
+#. i18n: ectx: property (whatsThis), widget (KColorButton, plainClockColor)
+#: rc.cpp:33
+msgid ""
+"Click on this button and the KDE standard color dialog will show. You can "
+"then choose the new color you want for your clock."
+msgstr ""
+"Kliknite na ovaj gumb i prikazati će se KDE-ov standardni dijalog za boju. "
+"Tada možete odabrati novu boju za vaš sat."
+
+#. i18n: file: clockConfig.ui:161
+#. i18n: ectx: property (text), widget (QLabel, label_9)
+#: rc.cpp:36
+msgid "Show shadow:"
+msgstr "Prikaži sjenu:"
+
+#. i18n: file: clockConfig.ui:198
+#. i18n: ectx: property (text), widget (QLabel, customShadowColorLabel)
+#: rc.cpp:39
+msgid "Custom shadow color:"
+msgstr "Prilagođena boja sjene:"
+
+#. i18n: file: clockConfig.ui:216
+#. i18n: ectx: property (toolTip), widget (KColorButton, plainClockShadowColor)
+#: rc.cpp:42
+msgid "Shadow color chooser"
+msgstr "Izbornik boje sjene"
+
+#. i18n: file: clockConfig.ui:219
+#. i18n: ectx: property (whatsThis), widget (KColorButton, plainClockShadowColor)
+#: rc.cpp:45
+msgid ""
+"Click on this button and the KDE standard color dialog will show. You can "
+"then choose the new color you want for the text shadow for your clock."
+msgstr ""
+"Kliknite na ovaj gumb i prikazati će se KDE-ov standardni dijalog za boju. "
+"Tada možete odabrati novu boju za sjenu teksta za Vaš sat."
+
+#. i18n: file: clockConfig.ui:257
+#. i18n: ectx: property (text), widget (QLabel, label_7)
+#: rc.cpp:48
+msgid "Information"
+msgstr "Informacija"
+
+#. i18n: file: clockConfig.ui:264
+#. i18n: ectx: property (text), widget (QLabel, label_4)
+#: rc.cpp:51
+msgid "Show time zone:"
+msgstr "Prikaži vremensku zonu:"
+
+#. i18n: file: clockConfig.ui:279
+#. i18n: ectx: property (toolTip), widget (QCheckBox, showTimeZone)
+#: rc.cpp:54
+msgid "Display the time zone name"
+msgstr "Prikaži ime vremenske zone"
+
+#. i18n: file: clockConfig.ui:282
+#. i18n: ectx: property (whatsThis), widget (QCheckBox, showTimeZone)
+#: rc.cpp:57
+msgid "Display the time zone name under the time."
+msgstr "Prikaži ime vremenske zone unutar vremena."
+
+#. i18n: file: clockConfig.ui:307
+#. i18n: ectx: property (text), widget (QLabel, label_5)
+#: rc.cpp:60
+msgid "Show seconds:"
+msgstr "Prikaži sekunde:"
+
+#. i18n: file: clockConfig.ui:322
+#. i18n: ectx: property (toolTip), widget (QCheckBox, secondsCheckbox)
+#: rc.cpp:63
+msgid "Show the seconds"
+msgstr "Prikaži sekunde"
+
+#. i18n: file: clockConfig.ui:325
+#. i18n: ectx: property (whatsThis), widget (QCheckBox, secondsCheckbox)
+#: rc.cpp:66
+msgid "Check this if you want to show the seconds."
+msgstr "Uključite ovo ako želite vidjeti sekunde."
+
+#. i18n: file: clockConfig.ui:350
+#. i18n: ectx: property (text), widget (QLabel, label_3)
+#: rc.cpp:69
+msgid "Date format:"
+msgstr "Format datuma:"
+
+#~ msgid "&Configure KDE date formats"
+#~ msgstr "&Podesi KDE-ove formate datuma"
+
+#~ msgctxt ""
+#~ "@label Short date: %1 day in the month, %2 short month name, %3 year"
+#~ msgid "%1 %2 %3"
+#~ msgstr "%1 %2 %3"
+
+#~ msgctxt "@label Day of the week with date: %1 short day name, %2 short date"
+#~ msgid "%1, %2"
+#~ msgstr "%1, %2"
+
+#~ msgid "Display the date of the day"
+#~ msgstr "Prikaži datum"
+
+#, fuzzy
+#~| msgid "Show day of the &week"
+#~ msgid "Include the day of the week:"
+#~ msgstr "Prikaži dan u &tjednu"
+
+#~ msgid "Display day of the week"
+#~ msgstr "Prikaži dan u tjednu"
+
+#~ msgid "Add the day of the week to the date display."
+#~ msgstr "Dodaj dan u tjednu u prikaz datuma."
+
+#~ msgid "Display the current year"
+#~ msgstr "Prikaži trenutnu godinu."
+
+#~ msgid "Add the year to the date string."
+#~ msgstr "Dodaj godinu u tekst datuma."
+
+#~ msgid "Show &year"
+#~ msgstr "Prikaži &godinu"
+
+#~ msgid "Use current desktop theme color"
+#~ msgstr "Koristi trenutnu boju iz teme radne površine"
+
+#~ msgid ""
+#~ "This is default. The clock will get its font color from the current "
+#~ "desktop theme."
+#~ msgstr ""
+#~ "Ovo je uobičajeno. Sat će dobiti boju pisma iz trenutne teme radne "
+#~ "površine."
+
+#~ msgid "Use theme color"
+#~ msgstr "Koristi boju iz teme"
+
+#~ msgid "Choose your own font color"
+#~ msgstr "Izaberite vlastitu boju pisma"
+
+#~ msgid ""
+#~ "When checked you can choose a custom color for the clock font by clicking "
+#~ "on the color widget on the right."
+#~ msgstr ""
+#~ "Kada je uključeno možete birati željenu boju za pismo sata klikajući na "
+#~ "desni widget boje."
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_icon.po kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_icon.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_icon.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_icon.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,49 @@
+# Translation of plasma_applet_icon to Croatian
+#
+# Marko Dimjasevic , 2009.
+msgid ""
+msgstr ""
+"Project-Id-Version: plasma_applet_icon\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-02 05:39+0200\n"
+"PO-Revision-Date: 2009-10-17 22:48+0200\n"
+"Last-Translator: Marko Dimjasevic \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"X-Generator: Lokalize 1.0\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: icon.cpp:282
+#, kde-format
+msgid "%1 Icon Settings"
+msgstr "Postavke ikona %1|/|Postavke ikona $[gen %1]"
+
+#: icon.cpp:444
+#, kde-format
+msgctxt "@action:inmenu"
+msgid "&Move Here\t%1 "
+msgstr "Po&makni ovdje\t%1 "
+
+#: icon.cpp:450
+#, kde-format
+msgctxt "@action:inmenu"
+msgid "&Copy Here\t%1 "
+msgstr "&Kopiraj ovdje\t%1 "
+
+#: icon.cpp:456
+#, kde-format
+msgctxt "@action:inmenu"
+msgid "&Link Here\t%1 "
+msgstr "&Poveži ovdje\t%1 "
+
+#: icon.cpp:459
+msgctxt "@action:inmenu"
+msgid "Cancel"
+msgstr "Prekini"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_launcher.po kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_launcher.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_launcher.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_launcher.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,407 @@
+# Translation of plasma_applet_launcher to Croatian
+#
+# DoDo , 2009.
+# Andrej Dundović , 2009.
+# Andrej Dundovic , 2009, 2010.
+# Marko Dimjasevic , 2010.
+# Marko Dimjašević , 2011.
+msgid ""
+msgstr ""
+"Project-Id-Version: plasma_applet_launcher\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-09-08 04:08+0200\n"
+"PO-Revision-Date: 2011-07-12 18:00+0200\n"
+"Last-Translator: Marko Dimjašević \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"X-Generator: Lokalize 1.2\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: applet/applet.cpp:84
+msgid "Kickoff Application Launcher"
+msgstr "Pokretač aplikacija Kickoff"
+
+#: applet/applet.cpp:85
+msgid ""
+"Favorites, applications, computer places, recently used items and desktop "
+"sessions"
+msgstr ""
+"Omiljeno, aplikacije, mjesta na računalu, nedavno korištene stvari i "
+"sjednice radne površine"
+
+#: applet/applet.cpp:108 simpleapplet/simpleapplet.cpp:340
+msgid "Edit Applications..."
+msgstr "Izmijeni aplikacije…"
+
+#: applet/applet.cpp:114
+msgid "Switch to Classic Menu Style"
+msgstr "Prebaci stil izbornika na klasični"
+
+#: applet/applet.cpp:159
+msgctxt "General configuration page"
+msgid "General"
+msgstr "Opće"
+
+#: core/applicationmodel.cpp:335
+msgid "Games"
+msgstr "Igre"
+
+#: core/applicationmodel.cpp:429 ui/launcher.cpp:975
+msgid "All Applications"
+msgstr "Sve aplikacije"
+
+#: core/favoritesmodel.cpp:49 core/favoritesmodel.cpp:322
+#: simpleapplet/simpleapplet.cpp:193 ui/launcher.cpp:121 ui/launcher.cpp:191
+msgid "Favorites"
+msgstr "Omiljeno"
+
+#: core/leavemodel.cpp:49 simpleapplet/simpleapplet.cpp:210
+msgid "Log out"
+msgstr "Odjavi se"
+
+#: core/leavemodel.cpp:51
+msgid "End session"
+msgstr "Kraj sjednice"
+
+#: core/leavemodel.cpp:53
+msgid "Lock"
+msgstr "Zaključaj"
+
+#: core/leavemodel.cpp:55
+msgid "Lock screen"
+msgstr "Zaključaj zaslon"
+
+#: core/leavemodel.cpp:57
+msgid "Switch user"
+msgstr "Zamijeni korisnika"
+
+#: core/leavemodel.cpp:59
+msgid "Start a parallel session as a different user"
+msgstr "Pokreni paralelnu sjednicu kao drugi korisnik"
+
+#: core/leavemodel.cpp:61 simpleapplet/simpleapplet.cpp:209
+msgid "Shut down"
+msgstr "Isključi"
+
+#: core/leavemodel.cpp:63
+msgid "Turn off computer"
+msgstr "Ugasi računalo"
+
+#: core/leavemodel.cpp:65
+msgctxt "Restart computer"
+msgid "Restart"
+msgstr "Ponovo pokreni"
+
+#: core/leavemodel.cpp:67
+msgid "Restart computer"
+msgstr "Ponovo pokreni računalo"
+
+#: core/leavemodel.cpp:69 simpleapplet/simpleapplet.cpp:203
+msgid "Save Session"
+msgstr "Spremi sjednicu"
+
+#: core/leavemodel.cpp:71
+msgid "Save current session for next login"
+msgstr "Spremi trenutnu sjednicu za sljedeću prijavu"
+
+#: core/leavemodel.cpp:73 simpleapplet/simpleapplet.cpp:205
+msgctxt "Puts the system on standby"
+msgid "Standby"
+msgstr "Spavaj"
+
+#: core/leavemodel.cpp:75
+msgid "Pause without logging out"
+msgstr "Pauziraj bez odjave"
+
+#: core/leavemodel.cpp:77 simpleapplet/simpleapplet.cpp:206
+msgid "Hibernate"
+msgstr "Hiberniraj"
+
+#: core/leavemodel.cpp:79
+msgid "Suspend to disk"
+msgstr "Obustavi na disk"
+
+#: core/leavemodel.cpp:81 simpleapplet/simpleapplet.cpp:207
+msgid "Sleep"
+msgstr "Spavanje"
+
+#: core/leavemodel.cpp:83
+msgid "Suspend to RAM"
+msgstr "Spavaj"
+
+#: core/leavemodel.cpp:106 simpleapplet/simpleapplet.cpp:211
+#: ui/launcher.cpp:179
+msgid "Leave"
+msgstr "Napusti"
+
+#: core/leavemodel.cpp:118
+msgid "Session"
+msgstr "Sjednica"
+
+#: core/leavemodel.cpp:146
+msgid "System"
+msgstr "Sustav"
+
+#: core/models.cpp:121
+msgid "Home Folder"
+msgstr "Osobna mapa"
+
+#: core/models.cpp:124
+msgid "Network Folders"
+msgstr "Mrežne mape"
+
+#: core/recentlyusedmodel.cpp:109
+msgid "Documents"
+msgstr "Dokumenti"
+
+#: core/recentlyusedmodel.cpp:120 core/systemmodel.cpp:84
+#: simpleapplet/simpleapplet.cpp:195 ui/launcher.cpp:123 ui/launcher.cpp:236
+msgid "Applications"
+msgstr "Aplikacije"
+
+#: core/recentlyusedmodel.cpp:186 simpleapplet/simpleapplet.cpp:197
+#: ui/launcher.cpp:124 ui/launcher.cpp:249
+msgid "Recently Used"
+msgstr "Nedavno korišteno"
+
+#: core/recentlyusedmodel.cpp:188 simpleapplet/simpleapplet.cpp:199
+msgid "Recently Used Documents"
+msgstr "Nedavno korišteni dokumenti"
+
+#: core/recentlyusedmodel.cpp:190 simpleapplet/simpleapplet.cpp:198
+msgid "Recently Used Applications"
+msgstr "Nedavno korištene aplikacije"
+
+#: core/systemmodel.cpp:85
+msgid "Places"
+msgstr "Mjesta"
+
+#: core/systemmodel.cpp:86
+msgid "Removable Storage"
+msgstr "Prijenosna spremišta"
+
+#: core/systemmodel.cpp:87
+msgid "Storage"
+msgstr "Spremišta"
+
+#: core/systemmodel.cpp:215 simpleapplet/simpleapplet.cpp:201
+msgid "Run Command..."
+msgstr "Pokreni naredbu …"
+
+#: core/systemmodel.cpp:219
+msgid "Run a command or a search query"
+msgstr "Izvrši naredbu ili traži"
+
+#: core/systemmodel.cpp:327 simpleapplet/simpleapplet.cpp:196
+#: ui/launcher.cpp:123 ui/launcher.cpp:270
+msgid "Computer"
+msgstr "Računalo"
+
+#: main.cpp:32
+msgid "Kickoff"
+msgstr "Kickoff"
+
+#: main.cpp:33
+msgid "Application Launcher"
+msgstr "Pokretač aplikacija"
+
+#: simpleapplet/simpleapplet.cpp:194
+msgid "Bookmarks"
+msgstr "Oznake"
+
+#: simpleapplet/simpleapplet.cpp:200
+msgid "System Settings"
+msgstr "Postavke sustava"
+
+#: simpleapplet/simpleapplet.cpp:202
+msgid "Switch User"
+msgstr "Promijeni korisnika"
+
+#: simpleapplet/simpleapplet.cpp:204
+msgid "Lock Screen"
+msgstr "Zaključaj zaslon"
+
+#: simpleapplet/simpleapplet.cpp:208
+msgctxt "Restart Computer"
+msgid "Restart"
+msgstr "Ponovo pokreni"
+
+#: simpleapplet/simpleapplet.cpp:267
+msgid "Application Launcher Menu"
+msgstr "Izbornik pokretača aplikacija"
+
+#: simpleapplet/simpleapplet.cpp:346
+msgid "Switch to Application Launcher Style"
+msgstr "Prebaci se na stil Pokretač aplikacija"
+
+#: simpleapplet/simpleapplet.cpp:445
+msgid "View"
+msgstr "Pogled"
+
+#: simpleapplet/simpleapplet.cpp:452
+msgid "Icon:"
+msgstr "Ikona:"
+
+#: simpleapplet/simpleapplet.cpp:459
+msgctxt "@label:listbox How to present applications in a KMenu-like menu"
+msgid "Format:"
+msgstr "Format:"
+
+#: simpleapplet/simpleapplet.cpp:463
+msgctxt "@item:inlistbox Format:"
+msgid "Name Only"
+msgstr "Samo ime"
+
+#: simpleapplet/simpleapplet.cpp:464
+msgctxt "@item:inlistbox Format:"
+msgid "Description Only"
+msgstr "Samo opis"
+
+#: simpleapplet/simpleapplet.cpp:465
+#, fuzzy
+#| msgctxt "@item:inlistbox Format:"
+#| msgid "Name Description"
+msgctxt "@item:inlistbox Format:"
+msgid "Name (Description)"
+msgstr "Ime Opis"
+
+#: simpleapplet/simpleapplet.cpp:466
+msgctxt "@item:inlistbox Format:"
+msgid "Description (Name)"
+msgstr "Opis (Ime)"
+
+#: simpleapplet/simpleapplet.cpp:467
+msgctxt "@item:inlistbox Format:"
+msgid "Name - Description"
+msgstr "Ime – Opis"
+
+#: simpleapplet/simpleapplet.cpp:472
+msgid "Recently used applications:"
+msgstr "Nedavno korištene aplikacije:"
+
+#: simpleapplet/simpleapplet.cpp:482
+msgid "Show menu titles:"
+msgstr "Prikaži naslove izbornika:"
+
+#: simpleapplet/simpleapplet.cpp:489
+msgid "Options"
+msgstr "Opcije"
+
+#: simpleapplet/simpleapplet.cpp:626
+msgid "Actions"
+msgstr "Akcije"
+
+#: ui/contextmenufactory.cpp:85
+msgid "Advanced"
+msgstr "Napredno"
+
+#: ui/contextmenufactory.cpp:178
+msgid "Remove From Favorites"
+msgstr "Ukloni iz omiljenog"
+
+#: ui/contextmenufactory.cpp:183
+msgid "Add to Favorites"
+msgstr "Dodaj u omiljeno"
+
+#: ui/contextmenufactory.cpp:215
+msgid "Add to Desktop"
+msgstr "Dodaj na radnu površinu"
+
+#: ui/contextmenufactory.cpp:223
+msgid "Add to Panel"
+msgstr "Dodaj na panel"
+
+#: ui/contextmenufactory.cpp:236
+msgid "Uninstall"
+msgstr "Ukloni"
+
+#: ui/contextmenufactory.cpp:261
+msgid "Eject"
+msgstr "Izbaci"
+
+#: ui/contextmenufactory.cpp:263
+msgid "Safely Remove"
+msgstr "Sigurno ukloni"
+
+#: ui/launcher.cpp:194
+msgid "Sort Alphabetically (A to Z)"
+msgstr "Sortiraj abecednim redom (od A do Z)"
+
+#: ui/launcher.cpp:197
+msgid "Sort Alphabetically (Z to A)"
+msgstr "Sortiraj abecednim redom (od Z do A)"
+
+#: ui/launcher.cpp:251
+msgid "Clear Recent Applications"
+msgstr "Očisti popis nedavno korištenih aplikacija"
+
+#: ui/launcher.cpp:252
+msgid "Clear Recent Documents"
+msgstr "Počisti popis nedavno korištenih dokumenata"
+
+#: ui/launcher.cpp:560
+#, kde-format
+msgctxt "login name, hostname"
+msgid "User %1 on %2 "
+msgstr "Korisnik %1 na %2 "
+
+#: ui/launcher.cpp:562
+#, kde-format
+msgctxt "full name, login name, hostname"
+msgid "%1 (%2) on %3 "
+msgstr "%1 (%2) na %3 "
+
+#: ui/searchbar.cpp:70
+msgctxt "Label of the search bar textedit"
+msgid "Search:"
+msgstr "Tražilica:"
+
+#: rc.cpp:1
+msgctxt "NAME OF TRANSLATORS"
+msgid "Your names"
+msgstr "Žarko Pintar, Nenad Mikša"
+
+#: rc.cpp:2
+msgctxt "EMAIL OF TRANSLATORS"
+msgid "Your emails"
+msgstr "zarko.pintar@gmail.com, DoDoEntertainment@gmail.com"
+
+#. i18n: file: applet/kickoffConfig.ui:27
+#. i18n: ectx: property (text), widget (QLabel, label_3)
+#: rc.cpp:5
+msgid "Show applications by &name:"
+msgstr "Prikaži aplikacije po ime&nu:"
+
+#. i18n: file: applet/kickoffConfig.ui:73
+#. i18n: ectx: property (text), widget (QLabel, iconLabel)
+#: rc.cpp:8
+msgid "&Icon:"
+msgstr "&Ikona:"
+
+#. i18n: file: applet/kickoffConfig.ui:86
+#. i18n: ectx: property (text), widget (QLabel, label_2)
+#: rc.cpp:11
+msgid "Switch &tabs on hover:"
+msgstr "Prebacuj kar&tice prilikom prijelaza mišem"
+
+#~ msgid "Switch to Kickoff Menu Style"
+#~ msgstr "Prebaci stil izbornika na Kickoff"
+
+#~ msgid "Menu Editor"
+#~ msgstr "Uređivanje izbornika"
+
+#~ msgid "run:/"
+#~ msgstr "pokreni:/"
+
+#~ msgid "Web Searches"
+#~ msgstr "Web pretrage"
+
+#~ msgid "Search web for '%1'"
+#~ msgstr "Traži '%1' na webu"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_netpanel.po kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_netpanel.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_netpanel.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_netpanel.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,29 @@
+# Translation of plasma_applet_netpanel to Croatian
+#
+# Andrej Dundovic , 2009.
+msgid ""
+msgstr ""
+"Project-Id-Version: \n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-02 05:40+0200\n"
+"PO-Revision-Date: 2009-11-01 00:10+0100\n"
+"Last-Translator: Andrej Dundovic \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"X-Generator: Lokalize 1.0\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: panel.cpp:88 panel.cpp:353
+msgid "Lock Panel"
+msgstr "Zaključaj panel"
+
+#: panel.cpp:346
+msgid "Unlock Panel"
+msgstr "Otključaj panel"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_notifier.po kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_notifier.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_notifier.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_notifier.po 2011-11-03 15:03:57.000000000 +0000
@@ -0,0 +1,201 @@
+# Translation of plasma_applet_devicenotifier to Croatian
+#
+# DoDo , 2009.
+# Andrej Dundović , 2009.
+# Andrej Dundovic , 2009, 2010.
+# Marko Dimjasevic , 2011.
+# Marko Dimjašević , 2011.
+msgid ""
+msgstr ""
+"Project-Id-Version: plasma_applet_devicenotifier\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-02 05:39+0200\n"
+"PO-Revision-Date: 2011-04-07 10:09+0200\n"
+"Last-Translator: Marko Dimjašević \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Language: hr\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"X-Generator: Lokalize 1.2\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: deviceitem.cpp:292
+msgid "Click to eject this disc."
+msgstr "Kliknite kako biste izbacili ovaj disk."
+
+#: deviceitem.cpp:295
+msgid "Click to safely remove this device."
+msgstr "Kliknite kako biste sigurno uklonili ovaj uređaj."
+
+#: deviceitem.cpp:297
+msgid "Click to unmount this device."
+msgstr "Kliknite kako biste uklonili ovaj uređaj."
+
+#: deviceitem.cpp:301
+msgid ""
+"It is currently not safe to remove this device: applications may be "
+"accessing it. Click the eject button to safely remove this device."
+msgstr ""
+"Trenutno nije sigurno ukloniti ovaj uređaj: možda mu pristupaju "
+"aplikacije. Kliknite na gumb izbaci kako biste sigurno uklonili ovaj uređaj."
+
+#: deviceitem.cpp:303
+msgid "This device is currently accessible."
+msgstr "Ovaj je uređaj trenutno dostupan."
+
+#: deviceitem.cpp:306
+msgid "Click to access this device from other applications."
+msgstr "Kliknite kako biste pristupili ovom uređaju iz drugih aplikacija."
+
+#: deviceitem.cpp:309
+msgid "It is currently safe to remove this device."
+msgstr "Sada je sigurno ukloniti ovaj uređaj."
+
+#: deviceitem.cpp:311
+msgid ""
+"It is currently not safe to remove this device: applications may be "
+"accessing other volumes on this device. Click the eject button on these "
+"other volumes to safely remove this device."
+msgstr ""
+"Trenutno nije sigurno ukloniti ovaj uređaj: aplikacije možda "
+"pristupaju drugim particijama na ovom uređaju. Kliknite na gumb izbaci i na "
+"drugim particijama kako biste sigurno uklonili ovaj uređaj."
+
+#: deviceitem.cpp:314
+msgid "This device is currently not accessible."
+msgstr "Ovaj uređaj trenutno nije dostupan."
+
+#: deviceitem.cpp:407
+#, kde-format
+msgctxt "@info:status Free disk space"
+msgid "%1 free"
+msgstr "%1 slobodno"
+
+#: deviceitem.cpp:461
+msgctxt ""
+"Accessing is a less technical word for Mounting; translation should be short "
+"and mean 'Currently mounting this device'"
+msgid "Accessing..."
+msgstr "Pristupanje…"
+
+#: deviceitem.cpp:464
+msgctxt ""
+"Removing is a less technical word for Unmounting; translation shoud be short "
+"and mean 'Currently unmounting this device'"
+msgid "Removing..."
+msgstr "Uklanjanje…"
+
+#: devicenotifier.cpp:102
+#, kde-format
+msgid "1 action for this device"
+msgid_plural "%1 actions for this device"
+msgstr[0] "%1 radnja za ovaj uređaj"
+msgstr[1] "%1 radnje za ovaj uređaj"
+msgstr[2] "%1 radnji za ovaj uređaj"
+
+#: devicenotifier.cpp:334
+msgid "No devices available."
+msgstr "Nema dostupnih uređaja."
+
+#: devicenotifier.cpp:338
+msgid "Most recent device"
+msgstr "Najnoviji uređaj"
+
+#: devicenotifier.cpp:468
+msgid "Display"
+msgstr "Prikaz"
+
+#: devicenotifier.cpp:471
+msgid "Automounting"
+msgstr "Automatski montiraj"
+
+#: notifierdialog.cpp:69
+msgid "Show hidden devices"
+msgstr "Prikaži skrivene uređaje"
+
+#: notifierdialog.cpp:973
+#, kde-format
+msgctxt "Hide a device"
+msgid "Hide %1"
+msgstr "Sakrij %1"
+
+#: notifierdialog.cpp:1037
+msgid "Available Devices"
+msgstr "Dostupni uređaji"
+
+#: notifierdialog.cpp:1039
+msgid "No Devices Available"
+msgstr "Nema dostupnih uređaja"
+
+#. i18n: file: configurationpage.ui:17
+#. i18n: ectx: property (text), widget (QRadioButton, removableDevices)
+#: rc.cpp:3
+msgid "Removable devices only"
+msgstr "Samo uklonjivi uređaji"
+
+#. i18n: file: configurationpage.ui:24
+#. i18n: ectx: property (text), widget (QRadioButton, nonRemovableDevices)
+#: rc.cpp:6
+msgid "Non-removable devices only"
+msgstr "Samo neuklonjivi uređaji"
+
+#. i18n: file: configurationpage.ui:44
+#. i18n: ectx: property (text), widget (QRadioButton, allDevices)
+#: rc.cpp:9
+msgid "All devices"
+msgstr "Svi uređaji"
+
+#~ msgid "Mounting..."
+#~ msgstr "Montiranje…"
+
+#, fuzzy
+#~| msgid "Device is plugged in and can be accessed by applications."
+#~ msgid ""
+#~ "Device is plugged in and the volume can be accessed by applications. It "
+#~ "is not safe to remove this device."
+#~ msgstr "Uređaj je priključen i aplikacije mu mogu pristupiti."
+
+#, fuzzy
+#~| msgid "Device is plugged in, but not mounted for access yet."
+#~ msgid ""
+#~ "Device is plugged in and the volume is not mounted for access yet. The "
+#~ "device can be safely removed."
+#~ msgstr "Uređaj je priključen, ali nije još montiran za pristup."
+
+#~ msgid ""
+#~ "Could not unmount device %1.\n"
+#~ "One or more files on this device are open within an application."
+#~ msgstr ""
+#~ "Nije moguće odmontirati uređaj %1.\n"
+#~ "Otvorena je jedna ili više datoteka s ovog uređaja u nekoj aplikaciji."
+
+#~ msgid ""
+#~ "Cannot eject the disc.\n"
+#~ "One or more files on this disc are open within an application."
+#~ msgstr ""
+#~ "Ne mogu izbaciti disk.\n"
+#~ "Otvorena je jedna ili više datoteka sa ovog uređaja u nekoj aplikaciji."
+
+#~ msgid "Could not mount device %1."
+#~ msgstr "Nije moguće montirati uređaj %1."
+
+#~ msgid "Cannot mount the disc."
+#~ msgstr "Nije moguće montirati disk."
+
+#~ msgid "No devices plugged in"
+#~ msgstr "Nema priključenih uređaja"
+
+#~ msgctxt "General options page"
+#~ msgid "General"
+#~ msgstr "Općenito"
+
+#~ msgid "No devices plugged in."
+#~ msgstr "Nema priključenih uređaja."
+
+#~ msgid "Devices recently plugged in:"
+#~ msgstr "Uređaji koji su nedavno priključeni"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_org.kde.notifications.po kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_org.kde.notifications.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_org.kde.notifications.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_org.kde.notifications.po 2012-09-22 23:44:02.000000000 +0000
@@ -0,0 +1,216 @@
+# Translation of plasma_applet_notifications to Croatian
+#
+msgid ""
+msgstr ""
+"Project-Id-Version: \n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-09-08 04:08+0200\n"
+"PO-Revision-Date: 2011-03-01 13:40+0100\n"
+"Last-Translator: Marko Dimjasevic \n"
+"Language-Team: Croatian \n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
+"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
+"Language: hr\n"
+"X-Generator: Lokalize 1.2\n"
+"X-Environment: kde\n"
+"X-Accelerator-Marker: &\n"
+"X-Text-Markup: kde4\n"
+
+#: core/completedjobnotification.cpp:48
+#, kde-format
+msgid "%1 [Finished]"
+msgstr "%1 [završeno]"
+
+#: core/completedjobnotification.cpp:64
+msgid "Open"
+msgstr "Otvori"
+
+#: core/job.cpp:196
+#, kde-format
+msgid "%1 file, to: %2"
+msgid_plural "%1 files, to: %2"
+msgstr[0] "%1 datoteka u: %2"
+msgstr[1] "%1 datoteke u: %2"
+msgstr[2] "%1 datoteka u: %2"
+
+#: core/notificationsmanager.cpp:192
+#, kde-format
+msgid "1 running job (%2 remaining)"
+msgid_plural "%1 running jobs (%2 remaining)"
+msgstr[0] "Izvršava se %1 posao (preostaje %2)"
+msgstr[1] "Izvršavaju se %1 posla (preostaje %2)"
+msgstr[2] "Izvršava se %1 poslova (preostaje %2)"
+
+#: core/notificationsmanager.cpp:197
+msgid "no running jobs"
+msgstr "Ni jedan posao se ne izvršava"
+
+#: ui/busywidget.cpp:315
+#, fuzzy, kde-format
+#| msgid "%1 running job"
+#| msgid_plural "%1 running jobs"
+msgctxt "Number of jobs and the speed at which they are downloading"
+msgid "%1 running job (%2/s)"
+msgid_plural "%1 running jobs (%2/s)"
+msgstr[0] "Izvršava se %1 posao"
+msgstr[1] "Izvršavaju se %1 posla"
+msgstr[2] "Izvršava se %1 poslova"
+
+#: ui/busywidget.cpp:323
+#, kde-format
+msgid "%1 suspended job"
+msgid_plural "%1 suspended jobs"
+msgstr[0] "%1 obustavljen posao"
+msgstr[1] "%1 obustavljena posla"
+msgstr[2] "%1 obustavljenih poslova"
+
+#: ui/busywidget.cpp:330
+#, kde-format
+msgid "%1 completed job"
+msgid_plural "%1 completed jobs"
+msgstr[0] "%1 završen posao"
+msgstr[1] "%1 završena posla"
+msgstr[2] "%1 završenih poslova"
+
+#: ui/busywidget.cpp:337
+#, kde-format
+msgid "%1 notification"
+msgid_plural "%1 notifications"
+msgstr[0] "%1 obavijest"
+msgstr[1] "%1 obavijesti"
+msgstr[2] "%1 obavijesti"
+
+#: ui/busywidget.cpp:342
+msgid "No active jobs or notifications"
+msgstr "Nema aktivnih poslova ili obavijesti"
+
+#: ui/busywidget.cpp:345
+msgid "Notifications and jobs"
+msgstr "Obavijesti i poslovi"
+
+#: ui/jobtotalswidget.cpp:83
+msgctxt "Generic title for the job transfer popup"
+msgid "Jobs"
+msgstr "Poslovi"
+
+#: ui/jobwidget.cpp:65
+msgid "KiB/s"
+msgstr "KiB/s"
+
+#: ui/jobwidget.cpp:114 ui/jobwidget.cpp:419
+msgid "More"
+msgstr "Više"
+
+#: ui/jobwidget.cpp:126
+msgid "Pause job"
+msgstr "Pauziraj posao"
+
+#: ui/jobwidget.cpp:135
+msgid "Resume job"
+msgstr "Nastavi posao"
+
+#: ui/jobwidget.cpp:144
+msgid "Cancel job"
+msgstr "Prekini posao"
+
+#: ui/jobwidget.cpp:194 ui/jobwidget.cpp:223
+#, kde-format
+msgid "%1 (%2 remaining)"
+msgstr "%1 (preostaje %2)"
+
+#: ui/jobwidget.cpp:202
+#, kde-format
+msgctxt ""
+"%1 is the name of the job, can be things like Copying, deleting, moving"
+msgid "%1 [Paused]"
+msgstr "%1 [pauzirano]"
+
+#: ui/jobwidget.cpp:203
+msgid "Paused"
+msgstr "Pauzirano"
+
+#: ui/jobwidget.cpp:207
+#, kde-format
+msgctxt ""
+"%1 is the name of the job, can be things like Copying, deleting, moving"
+msgid "%1 [Finished]"
+msgstr "%1 [završeno]"
+
+#: ui/jobwidget.cpp:269
+#, kde-format
+msgid "%2 / 1 folder"
+msgid_plural "%2 / %1 folders"
+msgstr[0] "%2 / %1 mapa"
+msgstr[1] "%2 / %1 mape"
+msgstr[2] "%2 / %1 mapa"
+
+#: ui/jobwidget.cpp:277
+#, kde-format
+msgid "%2 / 1 file"
+msgid_plural "%2 / %1 files"
+msgstr[0] "%2 / %1 datoteka"
+msgstr[1] "%2 / %1 datoteke"
+msgstr[2] "%2 / %1 datoteka"
+
+#: ui/jobwidget.cpp:407
+msgid "Less"
+msgstr "Manje"
+
+#: ui/notificationgroup.cpp:42
+msgid "Notifications"
+msgstr "Obavijesti"
+
+#: ui/notificationgroup.cpp:50
+msgctxt "Show all notifications"
+msgid "All"
+msgstr "Sve"
+
+#: ui/notificationgroup.cpp:94 ui/notificationwidget.cpp:324
+#, kde-format
+msgid "Notification from %1"
+msgstr "Obavijest od %1"
+
+#: ui/notifications.cpp:126
+msgid "No notifications and no jobs"
+msgstr "Nema obavijesti i nema poslova"
+
+#: ui/notifications.cpp:214
+msgid "Information"
+msgstr "Informacije"
+
+#: ui/notifications.cpp:216
+msgid "Choose which information to show"
+msgstr "Odaberite koje informacije treba prikazati"
+
+#. i18n: file: ui/notificationsconfig.ui:26
+#. i18n: ectx: property (text), widget (QLabel, label_2)
+#: rc.cpp:3
+msgid "Pop Up Notices"
+msgstr "Skočne objave"
+
+#. i18n: file: ui/notificationsconfig.ui:33
+#. i18n: ectx: property (text), widget (QLabel, label_4)
+#: rc.cpp:6
+msgid "Application notifications"
+msgstr "Aplikacijske obavijesti"
+
+#. i18n: file: ui/notificationsconfig.ui:50
+#. i18n: ectx: property (text), widget (QLabel, label_5)
+#: rc.cpp:9
+msgid "File transfers and other jobs"
+msgstr "Prijenosi datoteka i drugi poslovi"
+
+#. i18n: file: ui/notificationsconfig.ui:89
+#. i18n: ectx: property (text), widget (QLabel, label_3)
+#: rc.cpp:12
+msgid "Popup"
+msgstr "Skočni prozor"
+
+#. i18n: file: ui/notificationsconfig.ui:103
+#. i18n: ectx: property (text), widget (QLabel, label_10)
+#: rc.cpp:15
+msgid "Automatically hide"
+msgstr "Automatski sakrij"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_org.kde.plasma.analogclock.po kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_org.kde.plasma.analogclock.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_org.kde.plasma.analogclock.po 2013-12-24 07:56:10.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_org.kde.plasma.analogclock.po 1970-01-01 00:00:00.000000000 +0000
@@ -1,60 +0,0 @@
-# Translation of plasma_applet_clock to Croatian
-#
-msgid ""
-msgstr ""
-"Project-Id-Version: plasma_applet_clock\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-08-02 05:39+0200\n"
-"PO-Revision-Date: 2009-08-18 08:53+0200\n"
-"Last-Translator: \n"
-"Language-Team: Croatian \n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"Language: hr\n"
-"X-Generator: Lokalize 0.3\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
-"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"X-Environment: kde\n"
-"X-Accelerator-Marker: &\n"
-"X-Text-Markup: kde4\n"
-
-#: clock.cpp:185
-msgid "Appearance"
-msgstr "Izgled"
-
-#. i18n: file: clockConfig.ui:22
-#. i18n: ectx: property (toolTip), widget (QCheckBox, showSecondHandCheckBox)
-#: rc.cpp:3
-msgid "Show the seconds"
-msgstr "Pokaži sekunde"
-
-#. i18n: file: clockConfig.ui:25
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, showSecondHandCheckBox)
-#: rc.cpp:6
-msgid "Check this if you want to show the seconds."
-msgstr "Uključite ovo ako želite vidjeti sekunde."
-
-#. i18n: file: clockConfig.ui:28
-#. i18n: ectx: property (text), widget (QCheckBox, showSecondHandCheckBox)
-#: rc.cpp:9
-msgid "Show &seconds hand"
-msgstr "Pokaži kazaljku &sekundi"
-
-#. i18n: file: clockConfig.ui:35
-#. i18n: ectx: property (toolTip), widget (QCheckBox, showTimezoneStringCheckBox)
-#: rc.cpp:12
-msgid "Show the Timezone in text"
-msgstr "Pokaži vremensku zonu u tekstu"
-
-#. i18n: file: clockConfig.ui:38
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, showTimezoneStringCheckBox)
-#: rc.cpp:15
-msgid "Check this if you want to display Timezone in text."
-msgstr "Uključite ovo ako želite vidjeti vremensku zonu u tekstu"
-
-#. i18n: file: clockConfig.ui:41
-#. i18n: ectx: property (text), widget (QCheckBox, showTimezoneStringCheckBox)
-#: rc.cpp:18
-msgid "Show &time zone"
-msgstr "Pokaži &vremensku zonu"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_org.kde.plasma.battery.po kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_org.kde.plasma.battery.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_org.kde.plasma.battery.po 2014-01-04 10:39:05.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_org.kde.plasma.battery.po 1970-01-01 00:00:00.000000000 +0000
@@ -1,214 +0,0 @@
-# Translation of plasma_applet_battery to Croatian
-#
-# Andrej Dundović , 2009.
-# Andrej Dundovic , 2009, 2010.
-# Marko Dimjasevic , 2010, 2011.
-msgid ""
-msgstr ""
-"Project-Id-Version: plasma_applet_battery\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-08-02 05:39+0200\n"
-"PO-Revision-Date: 2011-02-15 16:36+0100\n"
-"Last-Translator: Marko Dimjasevic \n"
-"Language-Team: Croatian \n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"Language: hr\n"
-"X-Generator: Lokalize 1.2\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
-"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"X-Environment: kde\n"
-"X-Accelerator-Marker: &\n"
-"X-Text-Markup: kde4\n"
-
-#: battery.cpp:199
-msgid "Battery: "
-msgstr "Baterija: "
-
-#: battery.cpp:206
-#, kde-format
-msgctxt "tooltip: placeholder is the battery ID"
-msgid "Battery %1: "
-msgstr "Baterija %1: "
-
-#: battery.cpp:217
-msgctxt "tooltip"
-msgid "AC Adapter: "
-msgstr "AC adapter: "
-
-#: battery.cpp:218
-msgctxt "tooltip"
-msgid "Plugged in"
-msgstr "Priključen"
-
-#: battery.cpp:218
-msgctxt "tooltip"
-msgid "Not plugged in"
-msgstr "Nije priključen"
-
-#: battery.cpp:354
-msgid "General"
-msgstr "Općenito"
-
-#: battery.cpp:536
-msgctxt "Label for remaining time"
-msgid "Time Remaining:"
-msgstr "Preostalo vrijeme:"
-
-#: battery.cpp:556
-msgid "Power Profile:"
-msgstr "Energetski profil:"
-
-#: battery.cpp:571
-msgid "Screen Brightness:"
-msgstr "Osvjetljenje zaslona:"
-
-#: battery.cpp:598
-msgctxt "Suspend the computer to RAM; translation should be short"
-msgid "Sleep"
-msgstr "Spavaj"
-
-#: battery.cpp:605
-msgctxt "Suspend the computer to disk; translation should be short"
-msgid "Hibernate"
-msgstr "Hiberniraj"
-
-#: battery.cpp:614
-msgctxt "tooltip on the config button in the popup"
-msgid "Configure Power Management..."
-msgstr "Podešavanje upravitelja potrošnje energije…"
-
-#: battery.cpp:616
-msgid "Power Settings"
-msgstr "Postavke potrošnje energije"
-
-#: battery.cpp:672
-#, kde-format
-msgid "%1% (charged)"
-msgstr "%1% (napunjena)"
-
-#: battery.cpp:674
-#, kde-format
-msgid "%1% (discharging)"
-msgstr "%1% (pražnjenje)"
-
-#: battery.cpp:676
-#, kde-format
-msgid "%1% (charging)"
-msgstr "%1% (punjenje)"
-
-#: battery.cpp:680
-msgctxt "Battery is not plugged in"
-msgid "Not present"
-msgstr "Nije prisutna"
-
-#: battery.cpp:696 battery.cpp:729
-msgid "Battery:"
-msgstr "Baterija:"
-
-#: battery.cpp:703
-#, kde-format
-msgctxt "Placeholder is the battery ID"
-msgid "Battery %1:"
-msgstr "Baterija %1:"
-
-#: battery.cpp:710
-msgid "AC Adapter:"
-msgstr "AC adapter:"
-
-#: battery.cpp:712
-msgid "Plugged in "
-msgstr "Priključen "
-
-#: battery.cpp:714
-msgid "Not plugged in "
-msgstr "Nije priključen "
-
-#: battery.cpp:730
-msgctxt "Battery is not plugged in"
-msgid "Not present "
-msgstr "Nije prisutna "
-
-#: battery.cpp:988 battery.cpp:1019 battery.cpp:1031
-#, kde-format
-msgctxt "overlay on the battery, needs to be really tiny"
-msgid "%1%"
-msgstr "%1%"
-
-#. i18n: file: batteryConfig.ui:14
-#. i18n: ectx: property (windowTitle), widget (QWidget, batteryConfig)
-#: rc.cpp:3
-msgid "Configure Battery Monitor"
-msgstr "Podesi nadzornika baterije"
-
-#. i18n: file: batteryConfig.ui:23
-#. i18n: ectx: property (text), widget (QCheckBox, showBatteryStringCheckBox)
-#: rc.cpp:6
-msgid "Show charge &information"
-msgstr "Pokaži &informaciju o punjenju"
-
-#. i18n: file: batteryConfig.ui:33
-#. i18n: ectx: property (text), widget (QCheckBox, showMultipleBatteriesCheckBox)
-#: rc.cpp:9
-msgid "Show the state for &each battery present"
-msgstr "Pokaži stanj&e za svaku prisutnu bateriju"
-
-#~ msgid "AC Adapter: "
-#~ msgstr "AC adapter: "
-
-#~ msgid "Power Management"
-#~ msgstr "Upravljanje potrošnjom energije"
-
-#~ msgid "Battery: "
-#~ msgstr "Baterija: "
-
-#~ msgid "Screen Brightness"
-#~ msgstr "Osvjetljenje zaslona"
-
-#~ msgctxt "Shown when a time estimate is not available"
-#~ msgid "%1% (discharging)"
-#~ msgstr "%1% (pražnjenje)"
-
-#~ msgctxt "state of battery"
-#~ msgid "%1% (charged)"
-#~ msgstr "%1% (napunjena)"
-
-#~ msgctxt "state of battery"
-#~ msgid "%1% (discharging)"
-#~ msgstr "%1% (pražnjenje)"
-
-#~ msgctxt "state of battery"
-#~ msgid "%1% (charging)"
-#~ msgstr "%1% (punjenje)"
-
-#~ msgid "%2% (discharging)"
-#~ msgstr "%2% (pražnjenje)"
-
-#~ msgid "%2% (charging)"
-#~ msgstr "%2% (punjenje)"
-
-#~ msgid "Configure..."
-#~ msgstr "Podesi …"
-
-#~ msgid "Actions"
-#~ msgstr "Radnje"
-
-#~ msgid "%1% (fully charged)"
-#~ msgstr "%1% (potpuno napunjen)"
-
-#~ msgctxt "Shown when a time estimate is not available"
-#~ msgid "Battery: %1% (discharging) "
-#~ msgstr "Baterija: %1% (prazni se) "
-
-#~ msgid "Battery: %1% (charging) "
-#~ msgstr "Baterija: %1% (puni se) "
-
-#~ msgid "Battery %1: %2% (fully charged) "
-#~ msgstr "Baterija %1: %2% (potpuno puna) "
-
-#~ msgid "Battery %1: %2% (discharging) "
-#~ msgstr "Baterija %1: %2% (prazni se) "
-
-#~ msgid "AC Adapter: Not plugged in"
-#~ msgstr "Punjač: Nije priključen"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_org.kde.plasma.devicenotifier.po kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_org.kde.plasma.devicenotifier.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_org.kde.plasma.devicenotifier.po 2013-12-24 07:56:10.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_org.kde.plasma.devicenotifier.po 1970-01-01 00:00:00.000000000 +0000
@@ -1,201 +0,0 @@
-# Translation of plasma_applet_devicenotifier to Croatian
-#
-# DoDo , 2009.
-# Andrej Dundović , 2009.
-# Andrej Dundovic , 2009, 2010.
-# Marko Dimjasevic , 2011.
-# Marko Dimjašević , 2011.
-msgid ""
-msgstr ""
-"Project-Id-Version: plasma_applet_devicenotifier\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-08-02 05:39+0200\n"
-"PO-Revision-Date: 2011-04-07 10:09+0200\n"
-"Last-Translator: Marko Dimjašević \n"
-"Language-Team: Croatian \n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"Language: hr\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
-"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"X-Generator: Lokalize 1.2\n"
-"X-Environment: kde\n"
-"X-Accelerator-Marker: &\n"
-"X-Text-Markup: kde4\n"
-
-#: deviceitem.cpp:292
-msgid "Click to eject this disc."
-msgstr "Kliknite kako biste izbacili ovaj disk."
-
-#: deviceitem.cpp:295
-msgid "Click to safely remove this device."
-msgstr "Kliknite kako biste sigurno uklonili ovaj uređaj."
-
-#: deviceitem.cpp:297
-msgid "Click to unmount this device."
-msgstr "Kliknite kako biste uklonili ovaj uređaj."
-
-#: deviceitem.cpp:301
-msgid ""
-"It is currently not safe to remove this device: applications may be "
-"accessing it. Click the eject button to safely remove this device."
-msgstr ""
-"Trenutno nije sigurno ukloniti ovaj uređaj: možda mu pristupaju "
-"aplikacije. Kliknite na gumb izbaci kako biste sigurno uklonili ovaj uređaj."
-
-#: deviceitem.cpp:303
-msgid "This device is currently accessible."
-msgstr "Ovaj je uređaj trenutno dostupan."
-
-#: deviceitem.cpp:306
-msgid "Click to access this device from other applications."
-msgstr "Kliknite kako biste pristupili ovom uređaju iz drugih aplikacija."
-
-#: deviceitem.cpp:309
-msgid "It is currently safe to remove this device."
-msgstr "Sada je sigurno ukloniti ovaj uređaj."
-
-#: deviceitem.cpp:311
-msgid ""
-"It is currently not safe to remove this device: applications may be "
-"accessing other volumes on this device. Click the eject button on these "
-"other volumes to safely remove this device."
-msgstr ""
-"Trenutno nije sigurno ukloniti ovaj uređaj: aplikacije možda "
-"pristupaju drugim particijama na ovom uređaju. Kliknite na gumb izbaci i na "
-"drugim particijama kako biste sigurno uklonili ovaj uređaj."
-
-#: deviceitem.cpp:314
-msgid "This device is currently not accessible."
-msgstr "Ovaj uređaj trenutno nije dostupan."
-
-#: deviceitem.cpp:407
-#, kde-format
-msgctxt "@info:status Free disk space"
-msgid "%1 free"
-msgstr "%1 slobodno"
-
-#: deviceitem.cpp:461
-msgctxt ""
-"Accessing is a less technical word for Mounting; translation should be short "
-"and mean 'Currently mounting this device'"
-msgid "Accessing..."
-msgstr "Pristupanje…"
-
-#: deviceitem.cpp:464
-msgctxt ""
-"Removing is a less technical word for Unmounting; translation shoud be short "
-"and mean 'Currently unmounting this device'"
-msgid "Removing..."
-msgstr "Uklanjanje…"
-
-#: devicenotifier.cpp:102
-#, kde-format
-msgid "1 action for this device"
-msgid_plural "%1 actions for this device"
-msgstr[0] "%1 radnja za ovaj uređaj"
-msgstr[1] "%1 radnje za ovaj uređaj"
-msgstr[2] "%1 radnji za ovaj uređaj"
-
-#: devicenotifier.cpp:334
-msgid "No devices available."
-msgstr "Nema dostupnih uređaja."
-
-#: devicenotifier.cpp:338
-msgid "Most recent device"
-msgstr "Najnoviji uređaj"
-
-#: devicenotifier.cpp:468
-msgid "Display"
-msgstr "Prikaz"
-
-#: devicenotifier.cpp:471
-msgid "Automounting"
-msgstr "Automatski montiraj"
-
-#: notifierdialog.cpp:69
-msgid "Show hidden devices"
-msgstr "Prikaži skrivene uređaje"
-
-#: notifierdialog.cpp:973
-#, kde-format
-msgctxt "Hide a device"
-msgid "Hide %1"
-msgstr "Sakrij %1"
-
-#: notifierdialog.cpp:1037
-msgid "Available Devices"
-msgstr "Dostupni uređaji"
-
-#: notifierdialog.cpp:1039
-msgid "No Devices Available"
-msgstr "Nema dostupnih uređaja"
-
-#. i18n: file: configurationpage.ui:17
-#. i18n: ectx: property (text), widget (QRadioButton, removableDevices)
-#: rc.cpp:3
-msgid "Removable devices only"
-msgstr "Samo uklonjivi uređaji"
-
-#. i18n: file: configurationpage.ui:24
-#. i18n: ectx: property (text), widget (QRadioButton, nonRemovableDevices)
-#: rc.cpp:6
-msgid "Non-removable devices only"
-msgstr "Samo neuklonjivi uređaji"
-
-#. i18n: file: configurationpage.ui:44
-#. i18n: ectx: property (text), widget (QRadioButton, allDevices)
-#: rc.cpp:9
-msgid "All devices"
-msgstr "Svi uređaji"
-
-#~ msgid "Mounting..."
-#~ msgstr "Montiranje…"
-
-#, fuzzy
-#~| msgid "Device is plugged in and can be accessed by applications."
-#~ msgid ""
-#~ "Device is plugged in and the volume can be accessed by applications. It "
-#~ "is not safe to remove this device."
-#~ msgstr "Uređaj je priključen i aplikacije mu mogu pristupiti."
-
-#, fuzzy
-#~| msgid "Device is plugged in, but not mounted for access yet."
-#~ msgid ""
-#~ "Device is plugged in and the volume is not mounted for access yet. The "
-#~ "device can be safely removed."
-#~ msgstr "Uređaj je priključen, ali nije još montiran za pristup."
-
-#~ msgid ""
-#~ "Could not unmount device %1.\n"
-#~ "One or more files on this device are open within an application."
-#~ msgstr ""
-#~ "Nije moguće odmontirati uređaj %1.\n"
-#~ "Otvorena je jedna ili više datoteka s ovog uređaja u nekoj aplikaciji."
-
-#~ msgid ""
-#~ "Cannot eject the disc.\n"
-#~ "One or more files on this disc are open within an application."
-#~ msgstr ""
-#~ "Ne mogu izbaciti disk.\n"
-#~ "Otvorena je jedna ili više datoteka sa ovog uređaja u nekoj aplikaciji."
-
-#~ msgid "Could not mount device %1."
-#~ msgstr "Nije moguće montirati uređaj %1."
-
-#~ msgid "Cannot mount the disc."
-#~ msgstr "Nije moguće montirati disk."
-
-#~ msgid "No devices plugged in"
-#~ msgstr "Nema priključenih uređaja"
-
-#~ msgctxt "General options page"
-#~ msgid "General"
-#~ msgstr "Općenito"
-
-#~ msgid "No devices plugged in."
-#~ msgstr "Nema priključenih uređaja."
-
-#~ msgid "Devices recently plugged in:"
-#~ msgstr "Uređaji koji su nedavno priključeni"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_org.kde.plasma.notifications.po kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_org.kde.plasma.notifications.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_org.kde.plasma.notifications.po 2013-12-24 07:56:10.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_org.kde.plasma.notifications.po 1970-01-01 00:00:00.000000000 +0000
@@ -1,216 +0,0 @@
-# Translation of plasma_applet_notifications to Croatian
-#
-msgid ""
-msgstr ""
-"Project-Id-Version: \n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 04:08+0200\n"
-"PO-Revision-Date: 2011-03-01 13:40+0100\n"
-"Last-Translator: Marko Dimjasevic \n"
-"Language-Team: Croatian \n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
-"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"Language: hr\n"
-"X-Generator: Lokalize 1.2\n"
-"X-Environment: kde\n"
-"X-Accelerator-Marker: &\n"
-"X-Text-Markup: kde4\n"
-
-#: core/completedjobnotification.cpp:48
-#, kde-format
-msgid "%1 [Finished]"
-msgstr "%1 [završeno]"
-
-#: core/completedjobnotification.cpp:64
-msgid "Open"
-msgstr "Otvori"
-
-#: core/job.cpp:196
-#, kde-format
-msgid "%1 file, to: %2"
-msgid_plural "%1 files, to: %2"
-msgstr[0] "%1 datoteka u: %2"
-msgstr[1] "%1 datoteke u: %2"
-msgstr[2] "%1 datoteka u: %2"
-
-#: core/notificationsmanager.cpp:192
-#, kde-format
-msgid "1 running job (%2 remaining)"
-msgid_plural "%1 running jobs (%2 remaining)"
-msgstr[0] "Izvršava se %1 posao (preostaje %2)"
-msgstr[1] "Izvršavaju se %1 posla (preostaje %2)"
-msgstr[2] "Izvršava se %1 poslova (preostaje %2)"
-
-#: core/notificationsmanager.cpp:197
-msgid "no running jobs"
-msgstr "Ni jedan posao se ne izvršava"
-
-#: ui/busywidget.cpp:315
-#, fuzzy, kde-format
-#| msgid "%1 running job"
-#| msgid_plural "%1 running jobs"
-msgctxt "Number of jobs and the speed at which they are downloading"
-msgid "%1 running job (%2/s)"
-msgid_plural "%1 running jobs (%2/s)"
-msgstr[0] "Izvršava se %1 posao"
-msgstr[1] "Izvršavaju se %1 posla"
-msgstr[2] "Izvršava se %1 poslova"
-
-#: ui/busywidget.cpp:323
-#, kde-format
-msgid "%1 suspended job"
-msgid_plural "%1 suspended jobs"
-msgstr[0] "%1 obustavljen posao"
-msgstr[1] "%1 obustavljena posla"
-msgstr[2] "%1 obustavljenih poslova"
-
-#: ui/busywidget.cpp:330
-#, kde-format
-msgid "%1 completed job"
-msgid_plural "%1 completed jobs"
-msgstr[0] "%1 završen posao"
-msgstr[1] "%1 završena posla"
-msgstr[2] "%1 završenih poslova"
-
-#: ui/busywidget.cpp:337
-#, kde-format
-msgid "%1 notification"
-msgid_plural "%1 notifications"
-msgstr[0] "%1 obavijest"
-msgstr[1] "%1 obavijesti"
-msgstr[2] "%1 obavijesti"
-
-#: ui/busywidget.cpp:342
-msgid "No active jobs or notifications"
-msgstr "Nema aktivnih poslova ili obavijesti"
-
-#: ui/busywidget.cpp:345
-msgid "Notifications and jobs"
-msgstr "Obavijesti i poslovi"
-
-#: ui/jobtotalswidget.cpp:83
-msgctxt "Generic title for the job transfer popup"
-msgid "Jobs"
-msgstr "Poslovi"
-
-#: ui/jobwidget.cpp:65
-msgid "KiB/s"
-msgstr "KiB/s"
-
-#: ui/jobwidget.cpp:114 ui/jobwidget.cpp:419
-msgid "More"
-msgstr "Više"
-
-#: ui/jobwidget.cpp:126
-msgid "Pause job"
-msgstr "Pauziraj posao"
-
-#: ui/jobwidget.cpp:135
-msgid "Resume job"
-msgstr "Nastavi posao"
-
-#: ui/jobwidget.cpp:144
-msgid "Cancel job"
-msgstr "Prekini posao"
-
-#: ui/jobwidget.cpp:194 ui/jobwidget.cpp:223
-#, kde-format
-msgid "%1 (%2 remaining)"
-msgstr "%1 (preostaje %2)"
-
-#: ui/jobwidget.cpp:202
-#, kde-format
-msgctxt ""
-"%1 is the name of the job, can be things like Copying, deleting, moving"
-msgid "%1 [Paused]"
-msgstr "%1 [pauzirano]"
-
-#: ui/jobwidget.cpp:203
-msgid "Paused"
-msgstr "Pauzirano"
-
-#: ui/jobwidget.cpp:207
-#, kde-format
-msgctxt ""
-"%1 is the name of the job, can be things like Copying, deleting, moving"
-msgid "%1 [Finished]"
-msgstr "%1 [završeno]"
-
-#: ui/jobwidget.cpp:269
-#, kde-format
-msgid "%2 / 1 folder"
-msgid_plural "%2 / %1 folders"
-msgstr[0] "%2 / %1 mapa"
-msgstr[1] "%2 / %1 mape"
-msgstr[2] "%2 / %1 mapa"
-
-#: ui/jobwidget.cpp:277
-#, kde-format
-msgid "%2 / 1 file"
-msgid_plural "%2 / %1 files"
-msgstr[0] "%2 / %1 datoteka"
-msgstr[1] "%2 / %1 datoteke"
-msgstr[2] "%2 / %1 datoteka"
-
-#: ui/jobwidget.cpp:407
-msgid "Less"
-msgstr "Manje"
-
-#: ui/notificationgroup.cpp:42
-msgid "Notifications"
-msgstr "Obavijesti"
-
-#: ui/notificationgroup.cpp:50
-msgctxt "Show all notifications"
-msgid "All"
-msgstr "Sve"
-
-#: ui/notificationgroup.cpp:94 ui/notificationwidget.cpp:324
-#, kde-format
-msgid "Notification from %1"
-msgstr "Obavijest od %1"
-
-#: ui/notifications.cpp:126
-msgid "No notifications and no jobs"
-msgstr "Nema obavijesti i nema poslova"
-
-#: ui/notifications.cpp:214
-msgid "Information"
-msgstr "Informacije"
-
-#: ui/notifications.cpp:216
-msgid "Choose which information to show"
-msgstr "Odaberite koje informacije treba prikazati"
-
-#. i18n: file: ui/notificationsconfig.ui:26
-#. i18n: ectx: property (text), widget (QLabel, label_2)
-#: rc.cpp:3
-msgid "Pop Up Notices"
-msgstr "Skočne objave"
-
-#. i18n: file: ui/notificationsconfig.ui:33
-#. i18n: ectx: property (text), widget (QLabel, label_4)
-#: rc.cpp:6
-msgid "Application notifications"
-msgstr "Aplikacijske obavijesti"
-
-#. i18n: file: ui/notificationsconfig.ui:50
-#. i18n: ectx: property (text), widget (QLabel, label_5)
-#: rc.cpp:9
-msgid "File transfers and other jobs"
-msgstr "Prijenosi datoteka i drugi poslovi"
-
-#. i18n: file: ui/notificationsconfig.ui:89
-#. i18n: ectx: property (text), widget (QLabel, label_3)
-#: rc.cpp:12
-msgid "Popup"
-msgstr "Skočni prozor"
-
-#. i18n: file: ui/notificationsconfig.ui:103
-#. i18n: ectx: property (text), widget (QLabel, label_10)
-#: rc.cpp:15
-msgid "Automatically hide"
-msgstr "Automatski sakrij"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_org.kde.plasma.pager.po kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_org.kde.plasma.pager.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_org.kde.plasma.pager.po 2013-12-24 07:56:10.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_org.kde.plasma.pager.po 1970-01-01 00:00:00.000000000 +0000
@@ -1,124 +0,0 @@
-# Translation of plasma_applet_pager to Croatian
-#
-# Andrej Dundovic , 2009, 2010.
-msgid ""
-msgstr ""
-"Project-Id-Version: plasma_applet_pager\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-08-02 05:38+0200\n"
-"PO-Revision-Date: 2009-11-03 10:46+0100\n"
-"Last-Translator: Andrej Dundovic \n"
-"Language-Team: Croatian \n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"Language: hr\n"
-"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%"
-"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
-"X-Generator: Lokalize 1.0\n"
-"X-Environment: kde\n"
-"X-Accelerator-Marker: &\n"
-"X-Text-Markup: kde4\n"
-
-#: pager.cpp:278
-msgid "&Add Virtual Desktop"
-msgstr "Dod&aj virtualne radne površine"
-
-#: pager.cpp:281
-msgid "&Remove Last Virtual Desktop"
-msgstr "&Ukloni zadnju virtualnu radnu površinu"
-
-#: pager.cpp:321
-msgid "General"
-msgstr "Općenito"
-
-#: pager.cpp:1355
-#, kde-format
-msgid "One window:"
-msgid_plural "%1 windows:"
-msgstr[0] "%1 prozor:"
-msgstr[1] "%1 prozora:"
-msgstr[2] "%1 prozora:"
-
-#: pager.cpp:1359
-#, kde-format
-msgid "and 1 other"
-msgid_plural "and %1 others"
-msgstr[0] "i %1 ostali"
-msgstr[1] "i %1 ostala"
-msgstr[2] "i %1 ostalih"
-
-#. i18n: file: pagerConfig.ui:14
-#. i18n: ectx: property (windowTitle), widget (QWidget, pagerConfig)
-#: rc.cpp:3
-msgid "Configure Pager"
-msgstr "Podesi Pager"
-
-#. i18n: file: pagerConfig.ui:41
-#. i18n: ectx: property (text), widget (QLabel, displayLabel)
-#: rc.cpp:6
-msgid "Display text:"
-msgstr "Prikaži tekst:"
-
-#. i18n: file: pagerConfig.ui:51
-#. i18n: ectx: property (text), widget (QRadioButton, desktopNumberRadioButton)
-#: rc.cpp:9
-msgid "Desktop number"
-msgstr "Broj radne površine"
-
-#. i18n: file: pagerConfig.ui:61
-#. i18n: ectx: property (text), widget (QRadioButton, desktopNameRadioButton)
-#: rc.cpp:12
-msgid "Desktop name"
-msgstr "Naziv radne površine"
-
-#. i18n: file: pagerConfig.ui:71
-#. i18n: ectx: property (text), widget (QRadioButton, displayNoneRadioButton)
-#: rc.cpp:15
-msgid "No text"
-msgstr "Bez teksta"
-
-#. i18n: file: pagerConfig.ui:81
-#. i18n: ectx: property (text), widget (QLabel, label)
-#: rc.cpp:18
-msgid "Display icons:"
-msgstr "Prikaži ikone:"
-
-#. i18n: file: pagerConfig.ui:101
-#. i18n: ectx: property (text), widget (QLabel, currentLabel)
-#: rc.cpp:21
-msgid "Selecting current desktop:"
-msgstr "Odabirem trenutnu radnu površinu:"
-
-#. i18n: file: pagerConfig.ui:111
-#. i18n: ectx: property (text), widget (QRadioButton, doNothingRadioButton)
-#: rc.cpp:24
-msgid "Does nothing"
-msgstr "Ne čini ništa"
-
-#. i18n: file: pagerConfig.ui:121
-#. i18n: ectx: property (text), widget (QRadioButton, showDesktopRadioButton)
-#: rc.cpp:27
-msgid "Shows desktop"
-msgstr "Prikaži radnu površinu"
-
-#. i18n: file: pagerConfig.ui:131
-#. i18n: ectx: property (text), widget (QRadioButton, showDashboardRadioButton)
-#: rc.cpp:30
-msgid "Shows the dashboard"
-msgstr "Pokaži nadzornu ploču"
-
-#~ msgid "Number of columns:"
-#~ msgstr "Broj stupaca:"
-
-#~ msgid "Number of rows:"
-#~ msgstr "Broj redaka:"
-
-#~ msgid "Change the number of rows"
-#~ msgstr "Promijeni broj redaka"
-
-#~ msgid "&Configure Virtual Desktops..."
-#~ msgstr "&Podesi virtualne radne površine …"
-
-#~ msgid "Configure Desktops..."
-#~ msgstr "Podesi radnih površina …"
diff -Nru kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_pager.po kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_pager.po
--- kde-l10n-hr-4.12.97/messages/kde-workspace/plasma_applet_pager.po 1970-01-01 00:00:00.000000000 +0000
+++ kde-l10n-hr-4.13.0/messages/kde-workspace/plasma_applet_pager.po 2011-09-14 00:24:48.000000000 +0000
@@ -0,0 +1,124 @@
+# Translation of plasma_applet_pager to Croatian
+#
+# Andrej Dundovic , 2009, 2010.
+msgid ""
+msgstr ""
+"Project-Id-Version: plasma_applet_pager\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-08-02 05:38+0200\n"
+"PO-Revision-Date: 2009-11-03 10:46+0100\n"
+"Last-Translator: Andrej Dundovic \n"
+"Language-Team: Croatian