diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/adblock.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/adblock.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/adblock.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/adblock.po	2012-03-23 06:41:59.000000000 +0000
@@ -1,21 +1,21 @@
 # translation of adblock.po to Arabic
 # Copyright (C) YEAR This_file_is_part_of_KDE
 # This file is distributed under the same license as the PACKAGE package.
-#
-# zayed <zayed.alsaidi@gmail.com>, 2008.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
+# Abdalrahim G. Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: adblock\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2012-01-25 11:02+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"PO-Revision-Date: 2012-03-12 22:32+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:28+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:13+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: adblock.cpp:71
@@ -24,19 +24,19 @@
 
 #: adblock.cpp:77
 msgid "Show Blockable Elements..."
-msgstr ""
+msgstr "اظهر العناصر القابلة للمنع..."
 
 #: adblock.cpp:82 adblockdialog.cpp:96
 msgid "Configure Filters..."
-msgstr ""
+msgstr "اضبط المرشحات..."
 
 #: adblock.cpp:91
 msgid "No blocking for this page"
-msgstr ""
+msgstr "عطّلها لهذه الصفحة"
 
 #: adblock.cpp:96
 msgid "No blocking for this site"
-msgstr ""
+msgstr "عطّلها لهذا الموقع"
 
 #: adblock.cpp:172
 msgid "Please enable Konqueror's Adblock"
@@ -45,7 +45,7 @@
 #: adblock.cpp:173
 msgctxt "@title:window"
 msgid "Adblock disabled"
-msgstr ""
+msgstr "مانع الإعلانات معطل"
 
 #: adblock.cpp:206
 msgid "script"
@@ -57,7 +57,7 @@
 
 #: adblock.cpp:210
 msgid "frame"
-msgstr ""
+msgstr "الإطار"
 
 #: adblock.cpp:231
 msgid "image"
@@ -66,29 +66,29 @@
 #: adblock.cpp:290
 #, kde-format
 msgid "Blocked by %1"
-msgstr ""
+msgstr "محجوبة بواسطة %1"
 
 #: adblock.cpp:293
 #, kde-format
 msgid "Allowed by %1"
-msgstr ""
+msgstr "مسموح بواسطة %1"
 
 #: adblockdialog.cpp:93
 msgctxt "@title:window"
 msgid "Blockable items on this page"
-msgstr ""
+msgstr "العناصر القابلة للمنع في هذه الصفحة"
 
 #: adblockdialog.cpp:98
 msgid "Add filter"
-msgstr ""
+msgstr "أضف المرشح"
 
 #: adblockdialog.cpp:107
 msgid "Search:"
-msgstr ""
+msgstr "ابحث:"
 
 #: adblockdialog.cpp:114
 msgid "Blockable items:"
-msgstr ""
+msgstr "العناصر القابلة للمنع:"
 
 #: adblockdialog.cpp:123
 msgid "Source"
@@ -100,13 +100,15 @@
 
 #: adblockdialog.cpp:123
 msgid "Tag"
-msgstr ""
+msgstr "العلامة"
 
 #: adblockdialog.cpp:150
 msgid ""
 "New filter (can use *?[] wildcards, /RE/ for regular expression, prefix with "
 "@@ for white list):"
 msgstr ""
+"مرشح جديد (يمكن استعمال العلامات *?[]  ، و /RE/ للتعابير النمطية,  والمقدمة "
+"ب @@ للقوائم البيضاء):"
 
 #: adblockdialog.cpp:170
 msgid "Filter this item"
@@ -118,11 +120,11 @@
 
 #: adblockdialog.cpp:172
 msgid "Filter all items from same host"
-msgstr ""
+msgstr "رشح كل العناصر  من نفس المستضيف"
 
 #: adblockdialog.cpp:173
 msgid "Filter all items from same domain"
-msgstr ""
+msgstr "رشح كل العناصر في نفس النطاق"
 
 #: adblockdialog.cpp:175
 msgid "Add this item to white list"
@@ -134,7 +136,7 @@
 
 #: adblockdialog.cpp:180
 msgid "View item"
-msgstr ""
+msgstr "أظهر العنصر"
 
 #. i18n: file: plugin_adblock.rc:4
 #. i18n: ectx: Menu (tools)
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_birthdays_resource.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_birthdays_resource.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_birthdays_resource.po	2012-02-23 06:20:22.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_birthdays_resource.po	2012-03-23 06:41:54.000000000 +0000
@@ -15,8 +15,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 01:19+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:48+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: birthdaysresource.cpp:53
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_ical_resource.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_ical_resource.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_ical_resource.po	2012-02-23 06:20:22.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_ical_resource.po	2012-03-23 06:41:54.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 01:21+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:49+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: icalresourcebase.cpp:64 icalresourcebase.cpp:106 icalresourcebase.h:98
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_kabc_resource.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_kabc_resource.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_kabc_resource.po	2012-02-23 06:20:22.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_kabc_resource.po	2012-03-23 06:41:54.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 01:22+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:50+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kabcresource.cpp:123
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_kcal_resource.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_kcal_resource.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_kcal_resource.po	2012-02-23 06:20:22.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_kcal_resource.po	2012-03-23 06:41:54.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 01:23+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:50+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kcalresource.cpp:84
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_knut_resource.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_knut_resource.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_knut_resource.po	2012-02-23 06:20:22.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_knut_resource.po	2012-03-23 06:41:54.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 01:23+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:51+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: knutresource.cpp:73
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_kolabproxy_resource.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_kolabproxy_resource.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_kolabproxy_resource.po	2012-02-23 06:20:22.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_kolabproxy_resource.po	2012-03-23 06:41:54.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 01:24+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:51+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: incidencehandler.cpp:96
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_localbookmarks_resource.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_localbookmarks_resource.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_localbookmarks_resource.po	2012-02-23 06:20:22.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_localbookmarks_resource.po	2012-03-23 06:41:54.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 01:24+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:51+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: localbookmarksresource.cpp:60
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_nepomuktag_resource.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_nepomuktag_resource.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_nepomuktag_resource.po	2012-02-23 06:20:22.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_nepomuktag_resource.po	2012-03-23 06:41:54.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 01:27+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:53+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: nepomuktagresource.cpp:52 nepomuktagresource.cpp:54
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_nntp_resource.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_nntp_resource.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_nntp_resource.po	2012-02-23 06:20:22.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_nntp_resource.po	2012-03-23 06:41:54.000000000 +0000
@@ -15,8 +15,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 01:28+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:53+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: configdialog.cpp:32
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_singlefile_resource.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_singlefile_resource.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_singlefile_resource.po	2012-02-23 06:20:23.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_singlefile_resource.po	2012-03-23 06:41:54.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 01:29+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:54+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #. i18n: file: singlefileresourceconfigwidget_desktop.ui:12
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonaditray.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonaditray.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonaditray.po	2012-02-23 06:20:23.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonaditray.po	2012-03-23 06:41:54.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 01:31+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:54+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: backupassistant.cpp:42
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_vcarddir_resource.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_vcarddir_resource.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_vcarddir_resource.po	2012-02-23 06:20:23.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_vcarddir_resource.po	2012-03-23 06:41:54.000000000 +0000
@@ -15,8 +15,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 01:31+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:54+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #. i18n: file: settingsdialog.ui:20
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_vcard_resource.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_vcard_resource.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akonadi_vcard_resource.po	2012-02-23 06:20:23.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akonadi_vcard_resource.po	2012-03-23 06:41:54.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 01:30+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:54+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #. i18n: file: vcardresource.kcfg:10
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akregator_konqplugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akregator_konqplugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akregator_konqplugin.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akregator_konqplugin.po	2012-03-23 06:41:59.000000000 +0000
@@ -3,20 +3,21 @@
 #
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: akregator_konqplugin\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2009-05-11 17:36+0000\n"
-"Last-Translator: Khaled Hosny <khaledhosny@eglug.org>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"PO-Revision-Date: 2012-03-12 22:33+0000\n"
+"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:29+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:13+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: akregatorplugin.cpp:87 konqfeedicon.cpp:142
 msgid "Add Feed to Akregator"
@@ -40,9 +41,9 @@
 
 #: pluginbase.cpp:55
 msgid "Akregator feed icon - DBus Call failed"
-msgstr ""
+msgstr "أيقونة Akregator - فشلت منادة DBus"
 
 #: pluginbase.cpp:56
 msgctxt "@title:window"
 msgid "The DBus call addFeedToGroup failed"
-msgstr ""
+msgstr "فشلت منادة addFeedToGroup لDBus"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akregator.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akregator.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/akregator.po	2012-02-23 06:20:10.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/akregator.po	2012-03-23 06:41:41.000000000 +0000
@@ -10,7 +10,7 @@
 "Project-Id-Version: akregator\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 03:45+0000\n"
-"PO-Revision-Date: 2011-12-12 18:33+0000\n"
+"PO-Revision-Date: 2012-03-14 17:47+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <>\n"
 "MIME-Version: 1.0\n"
@@ -18,8 +18,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:20+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:06+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 "X-Poedit-SourceCharset: utf-8\n"
 
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/amarok.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/amarok.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/amarok.po	2012-02-23 06:20:05.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/amarok.po	2012-03-23 06:41:36.000000000 +0000
@@ -16,8 +16,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:08+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:25+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: toolbar/VolumePopupButton.cpp:107 toolbar/VolumePopupButton.cpp:118
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/amor.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/amor.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/amor.po	2012-02-23 06:20:11.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/amor.po	2012-03-23 06:41:43.000000000 +0000
@@ -6,19 +6,20 @@
 # Ahmad M. Zawawi <zawawi@arabeyes.org>, 2004.
 # Munzir Taha <munzir@kacst.edu.sa>, 2004.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: amor\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-09 04:38+0000\n"
-"PO-Revision-Date: 2011-12-12 17:59+0000\n"
+"PO-Revision-Date: 2012-03-14 17:37+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: <en@li.org>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:00+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:28+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: tips.cpp:2
@@ -49,7 +50,7 @@
 
 #: tips.cpp:17
 msgid "The answer is 42."
-msgstr "الجواب هو 42"
+msgstr "الجواب هو 42."
 
 #: tips.cpp:20
 msgid "It's not a bug. It's a misfeature."
@@ -63,16 +64,16 @@
 msgid ""
 "To maximize a window vertically, click the maximize button with the middle "
 "mouse button."
-msgstr "لتكبير نافذة عاموديا. استخدم زر التكبير مع الزر الاوسط للفارة"
+msgstr "لتكبير نافذة عاموديا. استخدم زر التكبير مع الزر الاوسط للفارة."
 
 #: tips.cpp:29
 msgid "You can use Alt+Tab to switch between applications."
-msgstr "يمكنك استخدام Alt+Tab للتحويل بين البرامج"
+msgstr "يمكنك استخدام Alt+Tab للتحويل بين البرامج."
 
 #: tips.cpp:32
 msgid ""
 "Press Ctrl+Esc to show the applications running in your current session."
-msgstr "اضغط Ctrl+Esc لاظهار جميع البرامج التي تعمل في جلستك هذه"
+msgstr "اضغط Ctrl+Esc لاظهار جميع البرامج التي تعمل في جلستك هذه."
 
 #: tips.cpp:35
 msgid "Alt+F2 displays a small window that you can type a command into."
@@ -116,31 +117,31 @@
 #: src/amor.cpp:251
 msgctxt "@info:status"
 msgid "Error reading theme: "
-msgstr ""
+msgstr "خطا في قراءة السمة: "
 
 #: src/amor.cpp:261 src/amor.cpp:268
 msgctxt "@info:status"
 msgid "Error reading group: "
-msgstr ""
+msgstr "خطا في قراءة المجموعة: "
 
 #: src/amor.cpp:506
 msgctxt "@action:inmenu Amor"
 msgid "&Help"
-msgstr ""
+msgstr "&مساعدة"
 
 #: src/amor.cpp:510
 msgctxt "@action:inmenu Amor"
 msgid "&Configure..."
-msgstr ""
+msgstr "إ&عداد..."
 
 #: src/amor.cpp:513
 msgctxt "@action:inmenu Amor"
 msgid "&Quit"
-msgstr ""
+msgstr "ا&خرج"
 
 #: src/amordialog.cpp:40
 msgid "Options"
-msgstr ""
+msgstr "خيارات"
 
 #: src/amordialog.cpp:51
 msgid "Theme:"
@@ -160,7 +161,7 @@
 
 #: src/amordialog.cpp:89
 msgid "Use a random character"
-msgstr "استخم حرف عشوائي"
+msgstr "استخدم محرفاً عشوائيًّا"
 
 #: src/amordialog.cpp:94
 msgid "Allow application tips"
@@ -183,10 +184,12 @@
 "1999 by Martin R. Jones\n"
 "2010 by Stefan Böhmann"
 msgstr ""
+"1999 by Martin R. Jones\n"
+"2010 by Stefan Böhmann"
 
 #: src/main.cpp:45
 msgid "Stefan Böhmann"
-msgstr ""
+msgstr "Stefan Böhmann"
 
 #: src/main.cpp:46
 msgid "Current maintainer"
@@ -194,8 +197,8 @@
 
 #: src/main.cpp:53
 msgid "Martin R. Jones"
-msgstr ""
+msgstr "Martin R. Jones"
 
 #: src/main.cpp:59
 msgid "Gerardo Puga"
-msgstr ""
+msgstr "Gerardo Puga"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ark.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ark.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ark.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ark.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,993 +0,0 @@
-# translation of ark.po to Arabic
-# translation of ark.po to
-# Copyright (C) 2002,2003, 2004, 2006, 2007, 2008 Free Software Foundation, Inc.
-# Sayed Jaffer Al-Mosawi <mosawi@arabeyes.org>, 2002.
-# Anmar Oueja <anmar@canada.com>, 2003.
-# anmar oueja <anmar@canada.com>, 2003.
-# Nuriddin S. Aminagha <nuriddin@haydarlinux.org>, 2003.
-# Ahmad M. Zawawi <azawawi@emirates.net.ae>, 2004.
-# Munzir Taha <munzir@kacst.edu.sa>, 2004.
-# Khaled Hosny <dr.khaled.hosny@gmail.com>, 2006.
-# Fahad Al-Saidi <fahad.alsaidi@gmail.com>, 2007.
-# Youssef Chahibi <chahibi@gmail.com>, 2007.
-# Youness BOUTYOUR <niceboy@linuxac.org>, 2008.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-#
-msgid ""
-msgstr ""
-"Project-Id-Version: ark\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 13:31+0000\n"
-"PO-Revision-Date: 2012-01-25 11:07+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
-"3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:03+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"Language: ar\n"
-
-#: kerfuffle/batchextract.cpp:134 kerfuffle/batchextract.cpp:187
-msgid "Extracting file..."
-msgstr "يستخرج الملف..."
-
-#: kerfuffle/batchextract.cpp:135 kerfuffle/batchextract.cpp:188
-msgid "Source archive"
-msgstr "أرشيف المصدر"
-
-#: kerfuffle/batchextract.cpp:136 kerfuffle/batchextract.cpp:189
-msgid "Destination"
-msgstr "المقصد"
-
-#: kerfuffle/batchextract.cpp:149
-msgid "The following files could not be extracted:"
-msgstr "الملفات التالية لا يمكن استخراجها:"
-
-#: kerfuffle/batchextract.cpp:165
-msgid "There was an error during extraction."
-msgstr "يوجد خطأ أثناء الاستخراج."
-
-#: app/extractHereDndPlugin.cpp:64
-msgctxt ""
-"@action:inmenu Context menu shown when an archive is being drag'n'dropped"
-msgid "Extract here"
-msgstr ""
-
-#: app/main.cpp:41
-msgid "Ark"
-msgstr "أرك"
-
-#: app/main.cpp:42
-msgid "KDE Archiving tool"
-msgstr "أداة كدى للأرشفة"
-
-#: app/main.cpp:43
-msgid "(c) 1997-2010, The Various Ark Developers"
-msgstr "الحقوق محفوظة 1997-2010(c) ، شتى مطوري برنامج أرك"
-
-#: app/main.cpp:52
-msgid "Raphael Kubo da Costa"
-msgstr "Raphael Kubo da Costa"
-
-#: app/main.cpp:50 app/main.cpp:53
-msgid "Maintainer"
-msgstr "المشرف"
-
-#: app/main.cpp:49
-msgid "Harald Hvaal"
-msgstr "Harald Hvaal"
-
-#: app/main.cpp:56
-msgid "Former Maintainer"
-msgstr "المشرف السابق"
-
-#: app/main.cpp:55
-msgid "Henrique Pinto"
-msgstr "Henrique Pinto"
-
-#: app/main.cpp:58
-msgid "Helio Chissini de Castro"
-msgstr "Helio Chissini de Castro"
-
-#: app/main.cpp:59
-msgid "Former maintainer"
-msgstr "المشرف السابق"
-
-#: app/main.cpp:61
-msgid "Georg Robbers"
-msgstr "Georg Robbers"
-
-#: app/main.cpp:64
-msgid "Roberto Selbach Teixeira"
-msgstr "Roberto Selbach Teixeira"
-
-#: app/main.cpp:67
-msgid "Francois-Xavier Duranceau"
-msgstr "Francois-Xavier Duranceau"
-
-#: app/main.cpp:70
-msgid "Emily Ezust (Corel Corporation)"
-msgstr "Emily Ezust (Corel شركة)"
-
-#: app/main.cpp:73
-msgid "Michael Jarrett (Corel Corporation)"
-msgstr "Michael Jarrett (Corel شركة)"
-
-#: app/main.cpp:76
-msgid "Robert Palmbos"
-msgstr "Robert Palmbos"
-
-#: app/main.cpp:80
-msgid "Bryce Corkins"
-msgstr "Bryce Corkins"
-
-#: app/main.cpp:81
-msgid "Icons"
-msgstr "الأيقونات"
-
-#: app/main.cpp:83
-msgid "Liam Smit"
-msgstr "Liam Smit"
-
-#: app/main.cpp:84
-msgid "Ideas, help with the icons"
-msgstr "أفكار، ومساعدة مع الأيقونات"
-
-#: app/main.cpp:86
-msgid "Andrew Smith"
-msgstr "Andrew Smith"
-
-#: app/main.cpp:87
-msgid "bkisofs code"
-msgstr "bkisofs code"
-
-#: app/main.cpp:94
-msgid "URL of an archive to be opened"
-msgstr "وصلة أرشيف لتفتح"
-
-#: app/main.cpp:95
-msgid ""
-"Show a dialog for specifying the options for the operation (extract/add)"
-msgstr "اعرض حوار لتحديد خيارات العملية (استخرج/أضف)"
-
-#: app/main.cpp:96
-msgid ""
-"Destination folder to extract to. Defaults to current path if not specified."
-msgstr ""
-"المجلد المقصد الذي سيفك الضغط إليه. المبدئي هو المسار الحالي إذا لم يحدد."
-
-#: app/main.cpp:97
-msgid "Options for adding files"
-msgstr "خيارات إضافة الملفات"
-
-#: app/main.cpp:98
-msgid ""
-"Query the user for an archive filename and add specified files to it. Quit "
-"when finished."
-msgstr ""
-"اسأل المستخدم عن اسم الأرشيف و أضف الملفات المحددة إليه. اخرج عندما تنتهي."
-
-#: app/main.cpp:99
-msgid ""
-"Add the specified files to 'filename'. Create archive if it does not exist. "
-"Quit when finished."
-msgstr ""
-"أضف الملفات المحددة إلى 'اسم الملف'. و أنشئ أرشيف إذا لم يكن موجود. اخرج "
-"عندما تنتهي."
-
-#: app/main.cpp:100
-msgid ""
-"Change the current dir to the first entry and add all other entries relative "
-"to this one."
-msgstr ""
-"غيّر الدليل الحالي إلى أول مدخلة و أضف جميع المدخلات الباقية ذات الصلة إليها."
-
-#: app/main.cpp:101
-msgid ""
-"Automatically choose a filename, with the selected suffix (for example rar, "
-"tar.gz, zip or any other supported types)"
-msgstr ""
-"اختر اسم الملف بشكل تلقائي باللاحقة المختارة (على سبيل المثال rar  أو tar.gz "
-" أو أي نوع مدعوم)"
-
-#: app/main.cpp:102
-msgid "Options for batch extraction:"
-msgstr "خيارات الاستخراج بالدفعات:"
-
-#: app/main.cpp:103
-msgid ""
-"Use the batch interface instead of the usual dialog. This option is implied "
-"if more than one url is specified."
-msgstr ""
-"استخدم واجهة الدفعات بدلا عن الواجهة المعتادة. هذا الخيار  سيطبق إذا كان "
-"هناك أكثر من عنوان محدد."
-
-#: app/main.cpp:104
-msgid ""
-"The destination argument will be set to the path of the first file supplied."
-msgstr "ستوضع معاملات المقصد إلى مسار أول ملف معطى."
-
-#: app/main.cpp:104
-msgid ""
-"Archive contents will be read, and if detected to not be a single folder "
-"archive, a subfolder with the name of the archive will be created."
-msgstr ""
-"ستقرأ محتويات الأرشيف ، فإذا وجد أنها ليس أرشيف مجلد واحد ، فإن مجلد فرعي "
-"باسم الأرشيف سينشئ."
-
-#: app/mainwindow.cpp:126
-msgid "Unable to find Ark's KPart component, please check your installation."
-msgstr "غير قادر عن إيجاد مكون KPart الخاص بأرك، افحص تثبيتك."
-
-#: app/mainwindow.cpp:149
-msgctxt "action, to open an archive"
-msgid "Open"
-msgstr "افتح"
-
-#: app/mainwindow.cpp:150
-msgid ""
-"Click to open an archive, click and hold to open a recently-opened archive"
-msgstr "انقر لفتح أرشيف، انقر و اقبض لفتح أرشيف مفتوح حديثا."
-
-#: app/mainwindow.cpp:151
-msgid "Open an archive"
-msgstr "افتح أرشيف"
-
-#: kerfuffle/adddialog.cpp:61
-msgid "Compress to Archive"
-msgstr "اضغط إلى أرشيف"
-
-#: kerfuffle/addtoarchive.cpp:130
-msgid "No input files were given."
-msgstr "لم تعطى ملفات الإدخال"
-
-#: kerfuffle/addtoarchive.cpp:140
-msgid ""
-"You need to either supply a filename for the archive or a suffix (such as "
-"rar, tar.gz) with the <command>--autofilename</command> argument."
-msgstr ""
-
-#: kerfuffle/addtoarchive.cpp:174
-msgid ""
-"Failed to create the new archive. Permissions might not be sufficient."
-msgstr "فشل في إنشاء أرشيف جديد. قد تكون الصلاحيات غير كافية."
-
-#: kerfuffle/addtoarchive.cpp:172
-msgid "It is not possible to create archives of this type."
-msgstr "تعذّر إنشاء أرشيف من هذا النوع"
-
-#: kerfuffle/cliinterface.cpp:324
-#, kde-format
-msgctxt "@info"
-msgid "Failed to locate program <filename>%1</filename> in PATH."
-msgstr ""
-
-#: kerfuffle/cliinterface.cpp:487 kerfuffle/cliinterface.cpp:507
-msgid "Incorrect password."
-msgstr "كلمة سر خاطئة."
-
-#: kerfuffle/cliinterface.cpp:495 kerfuffle/cliinterface.cpp:515
-msgid "Extraction failed because of an unexpected error."
-msgstr "فشل الاستخراج بسبب خطأ غير متوقع."
-
-#: kerfuffle/extractiondialog.cpp:60
-msgctxt "@title:window"
-msgid "Extract"
-msgstr "الاستخراج"
-
-#: kerfuffle/extractiondialog.cpp:92
-msgid "Extract multiple archives"
-msgstr "استخراج عدة أرشيفات"
-
-#: kerfuffle/extractiondialog.cpp:98
-msgid "The subfolder name may not contain the character '/'."
-msgstr "اسم المجلد الفرعي لا ينبغي أن يحوي المحرف '/'."
-
-#: kerfuffle/extractiondialog.cpp:108
-#, kde-format
-msgctxt "@info"
-msgid ""
-"The folder <filename>%1</filename> already exists. Are you sure you want to "
-"extract here?"
-msgstr ""
-
-#: kerfuffle/extractiondialog.cpp:107
-msgid "Folder exists"
-msgstr "المجلد موجود"
-
-#: app/extractHereDndPlugin.cpp:69 kerfuffle/extractiondialog.cpp:107
-msgid "Extract here"
-msgstr "استخراج هنا"
-
-#: kerfuffle/extractiondialog.cpp:107 part/part.cpp:343 part/part.cpp:728
-msgid "Cancel"
-msgstr "ألغ"
-
-#: kerfuffle/extractiondialog.cpp:117 kerfuffle/extractiondialog.cpp:123
-#, kde-format
-msgctxt "@info"
-msgid "The folder <filename>%1</filename> could not be created."
-msgstr ""
-
-#: kerfuffle/extractiondialog.cpp:118
-#, kde-format
-msgctxt "@info"
-msgid "<filename>%1</filename> already exists, but is not a folder."
-msgstr ""
-
-#: kerfuffle/extractiondialog.cpp:123
-msgid "Please check your permissions to create it."
-msgstr "الرجاء تأكد من الصلاحيات لإنشائه."
-
-#: kerfuffle/jobs.cpp:134
-msgid "Loading archive..."
-msgstr "تحميل الأرشيف..."
-
-#: kerfuffle/jobs.cpp:194
-msgid "Extracting all files"
-msgstr "استخراج كل الملفات"
-
-#: kerfuffle/jobs.cpp:196
-#, kde-format
-msgid "Extracting one file"
-msgid_plural "Extracting %1 files"
-msgstr[0] "لا يوجد ملفات للاستخراج"
-msgstr[1] "استخراج ملف واحد"
-msgstr[2] "استخراج ملفين"
-msgstr[3] "استخراج %1 ملفات"
-msgstr[4] "استخراج %1 ملفا"
-msgstr[5] "استخراج %1 ملف"
-
-#: kerfuffle/jobs.cpp:231
-#, kde-format
-msgid "Adding a file"
-msgid_plural "Adding %1 files"
-msgstr[0] "لا يوجد ملف للإضافة"
-msgstr[1] "إضافة ملف واحد"
-msgstr[2] "إضافة ملفين"
-msgstr[3] "إضافة %1 ملفات"
-msgstr[4] "إضافة %1 ملفا"
-msgstr[5] "إضافة %1 ملف"
-
-#: kerfuffle/jobs.cpp:254
-#, kde-format
-msgid "Deleting a file from the archive"
-msgid_plural "Deleting %1 files"
-msgstr[0] "لا يوجد ملفات للحذف"
-msgstr[1] "حذف ملف واحد"
-msgstr[2] "حذف ملفان"
-msgstr[3] "حذف %1 عناصر"
-msgstr[4] "حذف %1 عنصرا"
-msgstr[5] "حذف %1 عنصر"
-
-#: kerfuffle/queries.cpp:97
-msgid "File already exists"
-msgstr "الملف موجود من قبل"
-
-#: kerfuffle/queries.cpp:178
-#, kde-format
-msgctxt "@info"
-msgid ""
-"The archive <filename>%1</filename> is password protected. Please enter the "
-"password to extract the file."
-msgstr ""
-
-#: kerfuffle/queries.cpp:181
-msgid "Incorrect password, please try again."
-msgstr "كلمة سر خاطئة ، الرجاء المحاولة مرة أخرى."
-
-# msgctxt "Name of a file inside an archive"
-#: part/archivemodel.cpp:307
-msgctxt "Name of a file inside an archive"
-msgid "Name"
-msgstr "الاسم"
-
-#: part/archivemodel.cpp:309
-msgctxt "Uncompressed size of a file inside an archive"
-msgid "Size"
-msgstr "الحجم"
-
-#: part/archivemodel.cpp:311
-msgctxt "Compressed size of a file inside an archive"
-msgid "Compressed"
-msgstr "الحجم المضغوط"
-
-#: part/archivemodel.cpp:313
-msgctxt "Compression rate of file"
-msgid "Rate"
-msgstr "المعدل"
-
-#: part/archivemodel.cpp:315
-msgctxt "File's owner username"
-msgid "Owner"
-msgstr "المالك"
-
-#: part/archivemodel.cpp:317
-msgctxt "File's group"
-msgid "Group"
-msgstr "المجموعة"
-
-#: part/archivemodel.cpp:319
-msgctxt "File permissions"
-msgid "Mode"
-msgstr "النمط"
-
-#: part/archivemodel.cpp:321
-msgctxt "CRC hash code"
-msgid "CRC"
-msgstr "رمز CRC"
-
-#: part/archivemodel.cpp:323
-msgctxt "Compression method"
-msgid "Method"
-msgstr "الطريقة"
-
-#: part/archivemodel.cpp:326
-msgctxt "File version"
-msgid "Version"
-msgstr "الإصدارة"
-
-#: part/archivemodel.cpp:328
-msgctxt "Timestamp"
-msgid "Date"
-msgstr "التاريخ"
-
-#: part/archivemodel.cpp:330
-msgctxt "File comment"
-msgid "Comment"
-msgstr "الملاحظات"
-
-#: part/archivemodel.cpp:332
-msgctxt "Unnamed column"
-msgid "??"
-msgstr "؟؟"
-
-#: part/arkviewer.cpp:63
-msgid "Closing preview"
-msgstr "يغلق المعاينة"
-
-#: part/arkviewer.cpp:64
-msgid "Please wait while the preview is being closed..."
-msgstr "الرجاء الانتظار حالما يتم غلق المعاينة..."
-
-#: part/arkviewer.cpp:80 part/arkviewer.cpp:87
-msgid "The internal viewer cannot preview this file."
-msgstr "العارض الداخلي لا يمكنه معاينة هذا الملف."
-
-#: part/infopanel.cpp:67
-msgid "No archive loaded"
-msgstr "لم يحمل أي أرشيف"
-
-#: part/infopanel.cpp:113
-msgid "Symbolic Link"
-msgstr "وصلة رمزية"
-
-#: part/infopanel.cpp:118
-msgid "Unknown size"
-msgstr "حجم مجهول"
-
-#: part/infopanel.cpp:140
-#, kde-format
-msgid "One file selected"
-msgid_plural "%1 files selected"
-msgstr[0] "لا يوجد ملفات محدد"
-msgstr[1] "ملف واحد محدد"
-msgstr[2] "ملفان محددان"
-msgstr[3] "%1 ملفات محددة"
-msgstr[4] "%1 ملفا محدد"
-msgstr[5] "%1 ملف محدد"
-
-#: part/infopanel.cpp:188
-#, kde-format
-msgid "<b>Type:</b> %1<br/>"
-msgstr "<b>النوع:</b> %1<br/>"
-
-#: part/infopanel.cpp:191
-#, kde-format
-msgid "<b>Owner:</b> %1<br/>"
-msgstr "<b>المالك:</b> %1<br/>"
-
-#: part/infopanel.cpp:195
-#, kde-format
-msgid "<b>Group:</b> %1<br/>"
-msgstr "<b>المجموعة:</b> %1<br/>"
-
-#: part/infopanel.cpp:199
-#, kde-format
-msgid "<b>Target:</b> %1<br/>"
-msgstr "<b>الهدف:</b> %1<br/>"
-
-#: part/infopanel.cpp:203
-msgid "<b>Password protected:</b> Yes<br/>"
-msgstr "<b>محمي بكلمة سر:</b> نعم<br/>"
-
-#: part/part.cpp:228
-msgctxt "@action:inmenu"
-msgid "Show information panel"
-msgstr "أظهر لوحة المعلومات"
-
-#: part/part.cpp:220
-msgctxt "to preview a file inside an archive"
-msgid "Pre&view"
-msgstr "&عاين"
-
-#: part/part.cpp:222
-msgid "Click to preview the selected file"
-msgstr "انقر لمعاينة الملف المنتقى"
-
-#: part/part.cpp:227
-msgid "E&xtract"
-msgstr "ا&ستخراج"
-
-#: part/part.cpp:229
-msgid ""
-"Click to open an extraction dialog, where you can choose to extract either "
-"all files or just the selected ones"
-msgstr ""
-"انقر لفتح حوار استخراج، حيث يمكنك اختيار لاستخراج كل الملفات أو المحددة فقط"
-
-#: part/part.cpp:236
-msgid "Add &File..."
-msgstr "أ&ضف ملف..."
-
-#: part/part.cpp:237
-msgid "Click to add files to the archive"
-msgstr "انقر لإضافة ملفات إلى الأرشيف"
-
-#: part/part.cpp:243
-msgid "Add Fo&lder..."
-msgstr "أضف &مجلد..."
-
-#: part/part.cpp:244
-msgid "Click to add a folder to the archive"
-msgstr "انقر لإضافة مجلد إلى الأرشيف"
-
-#: part/part.cpp:250
-msgid "De&lete"
-msgstr "ا&حذف"
-
-#: part/part.cpp:252
-msgid "Click to delete the selected files"
-msgstr "انقر لحذف الملفات المحددة؟"
-
-#: part/part.cpp:298
-msgid "Extract To..."
-msgstr ""
-
-#: part/part.cpp:277
-msgid "Quick Extract To..."
-msgstr "استخرج سريع إلى..."
-
-#: part/part.cpp:334
-msgid "ArkPart"
-msgstr "أرك بارت"
-
-#: part/part.cpp:380
-#, kde-format
-msgctxt "@info"
-msgid "<filename>%1</filename> is a directory."
-msgstr ""
-
-#: part/part.cpp:387
-#, kde-format
-msgctxt "@info"
-msgid ""
-"The archive <filename>%1</filename> already exists. Would you like to open "
-"it instead?"
-msgstr ""
-
-#: part/part.cpp:387
-msgctxt "@title:window"
-msgid "File Exists"
-msgstr "الملف موجود"
-
-#: part/part.cpp:343
-msgid "Open File"
-msgstr "افتح ملف"
-
-#: part/part.cpp:395
-#, kde-format
-msgctxt "@info"
-msgid "The archive <filename>%1</filename> was not found."
-msgstr ""
-
-#: part/part.cpp:395 part/part.cpp:447 part/part.cpp:483
-msgctxt "@title:window"
-msgid "Error Opening Archive"
-msgstr "خطأ في فتح الأرشيف"
-
-#: part/part.cpp:427
-msgctxt "@title:window"
-msgid "Invalid Archive Type"
-msgstr ""
-
-#: part/part.cpp:428
-msgctxt "@info"
-msgid ""
-"Ark cannot create archives of the type you have chosen.<nl/><nl/>Please "
-"choose another archive type below."
-msgstr ""
-
-#: part/part.cpp:431
-msgctxt "@title:window"
-msgid "Unable to Determine Archive Type"
-msgstr "لم يستطع تحديد نوع الأرشيف"
-
-#: part/part.cpp:432
-msgctxt "@info"
-msgid ""
-"Ark was unable to determine the archive type of the "
-"filename.<nl/><nl/>Please choose the correct archive type below."
-msgstr ""
-
-#: part/part.cpp:447
-#, kde-format
-msgctxt "@info"
-msgid ""
-"Ark was not able to open the archive <filename>%1</filename>. No plugin "
-"capable of handling the file was found."
-msgstr ""
-
-#: part/part.cpp:483
-#, kde-format
-msgctxt "@info"
-msgid ""
-"Loading the archive <filename>%1</filename> failed with the following error: "
-"<message>%2</message>"
-msgstr ""
-
-#: part/part.cpp:778
-msgctxt "@title:window"
-msgid "Add Files"
-msgstr "أضف ملفات"
-
-#: part/part.cpp:786
-msgctxt "@title:window"
-msgid "Add Folder"
-msgstr "أضف مجلد"
-
-#: part/part.cpp:728
-msgid ""
-"Deleting these files is not undoable. Are you sure you want to do this?"
-msgstr "لا يمكن حذف الملفات ، هل أنت متأكد أنك تريد فعل هذا؟"
-
-#: part/part.cpp:816
-msgctxt "@title:window"
-msgid "Delete files"
-msgstr "احذف الملفات"
-
-#: part/part.cpp:862
-#, kde-format
-msgctxt "@info"
-msgid ""
-"An archive named <filename>%1</filename> already exists. Are you sure you "
-"want to overwrite it?"
-msgstr ""
-
-#: part/part.cpp:876
-#, kde-format
-msgctxt "@info"
-msgid ""
-"The archive <filename>%1</filename> cannot be copied to the specified "
-"location. The archive does not exist anymore."
-msgstr ""
-
-#: part/part.cpp:888
-#, kde-format
-msgctxt "@info"
-msgid ""
-"The archive could not be saved as <filename>%1</filename>. Try saving it to "
-"another location."
-msgstr ""
-
-#: plugins/karchiveplugin/karchiveplugin.cpp:64
-#: plugins/karchiveplugin/karchiveplugin.cpp:74
-#, kde-format
-msgctxt "@info"
-msgid "Could not open the archive <filename>%1</filename> for reading"
-msgstr ""
-
-#: plugins/karchiveplugin/karchiveplugin.cpp:82
-#, kde-format
-msgctxt "@info"
-msgid "File <filename>%1</filename> not found in the archive"
-msgstr ""
-
-#: plugins/karchiveplugin/karchiveplugin.cpp:151
-#, kde-format
-msgctxt "@info"
-msgid "Could not open the archive <filename>%1</filename> for writing."
-msgstr ""
-
-#: plugins/karchiveplugin/karchiveplugin.cpp:168
-#, kde-format
-msgctxt "@info"
-msgid "Could not add the directory <filename>%1</filename> to the archive"
-msgstr ""
-
-#: plugins/karchiveplugin/karchiveplugin.cpp:176
-#, kde-format
-msgctxt "@info"
-msgid "Could not add the file <filename>%1</filename> to the archive."
-msgstr ""
-
-#: plugins/libarchive/libarchivehandler.cpp:102
-#: plugins/libarchive/libarchivehandler.cpp:159
-#, kde-format
-msgctxt "@info"
-msgid ""
-"Could not open the archive <filename>%1</filename>, libarchive cannot handle "
-"it."
-msgstr ""
-
-#: plugins/libarchive/libarchivehandler.cpp:125
-#, kde-format
-msgctxt "@info"
-msgid ""
-"The archive reading failed with the following error: <message>%1</message>"
-msgstr ""
-
-#: plugins/libarchive/libarchivehandler.cpp:179
-msgid ""
-"This archive contains archive entries with absolute paths, which are not yet "
-"supported by ark."
-msgstr ""
-"هذا الأرشيف يحوي على مدخلات ذات مسارات مطلقة و التي لا يدعمها أرك حتى الآن."
-
-#: plugins/libarchive/libarchivehandler.cpp:316
-#: plugins/libarchive/libarchivehandler.cpp:489
-msgid "The archive reader could not be initialized."
-msgstr "لا يمكن بدء قارئ الأرشيف"
-
-#: plugins/libarchive/libarchivehandler.cpp:324
-#: plugins/libarchive/libarchivehandler.cpp:497
-msgid "The source file could not be read."
-msgstr "لم يمكن قراءة ملف المصدر"
-
-#: plugins/libarchive/libarchivehandler.cpp:332
-#: plugins/libarchive/libarchivehandler.cpp:504
-msgid "The archive writer could not be initialized."
-msgstr "لا يمكن بدء كاتب الأرشيف"
-
-#: plugins/libarchive/libarchivehandler.cpp:399
-#: plugins/libarchive/libarchivehandler.cpp:431
-#: plugins/libarchive/libarchivehandler.cpp:576
-#, kde-format
-msgctxt "@info"
-msgid ""
-"Setting the compression method failed with the following error: "
-"<message>%1</message>"
-msgstr ""
-
-#: plugins/libarchive/libarchivehandler.cpp:395
-#: plugins/libarchive/libarchivehandler.cpp:532
-#, kde-format
-msgid "The compression type '%1' is not supported by Ark."
-msgstr "أرك لا يدعم نوعية الضغط  '%1' ."
-
-#: plugins/libarchive/libarchivehandler.cpp:438
-#: plugins/libarchive/libarchivehandler.cpp:582
-#, kde-format
-msgctxt "@info"
-msgid ""
-"Opening the archive for writing failed with the following error: "
-"<message>%1</message>"
-msgstr ""
-
-#: plugins/libarchive/libarchivehandler.cpp:761
-#, kde-format
-msgctxt "@info Error in a message box"
-msgid "Ark could not compress <filename>%1</filename>:<nl/>%2"
-msgstr ""
-
-#: plugins/libsinglefileplugin/singlefileplugin.cpp:69
-#, kde-format
-msgctxt "@info"
-msgid "Ark could not extract <filename>%1</filename>."
-msgstr ""
-
-#: plugins/libsinglefileplugin/singlefileplugin.cpp:77
-#, kde-format
-msgctxt "@info"
-msgid "Ark could not open <filename>%1</filename> for extraction."
-msgstr ""
-
-#: plugins/libsinglefileplugin/singlefileplugin.cpp:91
-#, kde-format
-msgctxt "@info"
-msgid ""
-"There was an error while reading <filename>%1</filename> during extraction."
-msgstr ""
-
-#: rc.cpp:1
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr ""
-"Youness BOUTYOUR,زايد السعيدي, ,Launchpad Contributions:,Khaled Hosny,Munzir "
-"Taha,Phil,Youness BOUTYOUR,Youssef Chahibi"
-
-#: rc.cpp:2
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr ""
-"niceboy120@gmail.com,zayed.alsaidi@gmail.com,,,khaledhosny@eglug.org,,,nicebo"
-"y@linuxac.org,"
-
-#. i18n: file: part/ark_part.rc:5
-#. i18n: ectx: Menu (file)
-#: rc.cpp:5
-msgid "&File"
-msgstr "&ملف"
-
-#. i18n: file: part/ark_part.rc:9
-#. i18n: ectx: Menu (action)
-#: rc.cpp:8
-msgid "&Action"
-msgstr "الإ&جراء"
-
-#. i18n: file: part/ark_part.rc:17
-#. i18n: ectx: Menu (settings)
-#: rc.cpp:11
-msgid "&Settings"
-msgstr "إ&عدادات"
-
-#. i18n: file: app/arkui.rc:13
-#. i18n: ectx: ToolBar (mainToolBar)
-#: rc.cpp:14
-msgid "Main Toolbar"
-msgstr "شريط الأدوات الرئيسي"
-
-#. i18n: file: part/infopanel.ui:20
-#. i18n: ectx: property (windowTitle), widget (QWidget, InformationPanel)
-#: rc.cpp:17
-msgid "Information Panel"
-msgstr "لوحة المعلومات"
-
-#. i18n: file: part/infopanel.ui:58
-#. i18n: ectx: property (text), widget (QLabel, additionalInfo)
-#: rc.cpp:21
-msgid "Unknown file type"
-msgstr "نوع الملف غير معروف"
-
-#. i18n: file: part/infopanel.ui:75
-#. i18n: ectx: property (text), widget (QLabel, metadataLabel)
-#: rc.cpp:24
-msgid "Metadata Label"
-msgstr "المعلومات العامة"
-
-#. i18n: file: part/infopanel.ui:95
-#. i18n: ectx: property (text), widget (QLabel, actionsLabel)
-#: rc.cpp:27
-msgid "ActionsLabel"
-msgstr "أعمال"
-
-#. i18n: file: part/jobtracker.ui:13
-#. i18n: ectx: property (windowTitle), widget (QWidget, JobTrackerWidget)
-#: rc.cpp:30
-msgid "Job Tracker"
-msgstr "متقفي العمل"
-
-#. i18n: file: part/jobtracker.ui:43
-#. i18n: ectx: property (text), widget (QLabel, descriptionLabel)
-#: rc.cpp:33
-msgid "<b>Job Description</b>"
-msgstr "<b>وصف العمل</b>"
-
-#. i18n: file: part/jobtracker.ui:62
-#. i18n: ectx: property (text), widget (QLabel, informationLabel)
-#: rc.cpp:36
-msgid "Some Information about the job"
-msgstr "بعض المعلومات حول العمل"
-
-#. i18n: file: kerfuffle/adddialog.ui:28
-#. i18n: ectx: property (title), widget (QGroupBox, groupCompressFiles)
-#: rc.cpp:39
-msgid "Files/Folders to Compress"
-msgstr "الملفات/الملجدات المراد ضغطها"
-
-#. i18n: file: kerfuffle/adddialog.ui:92
-#. i18n: ectx: property (title), widget (QGroupBox, groupExtraOptions)
-#: rc.cpp:42
-msgid "Extra Compression Options"
-msgstr "خيارات ضغط إضافية"
-
-#. i18n: file: kerfuffle/adddialog.ui:99
-#. i18n: ectx: property (text), widget (QLabel, label)
-#: rc.cpp:45
-msgid ""
-"Easter egg for the developers:\n"
-"This is where future versions will have extra compression options for the "
-"various compression interfaces."
-msgstr ""
-"هدية للمطورين:\n"
-"هذا المكان حيث ستملك الإصدارات القادمة فيه خيارات ضغط إضافية لمختلف واجهات "
-"الضغط."
-
-#. i18n: file: kerfuffle/extractiondialog.ui:20
-#. i18n: ectx: property (windowTitle), widget (QWidget, ExtractionDialog)
-#: rc.cpp:49
-msgid "Extraction Dialog"
-msgstr "مربع حوار اللاستخراج"
-
-#. i18n: file: kerfuffle/extractiondialog.ui:69
-#. i18n: ectx: property (text), widget (QLabel, extractAllLabel)
-#: rc.cpp:52
-msgid "Extract All Files"
-msgstr "استخراج كل الملفات"
-
-#. i18n: file: kerfuffle/extractiondialog.ui:78
-#. i18n: ectx: property (title), widget (QGroupBox, singleFolderGroup)
-#: rc.cpp:55
-msgid "&Extraction into subfolder:"
-msgstr "اس&تخرج في مجلد فرعي:"
-
-#. i18n: file: kerfuffle/extractiondialog.ui:112
-#. i18n: ectx: property (title), widget (QGroupBox, groupBox)
-#: rc.cpp:58
-msgid "Options"
-msgstr "الخيارات"
-
-#. i18n: file: kerfuffle/extractiondialog.ui:131
-#. i18n: ectx: property (text), widget (QCheckBox, openFolderCheckBox)
-#: rc.cpp:61
-msgid "Open &destination folder after extraction"
-msgstr "افتح مجلد ال&مقصد بعد الاستخراج"
-
-#. i18n: file: kerfuffle/extractiondialog.ui:138
-#. i18n: ectx: property (text), widget (QCheckBox, closeAfterExtraction)
-#: rc.cpp:64
-msgid "Close &Ark after extraction"
-msgstr "أغلق أ&رك بعد الاستخراج"
-
-#. i18n: file: kerfuffle/extractiondialog.ui:138
-#. i18n: ectx: property (text), widget (QCheckBox, preservePaths)
-#: rc.cpp:64
-msgid "&Preserve paths when extracting"
-msgstr "&حافظ على المسارات أثناء الاستخراج"
-
-#. i18n: file: kerfuffle/extractiondialog.ui:145
-#. i18n: ectx: property (text), widget (QCheckBox, autoSubfolders)
-#: rc.cpp:67
-msgid "&Automatically create subfolders"
-msgstr "أ&نشئ المجلدات الفرعية تلقائيا"
-
-#. i18n: file: kerfuffle/extractiondialog.ui:161
-#. i18n: ectx: property (title), widget (QGroupBox, filesToExtractGroupBox)
-#: rc.cpp:70
-msgctxt "@title:group"
-msgid "Extract"
-msgstr "استخراج"
-
-#. i18n: file: kerfuffle/extractiondialog.ui:179
-#. i18n: ectx: property (text), widget (QRadioButton, selectedFilesButton)
-#: rc.cpp:73
-msgid "&Selected files only"
-msgstr "ال&ملفات المنتقاة فقط"
-
-#. i18n: file: kerfuffle/extractiondialog.ui:195
-#. i18n: ectx: property (text), widget (QRadioButton, allFilesButton)
-#: rc.cpp:76
-msgid "All &files"
-msgstr "&كل الملفات"
-
-#. i18n: file: kerfuffle/ark.kcfg:9
-#. i18n: ectx: label, entry (openDestinationFolderAfterExtraction), group (Extraction)
-#: rc.cpp:79
-msgid "Open destination folder after extraction"
-msgstr "افتح مجلد المقصد بعد الاستخراج"
-
-#. i18n: file: kerfuffle/ark.kcfg:13
-#. i18n: ectx: label, entry (closeAfterExtraction), group (Extraction)
-#: rc.cpp:85
-msgid "Close Ark after extraction"
-msgstr "أغلق أرك بعد الاستخراج"
-
-#. i18n: file: kerfuffle/ark.kcfg:13
-#. i18n: ectx: label, entry (preservePaths), group (Extraction)
-#: rc.cpp:82
-msgid "Preserve paths when extracting"
-msgstr "حافظ على المسارات أثناء الاستخراج"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/attica_kde.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/attica_kde.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/attica_kde.po	2012-02-23 06:20:24.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/attica_kde.po	2012-03-23 06:41:56.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:28+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:38+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kdeplatformdependent.cpp:103
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/audiocd_encoder_lame.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/audiocd_encoder_lame.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/audiocd_encoder_lame.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/audiocd_encoder_lame.po	2012-03-23 06:41:39.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:57+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:54+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #. i18n: file: encoderlameconfig.ui:16
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/audiocd_encoder_vorbis.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/audiocd_encoder_vorbis.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/audiocd_encoder_vorbis.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/audiocd_encoder_vorbis.po	2012-03-23 06:41:39.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:58+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:54+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #. i18n: file: encodervorbisconfig.ui:16
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/audiorename_plugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/audiorename_plugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/audiorename_plugin.po	2012-02-23 06:20:24.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/audiorename_plugin.po	2012-03-23 06:41:56.000000000 +0000
@@ -16,8 +16,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:29+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:38+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: audio_plugin.cpp:72
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/autorefresh.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/autorefresh.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/autorefresh.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/autorefresh.po	2012-03-23 06:41:59.000000000 +0000
@@ -1,24 +1,25 @@
 # translation of autorefresh.po to Arabic
 # translation of autorefresh.po to
 # Copyright (C) 2004, 2006, 2007, 2008 Free Software Foundation, Inc.
-#
 # Ahmad M. Zawawi <azawawi@emirates.net.ae>, 2004.
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
+# Abdalrahim G. Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: autorefresh\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2009-03-19 16:28+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"PO-Revision-Date: 2012-03-12 22:33+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:30+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:13+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: autorefresh.cpp:42
 msgid "&Auto Refresh"
@@ -62,16 +63,16 @@
 
 #: autorefresh.cpp:55
 msgid "Every 2 Hours"
-msgstr ""
+msgstr "كل ساعتين"
 
 #: autorefresh.cpp:56
 msgid "Every 6 Hours"
-msgstr ""
+msgstr "كل 6 ساعات"
 
 #: autorefresh.cpp:113
 msgctxt "@title:window"
 msgid "Cannot Refresh Source"
-msgstr ""
+msgstr "غير قادر على تحديث المصدر"
 
 #: autorefresh.cpp:114
 msgid "<qt>This plugin cannot auto-refresh the current part.</qt>"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/babelfish.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/babelfish.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/babelfish.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/babelfish.po	2012-03-23 06:41:59.000000000 +0000
@@ -1,26 +1,27 @@
 # translation of babelfish.po to Arabic
 # translation of babelfish.po to
 # Copyright (C) 2001,2002, 2004, 2006, 2007, 2008 Free Software Foundation, Inc.
-#
 # Mohammed Gamal <f2c2001@yahoo.com>, 2001.
 # Isam Bayazidi <bayazidi@arabeyes.org>, 2002.
 # Ahmad M. Zawawi <azawawi@emirates.net.ae>, 2004.
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
+# Abdalrahim G. Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: babelfish\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2009-07-10 17:31+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"PO-Revision-Date: 2012-03-12 22:32+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:31+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:14+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: plugin_babelfish.cpp:54
 msgid "Translate Web Page"
@@ -28,7 +29,7 @@
 
 #: plugin_babelfish.cpp:65
 msgid "Translate Web &Page"
-msgstr "ترجم ال&صفحة على الشبكة"
+msgstr "ترجم &صفحة وِب"
 
 #: plugin_babelfish.cpp:101
 msgid "&English To"
@@ -44,7 +45,7 @@
 
 #: plugin_babelfish.cpp:110
 msgid "&Greek To"
-msgstr ""
+msgstr "ال&يونانية إلى"
 
 #: plugin_babelfish.cpp:113
 msgid "&Spanish To"
@@ -64,7 +65,7 @@
 
 #: plugin_babelfish.cpp:125
 msgid "&Russian To"
-msgstr ""
+msgstr "ال&روسية إلى"
 
 #: plugin_babelfish.cpp:141
 msgid "&Chinese (Simplified)"
@@ -90,7 +91,7 @@
 
 #: plugin_babelfish.cpp:146 plugin_babelfish.cpp:159
 msgid "&Greek"
-msgstr ""
+msgstr "ال&يونانية"
 
 #: plugin_babelfish.cpp:147 plugin_babelfish.cpp:160
 msgid "&Italian"
@@ -126,7 +127,7 @@
 
 #: plugin_babelfish.cpp:155
 msgid "&Arabic"
-msgstr ""
+msgstr "ال&عربية"
 
 #: plugin_babelfish.cpp:157 plugin_babelfish.cpp:164 plugin_babelfish.cpp:166
 #: plugin_babelfish.cpp:168 plugin_babelfish.cpp:170 plugin_babelfish.cpp:172
@@ -153,7 +154,7 @@
 #: plugin_babelfish.cpp:291
 msgctxt "@title:window"
 msgid "Malformed URL"
-msgstr ""
+msgstr "عنوان مشوَّه"
 
 #: plugin_babelfish.cpp:292
 msgid "The URL you entered is not valid, please correct it and try again."
@@ -163,13 +164,13 @@
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
 msgstr ""
-"محمد سعد Mohamed SAAD, ,Launchpad Contributions:,Ahmad M. Zawawi,Zayed Amer "
-"Al-Saidi,metehyi"
+"محمد سعد Mohamed SAAD, ,Launchpad Contributions:,Abdalrahim G. "
+"Fakhouri,Ahmad M. Zawawi,Zayed Amer Al-Saidi,metehyi"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "metehyi@free.fr,,,,zayed.alsaidi@gmail.com,"
+msgstr "metehyi@free.fr,,,,,zayed.alsaidi@gmail.com,"
 
 #. i18n: file: plugin_babelfish.rc:4
 #. i18n: ectx: Menu (tools)
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/bomber.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/bomber.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/bomber.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/bomber.po	2012-03-23 06:41:38.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:39+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:44+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: rc.cpp:1 rc.cpp:1
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/bovo.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/bovo.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/bovo.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/bovo.po	2012-03-23 06:41:38.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:39+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:44+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: rc.cpp:1
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/calendarsupport.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/calendarsupport.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/calendarsupport.po	2012-02-23 06:20:10.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/calendarsupport.po	2012-03-23 06:41:41.000000000 +0000
@@ -7,14 +7,14 @@
 "Project-Id-Version: akonadi-kcal\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 03:45+0000\n"
-"PO-Revision-Date: 2012-01-25 21:29+0000\n"
+"PO-Revision-Date: 2012-03-13 23:21+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:21+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:07+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: archivedialog.cpp:64
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/cervisia.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/cervisia.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/cervisia.po	2012-02-23 06:20:11.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/cervisia.po	2012-03-23 06:41:42.000000000 +0000
@@ -20,11 +20,9 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:47+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Poedit-Country: JORDAN\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:22+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
-"X-Poedit-SourceCharset: utf-8\n"
 
 #: addignoremenu.cpp:38
 msgid "Add to Ignore List"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/choqok.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/choqok.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/choqok.po	2012-02-23 06:20:22.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/choqok.po	2012-03-23 06:41:53.000000000 +0000
@@ -16,8 +16,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:55+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:31+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: choqok/main.cpp:33
 msgid "KDE Micro-Blogging Client."
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/cvsservice.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/cvsservice.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/cvsservice.po	2012-02-23 06:20:11.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/cvsservice.po	2012-03-23 06:41:42.000000000 +0000
@@ -9,14 +9,14 @@
 "Project-Id-Version: cvsservice\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 16:09+0000\n"
-"PO-Revision-Date: 2012-01-26 20:59+0000\n"
+"PO-Revision-Date: 2012-03-14 18:29+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:48+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:22+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: cvsaskpass.cpp:34
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdeaccessibility.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdeaccessibility.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdeaccessibility.po	2012-02-23 06:20:06.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdeaccessibility.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,131 +0,0 @@
-# translation of desktop_kdeaccessibility.po to
-# Hafid BENHADRIA <ghosn@php4arab.info>, 2003.
-# Ahmad M. Zawawi <azawawi@emirates.net.ae>, 2004.
-# Anas Husseini <linux.anas@gmail.com>, 2007.
-# Youssef Chahibi <chahibi@gmail.com>, 2007.
-# Copyright (C) 2003, 2004, 2007 Free Software Foundation, Inc.
-msgid ""
-msgstr ""
-"Project-Id-Version: desktop_kdeaccessibility\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 04:10+0000\n"
-"PO-Revision-Date: 2011-01-05 22:13+0000\n"
-"Last-Translator: Youssef Chahibi <Unknown>\n"
-"Language-Team: <en@li.org>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:28+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-
-#: jovie/filters/stringreplacer/jovie_stringreplacerplugin.desktop:2
-msgctxt "Name"
-msgid "String Replacer"
-msgstr "مستبدل النصوص"
-
-#: jovie/filters/stringreplacer/jovie_stringreplacerplugin.desktop:63
-msgctxt "Comment"
-msgid "Generic String Replacement Filter Plugin for Jovie"
-msgstr ""
-
-#: jovie/filters/talkerchooser/jovie_talkerchooserplugin.desktop:2
-msgctxt "Name"
-msgid "Talker Chooser"
-msgstr "منتقي المتكلم"
-
-#: jovie/filters/talkerchooser/jovie_talkerchooserplugin.desktop:61
-msgctxt "Comment"
-msgid "Generic Talker Chooser Filter Plugin for Jovie"
-msgstr ""
-
-#: jovie/filters/xmltransformer/jovie_xmltransformerplugin.desktop:2
-msgctxt "Name"
-msgid "XML Transformer"
-msgstr "محول XML"
-
-#: jovie/filters/xmltransformer/jovie_xmltransformerplugin.desktop:61
-msgctxt "Comment"
-msgid "Generic XML Transformation Filter Plugin for Jovie"
-msgstr ""
-
-#: jovie/jovie/jovie.desktop:8 jovie/jovie/jovieapp.desktop:8
-#: jovie/jovie/kttsd.desktop:8 jovie/libkttsd/kttsd_synthplugin.desktop:2
-msgctxt "Name"
-msgid "Jovie"
-msgstr ""
-
-#: jovie/jovie/jovie.desktop:44 jovie/jovie/jovieapp.desktop:44
-#: jovie/jovie/kttsd.desktop:44
-msgctxt "Comment"
-msgid "KDE Text To Speech Service"
-msgstr ""
-
-#: jovie/kcmkttsmgr/kcmkttsd.desktop:14
-msgctxt "Name"
-msgid "Text-to-Speech"
-msgstr "نص-إلى-صوت"
-
-#: jovie/kcmkttsmgr/kcmkttsd.desktop:78
-msgctxt "Comment"
-msgid "Text-to-Speech Control Module"
-msgstr "وحدة تحكم نص-إلى-صوت"
-
-#: jovie/kcmkttsmgr/kcmkttsd_testmessage.desktop:5
-msgctxt "Name"
-msgid "The text-to-speech system seems to be functioning properly."
-msgstr "نظام نص-إلى-صوت يعمل بشكل جيد ظاهرياً."
-
-#: kmag/kmag.desktop:8
-msgctxt "Name"
-msgid "KMag"
-msgstr "مكبَر كي"
-
-#: kmag/kmag.desktop:71
-msgctxt "GenericName"
-msgid "Screen Magnifier"
-msgstr "مكبَر الشاشة"
-
-#: kmousetool/kmousetool/kmousetool.desktop:7
-msgctxt "Comment"
-msgid "Clicks the mouse for you, reducing the effects of RSI"
-msgstr "ينقر على الفأرة بدلاً عنك، مُخَفِّفاً عنك تأثيرات RSI"
-
-#: kmousetool/kmousetool/kmousetool.desktop:70
-msgctxt "Name"
-msgid "KMouseTool"
-msgstr "أداة فأرة كي"
-
-#: kmousetool/kmousetool/kmousetool.desktop:136
-msgctxt "GenericName"
-msgid "Automatic Mouse Click"
-msgstr "نقر الفأرة التلقائي"
-
-#: kmouth/books/de.desktop:2
-msgctxt "Name"
-msgid "German"
-msgstr "ألماني"
-
-#: kmouth/books/en.desktop:3
-msgctxt "Name"
-msgid "English"
-msgstr "إنجليزي"
-
-#: kmouth/books/nl.desktop:3
-msgctxt "Name"
-msgid "Dutch"
-msgstr "هولندي"
-
-#: kmouth/books/sv.desktop:3
-msgctxt "Name"
-msgid "Swedish"
-msgstr "سويدي"
-
-#: kmouth/kmouth.desktop:8
-msgctxt "Name"
-msgid "KMouth"
-msgstr "فم كي"
-
-#: kmouth/kmouth.desktop:73
-msgctxt "GenericName"
-msgid "Speech Synthesizer Frontend"
-msgstr "واجهة تحليل النطق"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdeadmin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdeadmin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdeadmin.po	2012-02-23 06:20:06.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdeadmin.po	2012-03-23 06:41:37.000000000 +0000
@@ -10,14 +10,14 @@
 "Project-Id-Version: desktop_kdeadmin\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 02:38+0000\n"
-"PO-Revision-Date: 2012-01-25 11:27+0000\n"
+"PO-Revision-Date: 2012-03-12 22:23+0000\n"
 "Last-Translator: Youssef Chahibi <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:31+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:39+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kcron/src/kcm_cron.desktop:14
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kde-baseapps.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kde-baseapps.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kde-baseapps.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kde-baseapps.po	2012-03-23 06:41:59.000000000 +0000
@@ -1,25 +1,26 @@
 # translation of desktop_kdebase.po to Arabic
+# translation of desktop_kdebase.po to
+#
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # Abdulaziz AlSharif <a.a-a.s@hotmail.com>, 2007.
 # محمد الحرقان <imksa@hotmail.com>, 2008.
 # Anas Husseini <linux.anas@gmail.com>, 2008.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
 # Gabi Sarkis <gfsarkis@gmail.com>, 2010.
-# translation of desktop_kdebase.po to
-#
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: desktop_kdebase\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2011-12-09 08:51+0000\n"
-"Last-Translator: Gabi Sarkis <Unknown>\n"
+"PO-Revision-Date: 2012-03-12 22:33+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:32+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:14+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: apps/dolphin/src/dolphin.desktop:2
@@ -167,7 +168,7 @@
 #: konq-plugins/adblock/plugin_adblock.desktop:2
 msgctxt "Name"
 msgid "Adblock"
-msgstr ""
+msgstr "مانع الإعلانات"
 
 #: konq-plugins/adblock/plugin_adblock.desktop:58
 msgctxt "Comment"
@@ -182,7 +183,7 @@
 #: konq-plugins/akregator/akregator_konqfeedicon.desktop:63
 msgctxt "Comment"
 msgid "Displays an icon in the status bar if the page contains a feed"
-msgstr ""
+msgstr "تعرض أيقونة في شريط الحالة إذا كانت الصفحة  تحوي تغذية"
 
 #: konq-plugins/akregator/akregator_konqplugin.desktop:4
 msgctxt "Name"
@@ -197,7 +198,7 @@
 #: konq-plugins/autorefresh/autorefresh.desktop:13
 msgctxt "Name"
 msgid "Auto Refresh"
-msgstr ""
+msgstr "محلق التحديث التلقائي"
 
 #: konq-plugins/autorefresh/autorefresh.desktop:67
 msgctxt "Comment"
@@ -273,7 +274,7 @@
 #: konq-plugins/imagerotation/imageconverter.desktop:214
 msgctxt "Name"
 msgid "TIFF"
-msgstr ""
+msgstr "TIFF"
 
 #: konq-plugins/imagerotation/imageconverter.desktop:276
 msgctxt "Name"
@@ -323,7 +324,7 @@
 #: konq-plugins/kimgalleryplugin/kimgalleryplugin.desktop:71
 msgctxt "Comment"
 msgid "An easy way to generate an HTML image gallery"
-msgstr ""
+msgstr "طريقة سريعة لإنشاء معرض صور HTML"
 
 #: apps/konqueror/kttsplugin/khtmlkttsd.desktop:14
 msgctxt "Name"
@@ -343,7 +344,7 @@
 #: konq-plugins/microformat/mf_konqmficon.desktop:62
 msgctxt "Comment"
 msgid "Displays an icon in the status bar if the page contains a microformat"
-msgstr ""
+msgstr "تعرض أيقونة في شريط الحالية إذا كانت الصفحة  تحوي على مايكروفورمات"
 
 #: konq-plugins/minitools/minitoolsplugin.desktop:14
 msgctxt "Name"
@@ -396,7 +397,7 @@
 #: konq-plugins/searchbar/searchbar.desktop:76
 msgctxt "Comment"
 msgid "Provides a text box for easier access to search engines like Google."
-msgstr ""
+msgstr "تزود صندوق النص بنفاذ سريع لمحركات البحث مثل جوجل"
 
 #: apps/konqueror/shellcmdplugin/kshellcmdplugin.desktop:14
 msgctxt "Name"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdelibs.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdelibs.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdelibs.po	2012-02-23 06:20:15.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdelibs.po	2012-03-23 06:41:46.000000000 +0000
@@ -11,20 +11,22 @@
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
 # Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
-#
+# Osama os_ <syriatalk@hotmail.com>, 2011.
+# Abdalrahim G. Fakhouri <abdilra7eem@yahoo.com>, 2011, 2012.
+# Abderrahim Kitouni <a.kitouni@gmail.com>, 2011, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: desktop_kdelibs\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 13:46+0000\n"
-"PO-Revision-Date: 2011-01-05 22:11+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"PO-Revision-Date: 2012-03-12 23:04+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 22:42+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:06+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: interfaces/kimproxy/interface/dbusinstantmessenger.desktop:4
@@ -51,7 +53,7 @@
 #: interfaces/ktexteditor/kcm_ktexteditor.desktop:2
 msgctxt "Name|standard desktop component"
 msgid "Embedded Text Editor"
-msgstr "محرر نصوص مدمج"
+msgstr "محرر نصوص مضمَّن"
 
 #: interfaces/ktexteditor/kcm_ktexteditor.desktop:67
 msgctxt "Comment"
@@ -61,12 +63,12 @@
 "service."
 msgstr ""
 "تقوم خدمة محرر النصوص بتزويد التطبيقات بمعاين نصوص ومحرر. يجب أن تستخدم "
-"تطبيقات كيدي التي تزود بتسهيلات تحرير النصوص هذه الخدمة."
+"تطبيقات كدي التي تزود بتسهيلات تحرير النصوص هذه الخدمة."
 
 #: interfaces/ktexteditor/ktexteditor.desktop:5
 msgctxt "Comment"
 msgid "Embeddable Text Editor Component (with Doc/View Separation)"
-msgstr "مكوّن تحرير النصوص قابل للدمج (مع Doc/View Separation)"
+msgstr "مكوّن تحرير النصوص قابل للدمج (مع فصل العرض والمضمون)"
 
 #: interfaces/ktexteditor/ktexteditor_loadsavefiltercheckplugin.desktop:5
 msgctxt "Comment"
@@ -196,7 +198,7 @@
 #: kdecore/all_languages.desktop:2005
 msgctxt "Name"
 msgid "Catalan (Valencian)"
-msgstr ""
+msgstr "كتلونية(بلنسية)"
 
 #: kdecore/all_languages.desktop:2060
 msgctxt "Name"
@@ -256,7 +258,7 @@
 #: kdecore/all_languages.desktop:3064
 msgctxt "Name"
 msgid "Lower Sorbian"
-msgstr "صوربية منخفضة"
+msgstr "صوربية سفلى"
 
 #: kdecore/all_languages.desktop:3138
 msgctxt "Name"
@@ -396,7 +398,7 @@
 #: kdecore/all_languages.desktop:5639
 msgctxt "Name"
 msgid "Upper Sorbian"
-msgstr "صوربية مرتفعة"
+msgstr "صوربية عُليا"
 
 #: kdecore/all_languages.desktop:5730
 msgctxt "Name"
@@ -826,12 +828,12 @@
 #: kdecore/all_languages.desktop:13625
 msgctxt "Name"
 msgid "Serbian Ijekavian"
-msgstr ""
+msgstr "صربية اليكافيانية"
 
 #: kdecore/all_languages.desktop:13677
 msgctxt "Name"
 msgid "Serbian Ijekavian Latin"
-msgstr ""
+msgstr "الصربية اليكافيانية اللاتينيّة"
 
 #: kdecore/all_languages.desktop:13729
 msgctxt "Name"
@@ -931,7 +933,7 @@
 #: kdecore/localization/all_languages.desktop:15534
 msgctxt "Name"
 msgid "Uyghur"
-msgstr ""
+msgstr "أيغوريّة"
 
 #: kdecore/all_languages.desktop:15600
 msgctxt "Name"
@@ -946,12 +948,12 @@
 #: kdecore/all_languages.desktop:15788
 msgctxt "Name"
 msgid "Uzbek"
-msgstr "الأوزبكية"
+msgstr "أوزبكية"
 
 #: kdecore/all_languages.desktop:15882
 msgctxt "Name"
 msgid "Uzbek (Cyrillic)"
-msgstr "الأوزبكية (سريالية)"
+msgstr "أوزبكية (سريالية)"
 
 #: kdecore/all_languages.desktop:15962
 msgctxt "Name"
@@ -986,7 +988,7 @@
 #: kdecore/localization/all_languages.desktop:16506
 msgctxt "Name"
 msgid "KDE Test Language"
-msgstr ""
+msgstr "لغة اختبار كدي"
 
 #: kdecore/all_languages.desktop:16522
 msgctxt "Name"
@@ -1031,22 +1033,22 @@
 #: kdecore/localization/entry.desktop:2
 msgctxt "Name"
 msgid "US English"
-msgstr ""
+msgstr "إنجليزية (الولايات المتحدة)"
 
 #: kdecore/network/kssld/kssld.desktop:8
 msgctxt "Name"
 msgid "SSL Certificate Policy"
-msgstr ""
+msgstr "سياسة شهادات SSL"
 
 #: kdecore/network/kssld/kssld.desktop:61
 msgctxt "Comment"
 msgid "Provides SSL certificate policy to applications"
-msgstr ""
+msgstr "يقدم سياسة شهادات SSL للتطبيقات"
 
 #: kdecore/services/kplugininfo.desktop:4
 msgctxt "Name"
 msgid "KDE Plugin Information"
-msgstr "معلومات ملحقات كيدي"
+msgstr "معلومات ملحقات كدي"
 
 #: kdecore/sonnet/sonnetspeller.desktop:5
 msgctxt "Comment"
@@ -1241,17 +1243,17 @@
 #: kio/kcmodule.desktop:4
 msgctxt "Name"
 msgid "KDE Configuration Module"
-msgstr "وحدة تحكم كيدي"
+msgstr "وحدة تحكم كدي"
 
 #: kio/kcmoduleinit.desktop:4
 msgctxt "Name"
 msgid "KDE Configuration Initialization"
-msgstr "تمهيد إعدادات كيدي"
+msgstr "تمهيد إعدادات كدي"
 
 #: kio/kdatatool.desktop:4
 msgctxt "Comment"
 msgid "KDE Data Tool"
-msgstr "أداة كيدي للبيانات"
+msgstr "أداة كدي للبيانات"
 
 #: kio/kfile/kiofilemodule.desktop:4
 msgctxt "Name"
@@ -1276,7 +1278,7 @@
 #: kio/kio/kfileitemactionplugin.desktop:4
 msgctxt "Comment"
 msgid "Plugin for the KIO file item context menu"
-msgstr ""
+msgstr "إضافة تستخدم لقائمة السياق لعناصر ملفات KIO"
 
 #: kio/kio/kfilewrite.desktop:5
 msgctxt "Comment"
@@ -1291,27 +1293,27 @@
 #: kio/kssl/kcm/kcm_ssl.desktop:11
 msgctxt "Name"
 msgid "SSL Preferences"
-msgstr ""
+msgstr "تفضيلات SSL"
 
 #: kio/kssl/kcm/kcm_ssl.desktop:57
 msgctxt "Comment"
 msgid "SSL Versions and Certificates"
-msgstr ""
+msgstr "إصدارات وشهادات SSL"
 
 #: kio/kurifilterplugin.desktop:4
 msgctxt "Name"
 msgid "Enhanced Browsing Plugin"
-msgstr "ملحق التصفح المحسن"
+msgstr "ملحق التصفّح المحسّن"
 
 #: kio/misc/kmailservice.desktop:11
 msgctxt "Name"
 msgid "KMailService"
-msgstr ""
+msgstr "KMailService"
 
 #: kio/misc/kpac/proxyscout.desktop:3
 msgctxt "Name"
 msgid "Network Proxy Configuration"
-msgstr ""
+msgstr "إعدادات وكيل الشبكة"
 
 #: kio/misc/kpac/proxyscout.desktop:58
 msgctxt "Comment"
@@ -1321,7 +1323,7 @@
 #: kio/misc/kpac/proxyscout.notifyrc:3
 msgctxt "Comment"
 msgid "Network Proxy Configuration"
-msgstr ""
+msgstr "إعدادات وكيل الشبكة"
 
 #: kio/misc/kpac/proxyscout.notifyrc:60
 msgctxt "Name"
@@ -1356,7 +1358,7 @@
 #: kio/misc/ktelnetservice.desktop:10
 msgctxt "Name"
 msgid "KTelnetService"
-msgstr ""
+msgstr "KTelnetService"
 
 #: kio/misc/mms.protocol:11
 msgctxt "Description"
@@ -1386,12 +1388,12 @@
 #: kioslave/http/kcookiejar/kcookiejar.desktop:3
 msgctxt "Name"
 msgid "Cookie Jar"
-msgstr ""
+msgstr "كعكة Jar"
 
 #: kioslave/http/kcookiejar/kcookiejar.desktop:55
 msgctxt "Comment"
 msgid "Stores network cookies"
-msgstr ""
+msgstr "يخزن كعكات (cookies) الشبكة"
 
 #: knotify/tests/knotifytest.notifyrc:3
 msgctxt "Comment"
@@ -1416,7 +1418,7 @@
 #: knotify/tests/knotifytest.notifyrc:333
 msgctxt "Comment"
 msgid "The contact is now connected"
-msgstr "المُراسَل  متصل"
+msgstr "المُراسَل متصل"
 
 #: knotify/tests/knotifytest.notifyrc:418
 msgctxt "Name"
@@ -1436,7 +1438,7 @@
 #: kparts/kpart.desktop:4 kparts/krop.desktop:5 kparts/krwp.desktop:5
 msgctxt "Comment"
 msgid "KDE Component"
-msgstr "مكون كيدي"
+msgstr "مكون كدي"
 
 #: kparts/tests/notepad.desktop:2
 msgctxt "Name"
@@ -1446,42 +1448,42 @@
 #: kutils/kemoticons/providers/adium/emoticonstheme_adium.desktop:3
 msgctxt "Name"
 msgid "Adium Emoticons Theme"
-msgstr "سمة رموز Adium"
+msgstr "سمة ابتسامات Adium"
 
 #: kutils/kemoticons/providers/adium/emoticonstheme_adium.desktop:76
 msgctxt "Comment"
 msgid "Library to use Adium emoticons theme"
-msgstr "مكتبة لاستخدام سمة رموز Adium"
+msgstr "مكتبة لاستخدام سمة ابتسامات Adium"
 
 #: kutils/kemoticons/providers/kde/emoticonstheme_kde.desktop:3
 msgctxt "Name"
 msgid "KDE Emoticons Theme"
-msgstr ""
+msgstr "سمة ابتسامات كدي"
 
 #: kutils/kemoticons/providers/kde/emoticonstheme_kde.desktop:56
 msgctxt "Comment"
 msgid "Library to use KDE emoticons theme"
-msgstr "مكتبة لاستخدام سمة رموز كيدي"
+msgstr "مكتبة لاستخدام سمة ابتسامات كدي"
 
 #: kutils/kemoticons/providers/pidgin/emoticonstheme_pidgin.desktop:3
 msgctxt "Name"
 msgid "Pidgin Emoticons Theme"
-msgstr "سمة رموز Pidgin"
+msgstr "سمة ابتسامات Pidgin"
 
 #: kutils/kemoticons/providers/pidgin/emoticonstheme_pidgin.desktop:78
 msgctxt "Comment"
 msgid "Library to use Pidgin emoticons theme"
-msgstr "مكتبة لاستخدام سمة رموز Pidgin"
+msgstr "مكتبة لاستخدام سمة ابتسامات Pidgin"
 
 #: kutils/kemoticons/providers/xmpp/emoticonstheme_xmpp.desktop:3
 msgctxt "Name"
 msgid "XMPP Emoticons Theme"
-msgstr "سمة رموز XMPP"
+msgstr "سمة ابتسامات XMPP"
 
 #: kutils/kemoticons/providers/xmpp/emoticonstheme_xmpp.desktop:78
 msgctxt "Comment"
 msgid "Library to use XMPP emoticons theme"
-msgstr "مكتبة لاستخدام سمة رموز XMPP"
+msgstr "مكتبة لاستخدام سمة ابتسامات XMPP"
 
 #: plasma/data/services/plasma-applet-extenderapplet.desktop:2
 msgctxt "Name"
@@ -1491,7 +1493,7 @@
 #: plasma/data/services/plasma.protocol:9
 msgctxt "Description"
 msgid "A protocol for Plasma services"
-msgstr ""
+msgstr "ميفاق لخدمات بلازما"
 
 #: plasma/data/servicetypes/plasma-animator.desktop:5
 msgctxt "Comment"
@@ -1506,12 +1508,12 @@
 #: plasma/data/servicetypes/plasma-applet.desktop:5
 msgctxt "Comment"
 msgid "Plasma applet"
-msgstr "بريمجة بلازما"
+msgstr "بريمج بلازما"
 
 #: plasma/data/servicetypes/plasma-containment.desktop:5
 msgctxt "Comment"
 msgid "Plasma applet container and background painter"
-msgstr "حاوية بريمج بلازما و رسام خلفية"
+msgstr "حاوية بريمج بلازما ورسام خلفية"
 
 #: plasma/data/servicetypes/plasma-containmentactions.desktop:5
 msgctxt "Comment"
@@ -1536,17 +1538,17 @@
 #: plasma/data/servicetypes/plasma-scriptengine.desktop:5
 msgctxt "Comment"
 msgid "Scripting language extension for Plasma"
-msgstr "إمتداد لغة سكربت للبلازما"
+msgstr "امتداد لغة سكربت لبلازما"
 
 #: plasma/data/servicetypes/plasma-service.desktop:5
 msgctxt "Comment"
 msgid "Plasma service"
-msgstr ""
+msgstr "خدمة بلازما"
 
 #: plasma/data/servicetypes/plasma-toolbox.desktop:5
 msgctxt "Comment"
 msgid "Plasma toolbox"
-msgstr ""
+msgstr "صندوق أدوات بلازما"
 
 #: plasma/data/servicetypes/plasma-wallpaper.desktop:5
 msgctxt "Comment"
@@ -1561,17 +1563,17 @@
 #: plasma/tests/packagemetadatatest.desktop:70
 msgctxt "Comment"
 msgid "A test desktop file to test the PackageMetaData class."
-msgstr "ملف اختبار سطح المكتب لاختبار صف  PackageMetaData"
+msgstr "ملف desktop لاختبار الصنف PackageMetaData."
 
 #: plasma/tests/testcontainmentactionsplugin/plasma-containmentactions-test.desktop:2
 msgctxt "Name"
 msgid "Test"
-msgstr ""
+msgstr "اختبار"
 
 #: plasma/tests/testcontainmentactionsplugin/plasma-containmentactions-test.desktop:51
 msgctxt "Comment"
 msgid "A dummy plugin for testing"
-msgstr ""
+msgstr "إضافة وهمية من أجل الاختبار"
 
 #: plasma/tests/testengine/plasma-dataengine-testengine.desktop:2
 msgctxt "Name"
@@ -1596,7 +1598,7 @@
 #: security/kcert/kcertpart.desktop:95
 msgctxt "Name"
 msgid "KCertPart"
-msgstr "جزء ك للشهادات"
+msgstr "KCertPart"
 
 #: sonnet/plugins/aspell/kspell_aspell.desktop:14
 msgctxt "Name"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdemultimedia.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdemultimedia.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdemultimedia.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdemultimedia.po	2012-03-23 06:41:39.000000000 +0000
@@ -21,8 +21,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:58+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:54+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: debian/dolphin-open-audiocd.desktop:9
 msgctxt "Name"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdenetwork.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdenetwork.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdenetwork.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdenetwork.po	2012-03-23 06:41:40.000000000 +0000
@@ -8,14 +8,14 @@
 "Project-Id-Version: desktop_kdenetwork\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 21:45+0000\n"
-"PO-Revision-Date: 2012-01-25 10:58+0000\n"
+"PO-Revision-Date: 2012-03-12 22:59+0000\n"
 "Last-Translator: Amine Roukh <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:08+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:59+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: filesharing/advanced/propsdlgplugin/fileshare_propsdlgplugin.desktop:4
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdepim.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdepim.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdepim.po	2012-02-23 06:20:10.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdepim.po	2012-03-23 06:41:41.000000000 +0000
@@ -11,14 +11,14 @@
 "Project-Id-Version: desktop_kdepim\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 03:45+0000\n"
-"PO-Revision-Date: 2012-01-25 11:27+0000\n"
+"PO-Revision-Date: 2012-03-12 22:55+0000\n"
 "Last-Translator: Youssef Chahibi <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:22+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:07+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: akonadiconsole/akonadiconsole.desktop:2
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdepim-runtime.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdepim-runtime.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdepim-runtime.po	2012-02-23 06:20:23.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdepim-runtime.po	2012-03-23 06:41:54.000000000 +0000
@@ -11,14 +11,14 @@
 "Project-Id-Version: desktop_kdepim\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:24+0000\n"
-"PO-Revision-Date: 2012-01-25 11:24+0000\n"
+"PO-Revision-Date: 2012-03-12 23:03+0000\n"
 "Last-Translator: Youssef Chahibi <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 01:32+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:55+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: accountwizard/accountwizard.desktop:2
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdeplasma-addons.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdeplasma-addons.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdeplasma-addons.po	2012-02-23 06:20:20.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdeplasma-addons.po	2012-03-23 06:41:51.000000000 +0000
@@ -6,14 +6,14 @@
 "Project-Id-Version: desktop_kdeplasma-addons\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-09 04:40+0000\n"
-"PO-Revision-Date: 2012-01-25 11:23+0000\n"
+"PO-Revision-Date: 2012-03-12 22:31+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:17+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:08+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: applets/bball/plasma-applet-bball.desktop:3
 msgctxt "Name"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kde-runtime.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kde-runtime.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kde-runtime.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kde-runtime.po	2012-03-23 06:41:56.000000000 +0000
@@ -12,14 +12,14 @@
 "Project-Id-Version: desktop_kdebase\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2011-12-09 08:56+0000\n"
+"PO-Revision-Date: 2012-03-12 22:42+0000\n"
 "Last-Translator: Gabi Sarkis <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:30+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:38+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: activitymanager/activitymanager-plugin.desktop:6
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdesdk.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdesdk.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdesdk.po	1970-01-01 00:00:00.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdesdk.po	2012-03-23 06:41:43.000000000 +0000
@@ -0,0 +1,702 @@
+# translation of desktop_kdesdk.po to
+# desktop.po - Arabic Translation.
+# Copyright (C) 2001, 2006, 2007 Free Software Foundation, Inc.
+#
+# Mohammed Gamal <f2c2001@yahoo.com>, 2001.
+# محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
+# Youssef Chahibi <chahibi@gmail.com>, 2007.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
+msgid ""
+msgstr ""
+"Project-Id-Version: desktop_kdesdk\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-09-08 16:09+0000\n"
+"PO-Revision-Date: 2012-03-12 23:02+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:22+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: \n"
+
+#: cervisia/cervisia.desktop:2
+msgctxt "GenericName"
+msgid "CVS Frontend"
+msgstr ""
+
+#: cervisia/cervisia.desktop:70 cervisia/cervisiapart.desktop:5
+msgctxt "Name"
+msgid "Cervisia"
+msgstr "Cervisia"
+
+#: cervisia/cervisia.notifyrc:3
+msgctxt "Comment"
+msgid "Cervisia CVS Client"
+msgstr ""
+
+#: cervisia/cervisia.notifyrc:40
+msgctxt "Name"
+msgid "CVS commit job done"
+msgstr ""
+
+#: cervisia/cervisia.notifyrc:87
+msgctxt "Comment"
+msgid "A CVS commit job is done"
+msgstr ""
+
+#: cervisia/cvsservice/cvsservice.desktop:3
+msgctxt "Name"
+msgid "CvsService"
+msgstr ""
+
+#: cervisia/cvsservice/cvsservice.desktop:63
+msgctxt "Comment"
+msgid "A D-Bus service that provides an interface to cvs"
+msgstr ""
+
+#: dolphin-plugins/git/fileviewgitplugin.desktop:3
+msgctxt "Name"
+msgid "Git"
+msgstr "Git"
+
+#: dolphin-plugins/svn/fileviewsvnplugin.desktop:3
+msgctxt "Name"
+msgid "Subversion"
+msgstr "Subversion"
+
+#: kapptemplate/kapptemplate.desktop:7
+msgctxt "GenericName"
+msgid "KDE Template Generator"
+msgstr "مولّد قوالب كدي"
+
+#: kapptemplate/kapptemplate.desktop:50
+msgctxt "Name"
+msgid "KAppTemplate"
+msgstr ""
+
+#: kapptemplate/templates/C++/akonadiresource/akonadiresource.kdevtemplate:3
+msgctxt "Name"
+msgid "Akonadi Resource Template"
+msgstr ""
+
+#: kapptemplate/templates/C++/akonadiresource/akonadiresource.kdevtemplate:44
+msgctxt "Comment"
+msgid "A template for an Akonadi PIM data resource"
+msgstr ""
+
+#: kapptemplate/templates/C++/akonadiserializer/akonadi_serializer_%{APPNAMELC}.desktop:2
+msgctxt "Name"
+msgid "%{APPNAME} Serializer"
+msgstr ""
+
+#: kapptemplate/templates/C++/akonadiserializer/akonadi_serializer_%{APPNAMELC}.desktop:41
+msgctxt "Comment"
+msgid "An Akonadi serializer plugin for %{APPNAMELC}"
+msgstr ""
+
+#: kapptemplate/templates/C++/akonadiserializer/akonadiserializer.kdevtemplate:3
+msgctxt "Name"
+msgid "Akonadi Serializer Template"
+msgstr ""
+
+#: kapptemplate/templates/C++/akonadiserializer/akonadiserializer.kdevtemplate:41
+msgctxt "Comment"
+msgid "A template for an Akonadi data serializer plugin"
+msgstr ""
+
+#: kapptemplate/templates/C++/flake/%{APPNAMELC}shape.desktop:4
+#: kapptemplate/templates/C++/flake/%{APPNAME}shape.desktop:4
+msgctxt "Name"
+msgid "%{APPNAME} Shape"
+msgstr ""
+
+#: kapptemplate/templates/C++/flake/%{APPNAMELC}shape.desktop:38
+#: kapptemplate/templates/C++/flake/%{APPNAME}shape.desktop:38
+msgctxt "Comment"
+msgid "%{APPNAME} Flake Shape"
+msgstr ""
+
+#: kapptemplate/templates/C++/flake/flake.kdevtemplate:3
+msgctxt "Name"
+msgid "KOffice Shape Template (Flake)"
+msgstr ""
+
+#: kapptemplate/templates/C++/flake/flake.kdevtemplate:34
+msgctxt "Comment"
+msgid ""
+"A KOffice plugin template with a shape, a tool and a docker (please use "
+"ThisFormat for the project name)"
+msgstr ""
+
+#: kapptemplate/templates/C++/kapp4/kapp4.kdevtemplate:3
+msgctxt "Name"
+msgid "KDE 4 GUI Application"
+msgstr ""
+
+#: kapptemplate/templates/C++/kapp4/kapp4.kdevtemplate:45
+msgctxt "Comment"
+msgid ""
+"KDE4 simple template based on CMake, inherits from XMLGuiWindow and "
+"demonstrates how to use KConfig XT"
+msgstr ""
+
+#: kapptemplate/templates/C++/kapp4/src/%{APPNAMELC}.desktop:2
+#: kapptemplate/templates/C++/konqplugin/src/%{APPNAMELC}.desktop:44
+#: kapptemplate/templates/C++/kpartapp/src/%{APPNAMELC}.desktop:2
+#: kapptemplate/templates/C++/ktexteditor/ktexteditor_%{APPNAMELC}.desktop:41
+#: kapptemplate/templates/C++/plasmoid/plasma-applet-%{APPNAMELC}.desktop:2
+#: kapptemplate/templates/C++/runner/%{APPNAMELC}.desktop:2
+#: kapptemplate/templates/ruby/kderubyapp/src/%{APPNAMELC}.desktop:2
+#: kapptemplate/templates/ruby/rubykonqplugin/src/%{APPNAMELC}.desktop:47
+msgctxt "Name"
+msgid "%{APPNAME}"
+msgstr ""
+
+#: kapptemplate/templates/C++/kapp4/src/%{APPNAMELC}.desktop:50
+msgctxt "GenericName"
+msgid "A KDE4 Application"
+msgstr ""
+
+#: kapptemplate/templates/C++/kofficetext/kofficetext.kdevtemplate:3
+msgctxt "Name"
+msgid "KOffice Text-Plugin Template"
+msgstr ""
+
+#: kapptemplate/templates/C++/kofficetext/kofficetext.kdevtemplate:35
+msgctxt "Comment"
+msgid ""
+"A KOffice plugin template to add new features for modifying text (use "
+"ThisFormat for the project name)"
+msgstr ""
+
+#: kapptemplate/templates/C++/kofficetext/kotext%{APPNAMELC}.desktop:2
+msgctxt "Name"
+msgid "%{APPNAME} plugin"
+msgstr ""
+
+#: kapptemplate/templates/C++/konqplugin/konqplugin.kdevtemplate:3
+msgctxt "Name"
+msgid "KDE 4 Konqueror plugin"
+msgstr ""
+
+#: kapptemplate/templates/C++/konqplugin/konqplugin.kdevtemplate:36
+msgctxt "Comment"
+msgid ""
+"KDE4 simple template based on CMake, inherits from KParts::Plugin and "
+"demonstrates how to write a konqueror plugin"
+msgstr ""
+
+#: kapptemplate/templates/C++/konqplugin/src/%{APPNAMELC}.desktop:16
+msgctxt "Comment"
+msgid "Extended UrlBar Options"
+msgstr ""
+
+#: kapptemplate/templates/C++/konqplugin/src/%{APPNAMELC}.desktop:88
+#: kapptemplate/templates/C++/ktexteditor/ktexteditor_%{APPNAMELC}.desktop:85
+#: kapptemplate/templates/ruby/rubykonqplugin/src/%{APPNAMELC}.desktop:91
+msgctxt "GenericName"
+msgid "%{APPNAME}"
+msgstr ""
+
+#: kapptemplate/templates/C++/kpartapp/kpartapp.kdevtemplate:3
+msgctxt "Name"
+msgid "KDE 4 KPart Application"
+msgstr ""
+
+#: kapptemplate/templates/C++/kpartapp/kpartapp.kdevtemplate:44
+msgctxt "Comment"
+msgid ""
+"KDE4 simple template based on CMake, inherits from XMLGuiWindow and "
+"demonstrates how to use KPart"
+msgstr ""
+
+#: kapptemplate/templates/C++/kpartapp/src/%{APPNAMELC}.desktop:50
+msgctxt "GenericName"
+msgid "A KDE KPart Application"
+msgstr ""
+
+#: kapptemplate/templates/C++/kpartapp/src/%{APPNAMELC}_part.desktop:2
+msgctxt "Name"
+msgid "%{APPNAME}Part"
+msgstr ""
+
+#: kapptemplate/templates/C++/ktexteditor/ktexteditor.kdevtemplate:3
+msgctxt "Name"
+msgid "KTextEditor Plugin Template"
+msgstr ""
+
+#: kapptemplate/templates/C++/ktexteditor/ktexteditor.kdevtemplate:38
+msgctxt "Comment"
+msgid ""
+"A KTextEditor plugin template to perform special operations on text in "
+"KWrite, Kate, KDevelop etc.  (use ThisFormat for the project name)"
+msgstr ""
+
+#: kapptemplate/templates/C++/ktexteditor/ktexteditor_%{APPNAMELC}.desktop:3
+msgctxt "Comment"
+msgid "%{APPNAME}"
+msgstr ""
+
+#: kapptemplate/templates/C++/plasmoid/plasma-applet-%{APPNAMELC}.desktop:46
+msgctxt "Comment"
+msgid "Plasma %{APPNAME}"
+msgstr ""
+
+#: kapptemplate/templates/C++/plasmoid/plasmoid.kdevtemplate:3
+msgctxt "Name"
+msgid "Plasma Applet Template"
+msgstr ""
+
+#: kapptemplate/templates/C++/plasmoid/plasmoid.kdevtemplate:45
+msgctxt "Comment"
+msgid "A plasma applet template displaying an icon and a text"
+msgstr ""
+
+#: kapptemplate/templates/C++/qmake_qt4guiapp/qmake_qt4guiapp.kdevtemplate:3
+msgctxt "Name"
+msgid "Qt4 GUI Application"
+msgstr ""
+
+#: kapptemplate/templates/C++/qmake_qt4guiapp/qmake_qt4guiapp.kdevtemplate:46
+msgctxt "Comment"
+msgid ""
+"Generate a QMake/Qt4 based application with graphical user interface "
+"(crossplatform compatible)"
+msgstr ""
+
+#: kapptemplate/templates/C++/runner/%{APPNAMELC}.desktop:46
+msgctxt "Comment"
+msgid "%{APPNAME} runner"
+msgstr ""
+
+#: kapptemplate/templates/C++/runner/runner.kdevtemplate:3
+msgctxt "Name"
+msgid "Plasma Runner Template"
+msgstr ""
+
+#: kapptemplate/templates/C++/runner/runner.kdevtemplate:43
+msgctxt "Comment"
+msgid "A plasma runner template"
+msgstr ""
+
+#: kapptemplate/templates/Python/pykde4app/pykde4app.kdevtemplate:3
+msgctxt "Name"
+msgid "PyKDE4 GUI Application"
+msgstr ""
+
+#: kapptemplate/templates/Python/pykde4app/pykde4app.kdevtemplate:45
+msgctxt "Comment"
+msgid "PyKDE4 template  - needs PyKDE4"
+msgstr ""
+
+#: kapptemplate/templates/Python/pyqt4app/pyqt4app.kdevtemplate:3
+msgctxt "Name"
+msgid "PyQt4 GUI Application"
+msgstr ""
+
+#: kapptemplate/templates/Python/pyqt4app/pyqt4app.kdevtemplate:45
+msgctxt "Comment"
+msgid "PyQt template using a Designer file - needs PyQt4"
+msgstr ""
+
+#: kapptemplate/templates/ruby/kderubyapp/kderubyapp.kdevtemplate:3
+msgctxt "Name"
+msgid "KDE 4 Ruby GUI Application"
+msgstr ""
+
+#: kapptemplate/templates/ruby/kderubyapp/kderubyapp.kdevtemplate:43
+msgctxt "Comment"
+msgid ""
+"KDE4 simple ruby template, inherits from XMLGuiWindow - needs korundum4"
+msgstr ""
+
+#: kapptemplate/templates/ruby/kderubyapp/src/%{APPNAMELC}.desktop:50
+msgctxt "GenericName"
+msgid "A KDE4 Ruby Application"
+msgstr ""
+
+#: kapptemplate/templates/ruby/rubykonqplugin/rubykonqplugin.kdevtemplate:3
+msgctxt "Name"
+msgid "KDE 4 Ruby Konqueror plugin"
+msgstr ""
+
+#: kapptemplate/templates/ruby/rubykonqplugin/rubykonqplugin.kdevtemplate:34
+msgctxt "Comment"
+msgid ""
+"KDE4 simple template based on CMake, inherits from KParts::Plugin and "
+"demonstrates how to write a konqueror plugin in Ruby"
+msgstr ""
+
+#: kapptemplate/templates/ruby/rubykonqplugin/src/%{APPNAMELC}.desktop:18
+msgctxt "Comment"
+msgid "%{APPNAME} - You can write Konqueror-Plugins in Ruby"
+msgstr ""
+
+#: kcachegrind/kcachegrind/kcachegrind.desktop:9
+msgctxt "Name"
+msgid "KCachegrind"
+msgstr ""
+
+#: kcachegrind/kcachegrind/kcachegrind.desktop:64
+msgctxt "GenericName"
+msgid "Profiler Frontend"
+msgstr ""
+
+#: kcachegrind/kcachegrind/kcachegrind.desktop:118
+msgctxt "Comment"
+msgid "Visualization of Performance Profiling Data"
+msgstr ""
+
+#: kdeaccounts-plugin/kdeaccountsplugin.desktop:2
+msgctxt "Name"
+msgid "KDE Repository Accounts"
+msgstr ""
+
+#: kioslave/svn/ksvnd/ksvnd.desktop:3
+msgctxt "Name"
+msgid "KDED Subversion Module"
+msgstr ""
+
+#: kioslave/svn/svn+file.protocol:15 kioslave/svn/svn+http.protocol:15
+#: kioslave/svn/svn+https.protocol:15 kioslave/svn/svn+ssh.protocol:15
+#: kioslave/svn/svn.protocol:15
+msgctxt "Description"
+msgid "Subversion ioslave"
+msgstr ""
+
+#: kioslave/svn/svnhelper/apply_patch.desktop:8
+msgctxt "Name"
+msgid "Apply Patch..."
+msgstr "طبّق الرقعة..."
+
+#: kioslave/svn/svnhelper/apply_patch.desktop:62
+msgctxt "Comment"
+msgid "Apply the patch to another folder/file"
+msgstr ""
+
+#: kioslave/svn/svnhelper/subversion.desktop:4
+msgctxt "X-KDE-Submenu"
+msgid "Subversion"
+msgstr "Subversion"
+
+#: kioslave/svn/svnhelper/subversion.desktop:66
+msgctxt "Name"
+msgid "Add to Repository"
+msgstr "أضِف إلى لمستودع"
+
+#: kioslave/svn/svnhelper/subversion.desktop:122
+msgctxt "Name"
+msgid "Delete From Repository"
+msgstr "أزل من المستودع"
+
+#: kioslave/svn/svnhelper/subversion.desktop:178
+msgctxt "Name"
+msgid "Revert Local Changes"
+msgstr ""
+
+#: kioslave/svn/svnhelper/subversion.desktop:231
+msgctxt "Comment"
+msgid "Remove any changes made locally. Warning - this cannot be undone."
+msgstr ""
+
+#: kioslave/svn/svnhelper/subversion.desktop:281
+msgctxt "Name"
+msgid "Rename..."
+msgstr "أعد تسمية..."
+
+#: kioslave/svn/svnhelper/subversion.desktop:339
+msgctxt "Comment"
+msgid ""
+"Rename a file locally and in the repository.  Use this rather than adding "
+"and deleting to rename a file."
+msgstr ""
+
+#: kioslave/svn/svnhelper/subversion.desktop:389
+msgctxt "Name"
+msgid "Import Repository"
+msgstr "استيراد المستودع"
+
+#: kioslave/svn/svnhelper/subversion.desktop:443
+msgctxt "Comment"
+msgid ""
+"Put folder into an existing repository to put it under revision control."
+msgstr ""
+
+#: kioslave/svn/svnhelper/subversion.desktop:492
+msgctxt "Name"
+msgid "Checkout From Repository..."
+msgstr ""
+
+#: kioslave/svn/svnhelper/subversion.desktop:544
+msgctxt "Comment"
+msgid "Checkout out files from an existing repository into this folder."
+msgstr ""
+
+#: kioslave/svn/svnhelper/subversion.desktop:594
+msgctxt "Name"
+msgid "Switch..."
+msgstr ""
+
+#: kioslave/svn/svnhelper/subversion.desktop:648
+msgctxt "Comment"
+msgid "Switch given working copy to another branch"
+msgstr ""
+
+#: kioslave/svn/svnhelper/subversion.desktop:699
+msgctxt "Name"
+msgid "Merge..."
+msgstr "ادمج..."
+
+#: kioslave/svn/svnhelper/subversion.desktop:753
+msgctxt "Comment"
+msgid "Merge changes between this and another branch"
+msgstr ""
+
+#: kioslave/svn/svnhelper/subversion.desktop:804
+msgctxt "Name"
+msgid "Blame..."
+msgstr "لُم..."
+
+#: kioslave/svn/svnhelper/subversion.desktop:854
+msgctxt "Comment"
+msgid "See who wrote each line of the file and in what revision"
+msgstr ""
+
+#: kioslave/svn/svnhelper/subversion.desktop:905
+msgctxt "Name"
+msgid "Create Patch..."
+msgstr "أنشئ رقعة..."
+
+#: kioslave/svn/svnhelper/subversion.desktop:960
+msgctxt "Name"
+msgid "Export..."
+msgstr "صدِّر..."
+
+#: kioslave/svn/svnhelper/subversion.desktop:1019
+msgctxt "Comment"
+msgid "Checkout out an unversioned copy of a tree from a repository"
+msgstr ""
+
+#: kioslave/svn/svnhelper/subversion.desktop:1069
+msgctxt "Name"
+msgid "Diff (local)"
+msgstr "الاختلافات (محلي)"
+
+#: kioslave/svn/svnhelper/subversion.desktop:1123
+msgctxt "Comment"
+msgid "Show local changes since last update"
+msgstr ""
+
+#: kioslave/svn/svnhelper/subversion_toplevel.desktop:11
+msgctxt "Name"
+msgid "SVN Update"
+msgstr "حدِّث SVN"
+
+#: kioslave/svn/svnhelper/subversion_toplevel.desktop:67
+msgctxt "Name"
+msgid "SVN Commit"
+msgstr "أودِع SVN"
+
+#: kompare/kompare.desktop:4
+msgctxt "Name"
+msgid "Kompare"
+msgstr ""
+
+#: kompare/kompare.desktop:65
+msgctxt "GenericName"
+msgid "Diff/Patch Frontend"
+msgstr ""
+
+#: kompare/komparenavtreepart/komparenavtreepart.desktop:2
+msgctxt "Name"
+msgid "KompareNavTreePart"
+msgstr ""
+
+#: kompare/komparepart/komparepart.desktop:3
+msgctxt "Name"
+msgid "KomparePart"
+msgstr ""
+
+#: kuiviewer/designerthumbnail.desktop:3
+msgctxt "Name"
+msgid "Qt Designer Files"
+msgstr ""
+
+#: kuiviewer/kuiviewer.desktop:2
+msgctxt "Name"
+msgid "KUIViewer"
+msgstr ""
+
+#: kuiviewer/kuiviewer.desktop:59
+msgctxt "GenericName"
+msgid "Qt Designer UI File Viewer"
+msgstr ""
+
+#: kuiviewer/kuiviewer_part.desktop:2
+msgctxt "Name"
+msgid "KUIViewerPart"
+msgstr ""
+
+#: lokalize/src/lokalize.desktop:2
+msgctxt "Name"
+msgid "Lokalize"
+msgstr "لوكالايز"
+
+#: lokalize/src/lokalize.desktop:54
+msgctxt "GenericName"
+msgid "Computer-Aided Translation System"
+msgstr "برنامج ترجمة بمساعدة الحاسوب."
+
+#: lokalize/src/lokalize.notifyrc:3
+msgctxt "Comment"
+msgid "Computer-aided translation system"
+msgstr "برنامج ترجمة بمساعدة الحاسوب."
+
+#: lokalize/src/lokalize.notifyrc:80
+msgctxt "Name"
+msgid "Error opening files"
+msgstr "خطأ في فتح الملفات"
+
+#: lokalize/src/lokalize.notifyrc:111
+msgctxt "Name"
+msgid "Error opening files for synchronization"
+msgstr ""
+
+#: okteta/kasten/controllers/view/structures/examples/bitfields/bitfields.desktop:7
+msgctxt "Name"
+msgid "Bitfields test"
+msgstr ""
+
+#: okteta/kasten/controllers/view/structures/examples/dynamic-array-js/dynamic.desktop:7
+msgctxt "Name"
+msgid ""
+"Testing dynamic length arrays (JS). Do not translate, it's a waste of time"
+msgstr ""
+
+#: okteta/kasten/controllers/view/structures/examples/dynamic-array-js/dynamic.desktop:32
+msgctxt "Comment"
+msgid ""
+"A test structure for dynamic arrays (JS). Do not translate, it's a waste of "
+"time"
+msgstr ""
+
+#: okteta/kasten/controllers/view/structures/examples/dynamic/dynamic.desktop:7
+msgctxt "Name"
+msgid "Testing dynamic length arrays"
+msgstr ""
+
+#: okteta/kasten/controllers/view/structures/examples/dynamic/dynamic.desktop:33
+msgctxt "Comment"
+msgid "A test structure for dynamic arrays"
+msgstr ""
+
+#: okteta/kasten/controllers/view/structures/examples/elf-js/elf-js.desktop:9
+#: okteta/kasten/controllers/view/structures/examples/elf/elf.desktop:7
+msgctxt "Name"
+msgid "ELF structure"
+msgstr ""
+
+#: okteta/kasten/controllers/view/structures/examples/elf-js/elf-js.desktop:35
+#: okteta/kasten/controllers/view/structures/examples/elf/elf.desktop:33
+msgctxt "Comment"
+msgid "Structure for Executable and Linkable Format (ELF)"
+msgstr ""
+
+#: okteta/kasten/controllers/view/structures/examples/enum/enum.desktop:7
+msgctxt "Name"
+msgid "Testing enums"
+msgstr ""
+
+#: okteta/kasten/controllers/view/structures/examples/enum/enum.desktop:33
+msgctxt "Comment"
+msgid "A test structure for enums"
+msgstr ""
+
+#: okteta/kasten/controllers/view/structures/examples/png/png.desktop:7
+msgctxt "Name"
+msgid "PNG file header"
+msgstr "ترويسة ملفات PNG"
+
+#: okteta/kasten/controllers/view/structures/examples/png/png.desktop:35
+msgctxt "Comment"
+msgid ""
+"A test structure containing the PNG file header (file must be set to big-"
+"endian)"
+msgstr ""
+
+#: okteta/kasten/controllers/view/structures/examples/simple-js/simple-js.desktop:7
+msgctxt "Name"
+msgid "JavaScript test"
+msgstr "اختبار جافاسكربت"
+
+#: okteta/kasten/controllers/view/structures/examples/simple-js/simple-js.desktop:34
+msgctxt "Comment"
+msgid "Just testing structures defined in JS"
+msgstr ""
+
+#: okteta/kasten/controllers/view/structures/examples/test/test.desktop:7
+msgctxt "Name"
+msgid "Simple test"
+msgstr "اختبار بسيط"
+
+#: okteta/kasten/controllers/view/structures/examples/test/test.desktop:35
+msgctxt "Comment"
+msgid "A few test structures"
+msgstr ""
+
+#: okteta/kasten/controllers/view/structures/examples/test_2/test_2.desktop:7
+msgctxt "Name"
+msgid "Another simple test"
+msgstr "اختبار بسيط آخر"
+
+#: okteta/kasten/controllers/view/structures/examples/test_2/test_2.desktop:35
+msgctxt "Comment"
+msgid "A few more test structures"
+msgstr ""
+
+#: okteta/mobile/program/okteta-mobile.desktop:4
+msgctxt "Name"
+msgid "Okteta Mobile"
+msgstr ""
+
+#: okteta/parts/kbytesedit/kbytearrayedit.desktop:3
+msgctxt "Name"
+msgid "BytesEdit Widget"
+msgstr ""
+
+#: okteta/parts/kpart/oktetapart.desktop:4
+msgctxt "Name"
+msgid "Okteta Hex Viewer"
+msgstr ""
+
+#: okteta/program/okteta.desktop:2
+msgctxt "Name"
+msgid "Okteta"
+msgstr ""
+
+#: okteta/program/okteta.desktop:33
+msgctxt "GenericName"
+msgid "Hex Editor"
+msgstr "محرّر ستّ-عشريّ"
+
+#: scheck/scheck.themerc:2
+msgctxt "Name"
+msgid "Scheck"
+msgstr ""
+
+#: scheck/scheck.themerc:55
+msgctxt "Comment"
+msgid "Development style for searching accelerator and style guide conflicts"
+msgstr ""
+
+#: umbrello/umbrello/umbrello.desktop:8
+msgctxt "Name"
+msgid "Umbrello"
+msgstr ""
+
+#: umbrello/umbrello/umbrello.desktop:65
+msgctxt "GenericName"
+msgid "UML Modeller"
+msgstr ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdetoys.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdetoys.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdetoys.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdetoys.po	2012-03-23 06:41:43.000000000 +0000
@@ -7,19 +7,20 @@
 # Munzir Taha <munzir@kacst.edu.sa>, 2004.
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: desktop_kdetoys\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-09 04:38+0000\n"
-"PO-Revision-Date: 2009-12-23 04:11+0000\n"
-"Last-Translator: Youssef Chahibi <Unknown>\n"
-"Language-Team: <en@li.org>\n"
+"PO-Revision-Date: 2012-03-12 22:44+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:01+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:28+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: amor/data/billyrc:5
@@ -35,7 +36,7 @@
 #: amor/data/blobrc:4
 msgctxt "Description"
 msgid "Multi-Talented Spot"
-msgstr ""
+msgstr "البقعة متعددة المواهب"
 
 #: amor/data/blobrc:66
 msgctxt "About"
@@ -50,12 +51,12 @@
 #: amor/data/bonhommerc:73 amor/data/eyesrc:72
 msgctxt "About"
 msgid "By Jean-Claude Dumas"
-msgstr ""
+msgstr "By Jean-Claude Dumas"
 
 #: amor/data/bsdrc:5
 msgctxt "Description"
 msgid "FreeBSD Mascot"
-msgstr ""
+msgstr "FreeBSD Mascot"
 
 #: amor/data/bsdrc:71 amor/data/tuxrc:72
 msgctxt "About"
@@ -65,12 +66,12 @@
 #: amor/data/eyesrc:6
 msgctxt "Description"
 msgid "Crazy Eyes"
-msgstr ""
+msgstr "العيون المجنونة"
 
 #: amor/data/ghostrc:4
 msgctxt "Description"
 msgid "Spooky Ghost"
-msgstr ""
+msgstr "الشبح المخيف"
 
 #: amor/data/ghostrc:70
 msgctxt "About"
@@ -80,7 +81,7 @@
 #: amor/data/nekokurorc:9
 msgctxt "Description"
 msgid "Neko Kuro"
-msgstr ""
+msgstr "Neko Kuro"
 
 #: amor/data/nekokurorc:50
 msgctxt "About"
@@ -129,7 +130,7 @@
 #: amor/data/wormrc:4
 msgctxt "Description"
 msgid "Little Worm"
-msgstr ""
+msgstr "الدودة الصغيرة"
 
 #: amor/data/wormrc:72
 msgctxt "About"
@@ -144,59 +145,59 @@
 #: amor/src/amor.desktop:73
 msgctxt "GenericName"
 msgid "On-Screen Creature"
-msgstr ""
+msgstr "مخلوق على الشاشة"
 
 #: kteatime/src/kteatime.desktop:2
 msgctxt "Name"
 msgid "KTeaTime"
-msgstr ""
+msgstr "برنامج وقت الشاي KTeaTime"
 
 #: kteatime/src/kteatime.desktop:64
 msgctxt "GenericName"
 msgid "Tea Cooker"
-msgstr ""
+msgstr "طنجرة الشاي"
 
 #: kteatime/src/kteatime.notifyrc:3
 msgctxt "Comment"
 msgid "Tea Cooker"
-msgstr ""
+msgstr "طنجرة الشاي"
 
 #: kteatime/src/kteatime.notifyrc:48
 msgctxt "Name"
 msgid "Tea is ready"
-msgstr ""
+msgstr "الشاي جاهز"
 
 #: kteatime/src/kteatime.notifyrc:111
 msgctxt "Comment"
 msgid "Tea is ready"
-msgstr ""
+msgstr "الشاي جاهز"
 
 #: kteatime/src/kteatime.notifyrc:179
 msgctxt "Name"
 msgid "Tea is getting lonely"
-msgstr ""
+msgstr "الشاي يشعر بالوحدة"
 
 #: kteatime/src/kteatime.notifyrc:231
 msgctxt "Comment"
 msgid "Tea is getting lonely."
-msgstr ""
+msgstr "الشاي يشعر بالوحدة."
 
 #: ktux/src/ktux.desktop:2
 msgctxt "Name"
 msgid "KTux"
-msgstr ""
+msgstr "KTux"
 
 #: ktux/src/ktux.desktop:78
 msgctxt "Name"
 msgid "Setup..."
-msgstr ""
+msgstr "Setup..."
 
 #: ktux/src/ktux.desktop:150
 msgctxt "Name"
 msgid "Display in Specified Window"
-msgstr ""
+msgstr "اعرض في نافذة محددة"
 
 #: ktux/src/ktux.desktop:217
 msgctxt "Name"
 msgid "Display in Root Window"
-msgstr ""
+msgstr "اعرض في النافذة الأمّ"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdeutils.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdeutils.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kdeutils.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kdeutils.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,510 +0,0 @@
-# translation of desktop_kdeutils.po to
-# desktop.po - Arabic Translation.
-# Copyright (C) 2001,2003, 2004, 2006, 2007 Free Software Foundation, Inc.
-# Mohammed Gamal <f2c2001@yahoo.com>, 2001.
-# Nuriddin Aminagha <nuriddin@eminaga.de>, 2003.
-# Anmar Oueja <anmar@canada.com>, 2003.
-# Munzir Taha <munzir@kacst.edu.sa>, 2004.
-# Khaled Hosny <khaledhosny@eglug.org>, 2006.
-# Fahad Al-Saidi <fahad.alsaidi@gmail.com>, 2007.
-# Youssef Chahibi <chahibi@gmail.com>, 2007.
-# Youness BOUTYOUR <niceboy@linuxac.org>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-#
-msgid ""
-msgstr ""
-"Project-Id-Version: desktop_kdeutils\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 13:31+0000\n"
-"PO-Revision-Date: 2011-01-26 04:14+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:03+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-
-#: ark/app/ark.desktop:3
-msgctxt "GenericName"
-msgid "Archiving Tool"
-msgstr "أداة أرشفة"
-
-#: ark/app/ark.desktop:71
-msgctxt "Name"
-msgid "Ark"
-msgstr "أرك"
-
-#: ark/app/ark_addtoservicemenu.desktop:6
-msgctxt "X-KDE-Submenu"
-msgid "Compress"
-msgstr "اضغط"
-
-#: ark/app/ark_addtoservicemenu.desktop:62
-msgctxt "Name"
-msgid "Here"
-msgstr "هنا"
-
-#: ark/app/ark_addtoservicemenu.desktop:116
-msgctxt "Name"
-msgid "As ZIP Archive"
-msgstr "ك أرشيف ZIP"
-
-#: ark/app/ark_addtoservicemenu.desktop:170
-msgctxt "Name"
-msgid "As RAR Archive"
-msgstr "كأرشيف RAR"
-
-#: ark/app/ark_addtoservicemenu.desktop:224
-msgctxt "Name"
-msgid "As ZIP/TAR Archive"
-msgstr "كأرشيف  ZIP/TAR"
-
-#: ark/app/ark_addtoservicemenu.desktop:277
-msgctxt "Name"
-msgid "Compress To..."
-msgstr "اضغط إلى..."
-
-#: ark/app/ark_dndextract.desktop:5
-msgctxt "Name"
-msgid "Ark Extract Here"
-msgstr "أرك استخرج هنا"
-
-#: ark/app/ark_servicemenu.desktop:12
-msgctxt "Name"
-msgid "Extract Archive Here"
-msgstr "فك الأرشيف هنا"
-
-#: ark/app/ark_servicemenu.desktop:65
-msgctxt "Name"
-msgid "Extract Archive To..."
-msgstr "فك الأرشيف إلى..."
-
-#: ark/app/ark_servicemenu.desktop:118
-msgctxt "Name"
-msgid "Extract Archive Here, Autodetect Subfolder"
-msgstr "فك الأرشيف هنا ، تعرف تلقائي للمجلدات الفرعية"
-
-#: ark/kerfuffle/kerfufflePlugin.desktop:4
-msgctxt "Comment"
-msgid "Plugin for handling of archive formats for the Kerfuffle library"
-msgstr "ملحق للتحكم بهيئات الأرشيف لمكتبة Kerfuffle"
-
-#: ark/part/ark_part.desktop:3
-msgctxt "Name"
-msgid "Archiver"
-msgstr "المؤرشف"
-
-#: ark/part/ark_part.desktop:71
-msgctxt "Comment"
-msgid "Archive Handling Tool"
-msgstr "أداة التعامل مع الملفات المضغوطة"
-
-#: ark/plugins/cli7zplugin/kerfuffle_cli7z.desktop:14
-msgctxt "Name"
-msgid "7zip archive plugin"
-msgstr "ملحق أرشيف 7zip"
-
-#: ark/plugins/cliplugin/kerfuffle_cli.desktop:14
-msgctxt "Name"
-msgid "TODO archive plugin"
-msgstr "ملحق أرشيف TODO"
-
-#: ark/plugins/clirarplugin/kerfuffle_clirar.desktop:14
-msgctxt "Name"
-msgid "RAR archive plugin"
-msgstr "ملحق أرشيف RAR"
-
-#: ark/plugins/clizipplugin/kerfuffle_clizip.desktop:14
-msgctxt "Name"
-msgid "ZIP archive plugin"
-msgstr "ملحق أرشيف ZIP"
-
-#: ark/plugins/karchiveplugin/kerfuffle_karchive.desktop:13
-msgctxt "Name"
-msgid "kerfuffle_karchive"
-msgstr "kerfuffle_karchive"
-
-#: ark/plugins/karchiveplugin/kerfuffle_karchive.desktop:67
-msgctxt "Comment"
-msgid "KArchive plugin for Kerfuffle"
-msgstr "KArchive ملحق لـ Kerfuffle"
-
-#: ark/plugins/libarchive/kerfuffle_libarchive.desktop:14
-msgctxt "Name"
-msgid "kerfuffle_libarchive"
-msgstr "kerfuffle_libarchive"
-
-#: ark/plugins/libarchive/kerfuffle_libarchive.desktop:68
-msgctxt "Comment"
-msgid "LibArchive Plugin for Kerfuffle"
-msgstr "LibArchive ملحق لـ Kerfuffle"
-
-#: ark/plugins/libarchive/kerfuffle_libarchive_readonly.desktop:14
-msgctxt "Name"
-msgid "kerfuffle_libarchive_readonly"
-msgstr ""
-
-#: ark/plugins/libsinglefileplugin/kerfuffle_libbz2.desktop:14
-msgctxt "Name"
-msgid "kerfuffle_libbz2"
-msgstr "kerfuffle_libbz2"
-
-#: ark/plugins/libsinglefileplugin/kerfuffle_libbz2.desktop:64
-msgctxt "Comment"
-msgid "libbz2 plugin for Kerfuffle"
-msgstr "ملحق libbz2 لـ Kerfuffle"
-
-#: ark/plugins/libsinglefileplugin/kerfuffle_libgz.desktop:14
-msgctxt "Name"
-msgid "kerfuffle_libgz"
-msgstr "kerfuffle_libgz"
-
-#: ark/plugins/libsinglefileplugin/kerfuffle_libgz.desktop:66
-msgctxt "Comment"
-msgid "libgz plugin for Kerfuffle"
-msgstr "ملحقlibgz لـ Kerfuffle"
-
-#: ark/plugins/libsinglefileplugin/kerfuffle_libxz.desktop:14
-msgctxt "Name"
-msgid "kerfuffle_libxz"
-msgstr "kerfuffle_libxz"
-
-#: ark/plugins/libsinglefileplugin/kerfuffle_libxz.desktop:64
-msgctxt "Comment"
-msgid "libxz plugin for Kerfuffle"
-msgstr "ملحقlibxz لـ Kerfuffle"
-
-#: filelight/misc/filelight.desktop:3
-msgctxt "Name"
-msgid "Filelight"
-msgstr ""
-
-#: filelight/misc/filelight.desktop:43
-msgctxt "GenericName"
-msgid "Disk Usage Statistics"
-msgstr ""
-
-#: filelight/misc/filelight.desktop:87
-msgctxt "Comment"
-msgid "View disk usage information"
-msgstr ""
-
-#: filelight/misc/filelightpart.desktop:3
-msgctxt "Name"
-msgid "Radial Map"
-msgstr ""
-
-#: kcalc/kcalc.desktop:2
-msgctxt "Name"
-msgid "KCalc"
-msgstr "حاسبة ك"
-
-#: kcalc/kcalc.desktop:71
-msgctxt "GenericName"
-msgid "Scientific Calculator"
-msgstr "آلة حاسبة علمية"
-
-#: kcharselect/KCharSelect.desktop:2
-msgctxt "GenericName"
-msgid "Character Selector"
-msgstr "أداة اختيار الرموز"
-
-#: kcharselect/KCharSelect.desktop:75
-msgctxt "Name"
-msgid "KCharSelect"
-msgstr "منتقي الحروف ك"
-
-#: kdf/kcmdf.desktop:15
-msgctxt "Name"
-msgid "Storage Devices"
-msgstr "أجهزة تخزين"
-
-#: kdf/kcmdf.desktop:83
-msgctxt "Comment"
-msgid "Shows the disk usage of the mounted devices"
-msgstr "يعرض المساحة المستخدمة من الأقراص المضمومة"
-
-#: kdf/kdf.desktop:2
-msgctxt "Name"
-msgid "KDiskFree"
-msgstr "KDiskFree"
-
-#: kdf/kdf.desktop:69
-msgctxt "GenericName"
-msgid "View Disk Usage"
-msgstr "عرض المستخدم من القرص"
-
-#: kdf/kwikdisk.desktop:2
-msgctxt "Name"
-msgid "KwikDisk"
-msgstr "KwikDisk"
-
-#: kdf/kwikdisk.desktop:71
-msgctxt "GenericName"
-msgid "Removable Media Utility"
-msgstr "أداة الوسائط القابلة للإزالة"
-
-#: kfloppy/KFloppy.desktop:2
-msgctxt "GenericName"
-msgid "Floppy Formatter"
-msgstr "مهئ الأقراص المرنة"
-
-#: kfloppy/KFloppy.desktop:71
-msgctxt "Name"
-msgid "KFloppy"
-msgstr "كفلوبي"
-
-#: kfloppy/floppy_format.desktop:4
-msgctxt "Name"
-msgid "Format"
-msgstr "تهيئة"
-
-#: kgpg/encryptfile.desktop:9
-msgctxt "Name"
-msgid "Encrypt File"
-msgstr "تشفير ملف"
-
-#: kgpg/encryptfolder.desktop:7
-msgctxt "Name"
-msgid "Archive & Encrypt Folder"
-msgstr "أرشفة و تشفير مجلّد"
-
-#: kgpg/kgpg.desktop:8
-msgctxt "GenericName"
-msgid "Encryption Tool"
-msgstr "أداة للتشفير"
-
-#: kgpg/kgpg.desktop:70
-msgctxt "Comment"
-msgid "A GnuPG frontend"
-msgstr "واجهة لـ GnuPG"
-
-#: kgpg/kgpg.desktop:133
-msgctxt "Name"
-msgid "KGpg"
-msgstr "KGpg"
-
-#: kgpg/viewdecrypted.desktop:8
-msgctxt "Name"
-msgid "View file decrypted"
-msgstr "اعرض ملف مفكوك التشفير"
-
-#: kremotecontrol/dataengine/plasma-engine-kremotecontrol.desktop:2
-msgctxt "Name"
-msgid "Remote Control Data Engine"
-msgstr "محرك بيانات التحكّم عن بعد"
-
-#: kremotecontrol/dataengine/plasma-engine-kremotecontrol.desktop:44
-msgctxt "Comment"
-msgid "Data engine for kremotecontrol"
-msgstr "محرك بيانات لkremotecontrol"
-
-#: kremotecontrol/kcmremotecontrol/kcm_remotecontrol.desktop:22
-msgctxt "Name"
-msgid "Remote Controls"
-msgstr "التحكّم عن بعد"
-
-#: kremotecontrol/kcmremotecontrol/kcm_remotecontrol.desktop:80
-msgctxt "Comment"
-msgid "Configure your remote controls for use with applications"
-msgstr "إعداد التحكّم عن بعد لاستخدامه في التطبيقات"
-
-#: kremotecontrol/kded/kremotecontroldaemon.desktop:2
-msgctxt "Name"
-msgid "K Remote Control Daemon"
-msgstr "مراقب التحكّم عن بعد ك"
-
-#: kremotecontrol/kded/kremotecontroldaemon.notifyrc:3
-msgctxt "Comment"
-msgid "KRemoteControl Daemon"
-msgstr "مراقب KRemoteControl"
-
-#: kremotecontrol/kded/kremotecontroldaemon.notifyrc:46
-msgctxt "Name"
-msgid "KRemoteControl notification"
-msgstr "اشعار KRemoteControl"
-
-#: kremotecontrol/kded/kremotecontroldaemon.notifyrc:86
-msgctxt "Comment"
-msgid "KRemoteControl global notification event"
-msgstr "حدث اشعار عام لـKRemoteControl"
-
-#: kremotecontrol/kded/kremotecontroldaemon.notifyrc:130
-msgctxt "Name"
-msgid "Mode switch event"
-msgstr "حدث تبديل النمط"
-
-#: kremotecontrol/kded/kremotecontroldaemon.notifyrc:171
-msgctxt "Comment"
-msgid "Mode has changed"
-msgstr "غير النمط"
-
-#: kremotecontrol/kded/kremotecontroldaemon.notifyrc:221
-msgctxt "Name"
-msgid "Application event"
-msgstr "حدث التطبيق"
-
-#: kremotecontrol/kded/kremotecontroldaemon.notifyrc:269
-msgctxt "Comment"
-msgid "KRemoteControl has started an application"
-msgstr "شغل KRemoteControl  تطبيقا"
-
-#: kremotecontrol/krcdnotifieritem/krcdnotifieritem.desktop:3
-msgctxt "Name"
-msgid "KRemoteControl Notifier Item"
-msgstr "عنصر منبه KRemoteControl"
-
-#: kremotecontrol/libkremotecontrol/backends/lirc/kremotecontrol_lirc.desktop:8
-msgctxt "Name"
-msgid "Lirc"
-msgstr ""
-
-#: kremotecontrol/libkremotecontrol/backends/lirc/kremotecontrol_lirc.desktop:46
-msgctxt "Comment"
-msgid "Linux Infrared Remote Control"
-msgstr ""
-
-#: kremotecontrol/libkremotecontrol/kremotecontrolmanager.desktop:4
-msgctxt "Comment"
-msgid "Remote Control Management Backend"
-msgstr ""
-
-#: ktimer/ktimer.desktop:2
-msgctxt "GenericName"
-msgid "Countdown Launcher"
-msgstr "مطلق العدّ التنازلى"
-
-#: ktimer/ktimer.desktop:62
-msgctxt "Name"
-msgid "KTimer"
-msgstr "KTimer"
-
-#: kwallet/konfigurator/kwalletconfig.desktop:13
-msgctxt "Name"
-msgid "KDE Wallet"
-msgstr "محفظة كدى"
-
-#: kwallet/konfigurator/kwalletconfig.desktop:76
-msgctxt "Comment"
-msgid "KDE Wallet Configuration"
-msgstr "إعداد محفظة كدى"
-
-#: kwallet/konfigurator/kwalletmanager_show.desktop:2
-#: kwallet/kwalletmanager-kwalletd.desktop:2
-msgctxt "Name"
-msgid "Wallet Management Tool"
-msgstr "أداة إدارة المحفظة"
-
-#: kwallet/kwalletmanager.desktop:2
-msgctxt "Name"
-msgid "KWalletManager"
-msgstr "KWalletManager"
-
-#: kwallet/kwalletmanager.desktop:53
-msgctxt "GenericName"
-msgid "Wallet Management Tool"
-msgstr "أداة إدارة المحفظة"
-
-#: printer-applet/printer-applet.desktop:2
-#: printer-applet/printer-applet.notifyrc:3
-msgctxt "Name"
-msgid "Printer Applet"
-msgstr "بريمج الطباعة"
-
-#: printer-applet/printer-applet.desktop:54
-msgctxt "Comment"
-msgid "System tray icon for managing print jobs"
-msgstr "الأيقونة المصغرة لرسائل عمل الطباعة"
-
-#: printer-applet/printer-applet.notifyrc:55
-msgctxt "Comment"
-msgid "Printer Applet"
-msgstr "بريمج الطباعة"
-
-#: printer-applet/printer-applet.notifyrc:106
-msgctxt "Name"
-msgid "New Printer"
-msgstr "طابعة جديدة"
-
-#: printer-applet/printer-applet.notifyrc:155
-msgctxt "Comment"
-msgid "Configuring New Printer"
-msgstr "يضبط الطابعة الجديدة"
-
-#: printer-applet/printer-applet.notifyrc:207
-msgctxt "Name"
-msgid "Printer Added"
-msgstr "أضيفت طابعة"
-
-#: printer-applet/printer-applet.notifyrc:256
-msgctxt "Comment"
-msgid "Printer Added"
-msgstr "أضيفت طباعة"
-
-#: printer-applet/printer-applet.notifyrc:308
-msgctxt "Name"
-msgid "Missing Printer Driver"
-msgstr "مشغل الطابعة مفقود"
-
-#: printer-applet/printer-applet.notifyrc:357
-msgctxt "Comment"
-msgid "Missing Printer Driver"
-msgstr "مشغل الطابعة مفقود"
-
-#: printer-applet/printer-applet.notifyrc:409
-msgctxt "Name"
-msgid "Other"
-msgstr "أخرى"
-
-#: printer-applet/printer-applet.notifyrc:458
-msgctxt "Comment"
-msgid "Other"
-msgstr "أخرى"
-
-#: superkaramba/plasma/plasma-package-superkaramba.desktop:2
-msgctxt "Name"
-msgid "SuperKaramba Theme Files"
-msgstr "ملفات سوبركارامبا"
-
-#: superkaramba/plasma/plasma-package-superkaramba.desktop:53
-msgctxt "Comment"
-msgid "Karamba Desktop Themes"
-msgstr "سمات كارامبا لسطح المكتب"
-
-#: superkaramba/plasma/plasma-scriptengine-superkaramba.desktop:2
-#: superkaramba/plasma/plasma-skapplet-default.desktop:2
-#: superkaramba/src/superkaramba.desktop:2
-msgctxt "Name"
-msgid "SuperKaramba"
-msgstr "سوبركارامبا"
-
-#: superkaramba/plasma/plasma-scriptengine-superkaramba.desktop:61
-msgctxt "Comment"
-msgid "Karamba Desktop Theme"
-msgstr "سمة كارامبا لسطح المكتب"
-
-#: superkaramba/plasma/plasma-skapplet-default.desktop:61
-msgctxt "Comment"
-msgid "SuperKaramba Plasma Applet"
-msgstr "بريمج بلازما سوبركارامبا"
-
-#: superkaramba/src/superkaramba.desktop:65
-msgctxt "Comment"
-msgid "An engine for cool desktop eyecandy."
-msgstr "محرك لجماليات سطح مكتب لطيفة."
-
-#: superkaramba/src/superkaramba.desktop:121
-msgctxt "GenericName"
-msgid "Desktop Widgets"
-msgstr "قطع سطح المكتب"
-
-#: sweeper/sweeper.desktop:10
-msgctxt "Name"
-msgid "Sweeper"
-msgstr "الكناس"
-
-#: sweeper/sweeper.desktop:64
-msgctxt "GenericName"
-msgid "System Cleaner"
-msgstr "منظف النظام"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kde-wallpapers.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kde-wallpapers.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kde-wallpapers.po	1970-01-01 00:00:00.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kde-wallpapers.po	2012-03-23 06:41:59.000000000 +0000
@@ -0,0 +1,90 @@
+# Abdalrahim G. Fakhouri <abdilra7eem@yahoo.com>, 2012.
+msgid ""
+msgstr ""
+"Project-Id-Version: desktop files\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-09-08 19:08+0000\n"
+"PO-Revision-Date: 2012-03-12 22:44+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:12+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
+
+#: Aghi/metadata.desktop:2
+msgctxt "Name"
+msgid "Aghi"
+msgstr ""
+
+#: Air/metadata.desktop:2
+msgctxt "Name"
+msgid "Air"
+msgstr "هواء"
+
+#: Autumn/metadata.desktop:2
+msgctxt "Name"
+msgid "Autumn"
+msgstr "خريف"
+
+#: Blue_Wood/metadata.desktop:2
+msgctxt "Name"
+msgid "Blue Wood"
+msgstr "الغابة الزرقاء"
+
+#: Evening/metadata.desktop:2
+msgctxt "Name"
+msgid "Evening"
+msgstr ""
+
+#: Fields_of_Peace/metadata.desktop:2
+msgctxt "Name"
+msgid "Fields of Peace"
+msgstr ""
+
+#: Finally_Summer_in_Germany/metadata.desktop:2
+msgctxt "Name"
+msgid "Finally Summer in Germany"
+msgstr "وأخيراً صيف في ألمانيا"
+
+#: Fresh_Morning/metadata.desktop:2
+msgctxt "Name"
+msgid "Fresh Morning"
+msgstr "الصباح الجديد"
+
+#: Grass/metadata.desktop:2
+msgctxt "Name"
+msgid "Grass"
+msgstr "العشب"
+
+#: Hanami/metadata.desktop:2
+msgctxt "Name"
+msgid "Hanami"
+msgstr "هانامي"
+
+#: Horos/metadata.desktop:2
+msgctxt "Name"
+msgid "Horos"
+msgstr ""
+
+#: Media_Life/metadata.desktop:2
+msgctxt "Name"
+msgid "Media Life"
+msgstr "حياة الوسائط"
+
+#: Plasmalicious/metadata.desktop:2
+msgctxt "Name"
+msgid "Plasmalicious"
+msgstr ""
+
+#: Quadros/metadata.desktop:2
+msgctxt "Name"
+msgid "Quadros"
+msgstr ""
+
+#: Red_Leaf/metadata.desktop:2
+msgctxt "Name"
+msgid "Red Leaf"
+msgstr ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kde-workspace.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kde-workspace.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/desktop_kde-workspace.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/desktop_kde-workspace.po	2012-03-23 06:42:01.000000000 +0000
@@ -6,46 +6,47 @@
 # zayed <zayed.alsaidi@gmail.com>, 2008.
 # Gabi Sarkis <gfsarkis@gmail.com>, 2010.
 # translation of desktop_kdebase.po to
-#
+# hanny <hannysabbagh@hotmail.com>, 2012.
+# Abdalrahim G. Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: desktop_kdebase\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2011-12-09 09:01+0000\n"
-"Last-Translator: Gabi Sarkis <Unknown>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"PO-Revision-Date: 2012-03-12 22:26+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:18+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:41+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: obj-i686-linux-gnu/kdm/kfrontend/sessions/kde-plasma-safe.desktop:6
 msgctxt "Name"
 msgid "KDE Plasma Workspace (failsafe session)"
-msgstr ""
+msgstr "مساحة عمل بلازما كدي (الجلسة الآمنة)"
 
 #: obj-i686-linux-gnu/kdm/kfrontend/sessions/kde-plasma-safe.desktop:7
 msgctxt "Comment"
 msgid "The desktop made by KDE (failsafe session)"
-msgstr ""
+msgstr "سطح المكتب الذي أنتجته كدي (الجلسة الآمنة)"
 
 #: obj-i686-linux-gnu/kdm/kfrontend/sessions/kde-plasma.desktop:6
 msgctxt "Name"
 msgid "KDE Plasma Workspace"
-msgstr ""
+msgstr "مساحة عمل بلازما كدي"
 
 #: obj-i686-linux-gnu/kdm/kfrontend/sessions/kde-plasma.desktop:7
 msgctxt "Comment"
 msgid "The desktop made by KDE"
-msgstr ""
+msgstr "سطح المكتب الذي أنتجته كدي"
 
 #: plasma/netbook/containments/sal/plasma-containment-sal.desktop:2
 msgctxt "Name"
 msgid "Search and Launch"
-msgstr ""
+msgstr "ابحث و شغل"
 
 #: plasma/desktop/shell/data/layouts/org.kde.plasma-desktop.defaultPanel/metadata.desktop:3
 #: plasma/desktop/shell/data/layouts/plasma-layout-org.kde.plasma-desktop.defaultPanel.desktop:3
@@ -60,19 +61,19 @@
 #: plasma/desktop/shell/data/layouts/org.kde.plasma-desktop.desktopIcons/metadata.desktop:3
 msgctxt "Name"
 msgid "Desktop Icons"
-msgstr ""
+msgstr "أيقونات سطح المكتب"
 
 #: obj-i686-linux-gnu/plasma/desktop/shell/plasma-layout-org.kde.plasma-desktop.findWidgets.desktop:3
 #: plasma/desktop/shell/data/layouts/org.kde.plasma-desktop.findWidgets/metadata.desktop:3
 msgctxt "Name"
 msgid "Find Widgets"
-msgstr ""
+msgstr "جد الودجات"
 
 #: obj-i686-linux-gnu/plasma/desktop/shell/plasma-layout-org.kde.plasma-desktop.photoActivity.desktop:3
 #: plasma/desktop/shell/data/layouts/org.kde.plasma-desktop.photoActivity/metadata.desktop:3
 msgctxt "Name"
 msgid "Photos Activity"
-msgstr ""
+msgstr "أنشطة الصور"
 
 #: debian/build-kwin-gles/plasma/generic/dataengines/share/backends/imgsusepasteorg/plasma-dataengine-share-addon-imgsusepasteorg.desktop:2
 #: debian/tmp/usr/share/kde4/apps/plasma/shareprovider/imgsusepasteorg/metadata.desktop:2
@@ -81,7 +82,7 @@
 #: plasma/generic/dataengines/share/backends/imgsusepasteorg/metadata.desktop:2
 msgctxt "Name"
 msgid "img.susepaste.org"
-msgstr ""
+msgstr "img.susepaste.org"
 
 #: debian/build-kwin-gles/plasma/generic/dataengines/share/backends/imgsusepasteorg/plasma-dataengine-share-addon-imgsusepasteorg.desktop:49
 #: debian/tmp/usr/share/kde4/apps/plasma/shareprovider/imgsusepasteorg/metadata.desktop:49
@@ -90,7 +91,7 @@
 #: plasma/generic/dataengines/share/backends/imgsusepasteorg/metadata.desktop:49
 msgctxt "Comment"
 msgid "Allows images to be shared using the susepaste.org service"
-msgstr ""
+msgstr "يسمح للصور أن تُشارك بإستخدام خدمة susepaste.org"
 
 #: obj-i686-linux-gnu/plasma/generic/dataengines/share/backends/imgur/plasma-dataengine-share-addon-imgur.desktop:2
 #: plasma/generic/dataengines/share/backends/imgur/metadata.desktop:2
@@ -105,7 +106,7 @@
 #: plasma/generic/dataengines/share/backends/imgur/metadata.desktop:56
 msgctxt "Comment"
 msgid "Allows images to be shared using the imgur service"
-msgstr ""
+msgstr "يسمح للصور أن تُشارك بإستخدام خدمة imgur"
 
 #: debian/build-kwin-gles/plasma/generic/dataengines/share/backends/kde/plasma-dataengine-share-addon-kde.desktop:2
 #: debian/tmp/usr/share/kde4/apps/plasma/shareprovider/kde/metadata.desktop:2
@@ -114,7 +115,7 @@
 #: plasma/generic/dataengines/share/backends/kde/metadata.desktop:2
 msgctxt "Name"
 msgid "kde.org"
-msgstr ""
+msgstr "kde.org"
 
 #: debian/build-kwin-gles/plasma/generic/dataengines/share/backends/kde/plasma-dataengine-share-addon-kde.desktop:52
 #: debian/tmp/usr/share/kde4/apps/plasma/shareprovider/kde/metadata.desktop:52
@@ -123,13 +124,13 @@
 #: plasma/generic/dataengines/share/backends/kde/metadata.desktop:52
 msgctxt "Comment"
 msgid "Allows text to be shared using the kde.org service"
-msgstr ""
+msgstr "يسمح للنصوص أن تُشارك بإستخدام خدمة kde.org"
 
 #: obj-i686-linux-gnu/plasma/generic/dataengines/share/backends/pastebincom/plasma-dataengine-share-addon-pastebincom.desktop:2
 #: plasma/generic/dataengines/share/backends/pastebincom/metadata.desktop:2
 msgctxt "Name"
 msgid "pastebin.com"
-msgstr ""
+msgstr "pastebin.com"
 
 #: debian/build-kwin-gles/plasma/generic/dataengines/share/backends/pastebincom/plasma-dataengine-share-addon-pastebincom.desktop:57
 #: debian/tmp/usr/share/kde4/apps/plasma/shareprovider/pastebincom/metadata.desktop:57
@@ -138,13 +139,13 @@
 #: plasma/generic/dataengines/share/backends/pastebincom/metadata.desktop:57
 msgctxt "Comment"
 msgid "Allows text to be shared using the pastebin.com service"
-msgstr ""
+msgstr "يسمح للنصوص أن تُشارك بإستخدام خدمة pastebin.com"
 
 #: obj-i686-linux-gnu/plasma/generic/dataengines/share/backends/pasteopensuseorg/plasma-dataengine-share-addon-pasteopensuseorg.desktop:2
 #: plasma/generic/dataengines/share/backends/pasteopensuseorg/metadata.desktop:2
 msgctxt "Name"
 msgid "paste.opensuse.org"
-msgstr ""
+msgstr "paste.opensuse.org"
 
 #: obj-i686-linux-gnu/plasma/generic/dataengines/share/backends/pasteopensuseorg/plasma-dataengine-share-addon-pasteopensuseorg.desktop:53
 #: plasma/generic/dataengines/share/backends/pasteopensuseorg/metadata.desktop:53
@@ -156,13 +157,13 @@
 #: plasma/generic/dataengines/share/backends/pasteubuntucom/metadata.desktop:2
 msgctxt "Name"
 msgid "paste.ubuntu.com"
-msgstr ""
+msgstr "paste.ubuntu.com"
 
 #: obj-i686-linux-gnu/plasma/generic/dataengines/share/backends/privatepaste/plasma-dataengine-share-addon-privatepastecom.desktop:2
 #: plasma/generic/dataengines/share/backends/privatepaste/metadata.desktop:2
 msgctxt "Name"
 msgid "privatepaste.com"
-msgstr ""
+msgstr "privatepaste.com"
 
 #: obj-i686-linux-gnu/plasma/generic/dataengines/share/backends/privatepaste/plasma-dataengine-share-addon-privatepastecom.desktop:52
 #: plasma/generic/dataengines/share/backends/privatepaste/metadata.desktop:52
@@ -174,7 +175,7 @@
 #: plasma/generic/dataengines/share/backends/simplestimagehosting/metadata.desktop:2
 msgctxt "Name"
 msgid "Simplest Image Hosting"
-msgstr ""
+msgstr "أبسط إستضافة للصور"
 
 #: debian/build-kwin-gles/plasma/generic/dataengines/share/backends/simplestimagehosting/plasma-dataengine-share-addon-simplestimagehosting.desktop:54
 #: debian/tmp/usr/share/kde4/apps/plasma/shareprovider/simplestimagehosting/metadata.desktop:54
@@ -189,7 +190,7 @@
 #: plasma/generic/dataengines/share/backends/wklej/metadata.desktop:2
 msgctxt "Name"
 msgid "wklej.org"
-msgstr ""
+msgstr "wklej.org"
 
 #: debian/build-kwin-gles/plasma/generic/dataengines/share/backends/wklej/plasma-dataengine-share-addon-wklej.desktop:57
 #: debian/tmp/usr/share/kde4/apps/plasma/shareprovider/wklej/metadata.desktop:57
@@ -198,13 +199,13 @@
 #: plasma/generic/dataengines/share/backends/wklej/metadata.desktop:57
 msgctxt "Comment"
 msgid "Allows text to be shared using the wklej.org service"
-msgstr ""
+msgstr "يسمح للنصوص أن تُشارك بإستخدام خدمة wklej.org"
 
 #: obj-i686-linux-gnu/plasma/generic/dataengines/share/backends/wstaw/plasma-dataengine-share-addon-wstaw.desktop:2
 #: plasma/generic/dataengines/share/backends/wstaw/metadata.desktop:2
 msgctxt "Name"
 msgid "wstaw.org"
-msgstr ""
+msgstr "wstaw.org"
 
 #: debian/build-kwin-gles/plasma/generic/dataengines/share/backends/wstaw/plasma-dataengine-share-addon-wstaw.desktop:58
 #: debian/tmp/usr/share/kde4/apps/plasma/shareprovider/wstaw/metadata.desktop:58
@@ -238,7 +239,7 @@
 #: kinfocenter/kinfocenter.desktop:9
 msgctxt "Name"
 msgid "KInfoCenter"
-msgstr "مركز معلومات  كدي"
+msgstr "مركز معلومات كدي"
 
 #: kinfocenter/kinfocenter.desktop:96
 msgctxt "GenericName"
@@ -325,7 +326,7 @@
 #: freespacenotifier/freespacenotifier.notifyrc:3
 msgctxt "Comment"
 msgid "KDE Free Space Notifier Daemon"
-msgstr "مراقب كدي لمنبه المساحة الفارغة"
+msgstr "مراقب كدي لمنبه المساحة الحرّة"
 
 #: freespacenotifier/freespacenotifier.notifyrc:54
 msgctxt "Name"
@@ -347,7 +348,7 @@
 #: freespacenotifier/freespacenotifier.notifyrc:260
 msgctxt "Name"
 msgid "Running low on disk space"
-msgstr "مساحة القرص منخفضة"
+msgstr "قارب القرص على الامتلاء"
 
 #: freespacenotifier/freespacenotifier.notifyrc:310
 msgctxt "Comment"
@@ -357,7 +358,7 @@
 #: kcontrol/access/kaccess.notifyrc:3
 msgctxt "Comment"
 msgid "Accessibility"
-msgstr "إتاحة الوصول"
+msgstr "الإتاحة"
 
 #: kcontrol/access/kaccess.notifyrc:93
 msgctxt "Name"
@@ -564,7 +565,7 @@
 "A minimal window manager based on AEWM, enhanced by virtual desktops and "
 "partial GNOME support"
 msgstr ""
-"مدير نوافذ مختزل بني على قاعدة AEWM وحُسّن بسطوح المكتب الإفتراضية وبدعم "
+"مدير نوافذ مختزل بني على قاعدة AEWM وحُسّن بسطوح المكتب الافتراضية وبدعم "
 "جزئي لجنوم"
 
 #: kdm/kfrontend/sessions/aewm.desktop:5
@@ -1021,7 +1022,7 @@
 #: kdm/kfrontend/sessions/xfce4.desktop:5
 msgctxt "Name"
 msgid "Xfce 4"
-msgstr ""
+msgstr "XFce 4"
 
 #: kdm/kfrontend/sessions/xfce4.desktop:91
 msgctxt "Comment"
@@ -1238,7 +1239,7 @@
 #: kwin/kwin.notifyrc:142
 msgctxt "Comment"
 msgid "Virtual desktop one is selected"
-msgstr "تم اختيار سطح المكتب الإفتراضي 1"
+msgstr "تم اختيار سطح المكتب الافتراضي 1"
 
 #: kwin/kwin.notifyrc:227
 msgctxt "Name"
@@ -1248,7 +1249,7 @@
 #: kwin/kwin.notifyrc:311
 msgctxt "Comment"
 msgid "Virtual desktop two is selected"
-msgstr "تم اختيار سطح المكتب الإفتراضي 2"
+msgstr "تم اختيار سطح المكتب الافتراضي 2"
 
 #: kwin/kwin.notifyrc:397
 msgctxt "Name"
@@ -1258,7 +1259,7 @@
 #: kwin/kwin.notifyrc:481
 msgctxt "Comment"
 msgid "Virtual desktop three is selected"
-msgstr "تم اختيار سطح المكتب الإفتراضي 3"
+msgstr "تم اختيار سطح المكتب الافتراضي 3"
 
 #: kwin/kwin.notifyrc:567
 msgctxt "Name"
@@ -1268,7 +1269,7 @@
 #: kwin/kwin.notifyrc:651
 msgctxt "Comment"
 msgid "Virtual desktop four is selected"
-msgstr "تم اختيار سطح المكتب الإفتراضي 4"
+msgstr "تم اختيار سطح المكتب الافتراضي 4"
 
 #: kwin/kwin.notifyrc:736
 msgctxt "Name"
@@ -1278,7 +1279,7 @@
 #: kwin/kwin.notifyrc:820
 msgctxt "Comment"
 msgid "Virtual desktop five is selected"
-msgstr "تم اختيار سطح المكتب الإفتراضي 5"
+msgstr "تم اختيار سطح المكتب الافتراضي 5"
 
 #: kwin/kwin.notifyrc:906
 msgctxt "Name"
@@ -1288,7 +1289,7 @@
 #: kwin/kwin.notifyrc:990
 msgctxt "Comment"
 msgid "Virtual desktop six is selected"
-msgstr "تم اختيار سطح المكتب الإفتراضي 6"
+msgstr "تم اختيار سطح المكتب الافتراضي 6"
 
 #: kwin/kwin.notifyrc:1074
 msgctxt "Name"
@@ -1298,7 +1299,7 @@
 #: kwin/kwin.notifyrc:1158
 msgctxt "Comment"
 msgid "Virtual desktop seven is selected"
-msgstr "تم اختيار سطح المكتب الإفتراضي 7"
+msgstr "تم اختيار سطح المكتب الافتراضي 7"
 
 #: kwin/kwin.notifyrc:1244
 msgctxt "Name"
@@ -1308,7 +1309,7 @@
 #: kwin/kwin.notifyrc:1328
 msgctxt "Comment"
 msgid "Virtual desktop eight is selected"
-msgstr "تم اختيار سطح المكتب الإفتراضي 8"
+msgstr "تم اختيار سطح المكتب الافتراضي 8"
 
 #: kwin/kwin.notifyrc:1414
 msgctxt "Name"
@@ -1318,7 +1319,7 @@
 #: kwin/kwin.notifyrc:1496
 msgctxt "Comment"
 msgid "Virtual desktop nine is selected"
-msgstr "تم اختيار سطح المكتب الإفتراضي 9"
+msgstr "تم اختيار سطح المكتب الافتراضي 9"
 
 #: kwin/kwin.notifyrc:1580
 msgctxt "Name"
@@ -1328,7 +1329,7 @@
 #: kwin/kwin.notifyrc:1662
 msgctxt "Comment"
 msgid "Virtual desktop ten is selected"
-msgstr "تم اختيار سطح المكتب الإفتراضي 10"
+msgstr "تم اختيار سطح المكتب الافتراضي 10"
 
 #: kwin/kwin.notifyrc:1746
 msgctxt "Name"
@@ -1338,7 +1339,7 @@
 #: kwin/kwin.notifyrc:1828
 msgctxt "Comment"
 msgid "Virtual desktop eleven is selected"
-msgstr "تم اختيار سطح المكتب الإفتراضي 11"
+msgstr "تم اختيار سطح المكتب الافتراضي 11"
 
 #: kwin/kwin.notifyrc:1911
 msgctxt "Name"
@@ -1348,7 +1349,7 @@
 #: kwin/kwin.notifyrc:1993
 msgctxt "Comment"
 msgid "Virtual desktop twelve is selected"
-msgstr "تم اختيار سطح المكتب الإفتراضي 12"
+msgstr "تم اختيار سطح المكتب الافتراضي 12"
 
 #: kwin/kwin.notifyrc:2076
 msgctxt "Name"
@@ -1358,7 +1359,7 @@
 #: kwin/kwin.notifyrc:2158
 msgctxt "Comment"
 msgid "Virtual desktop thirteen is selected"
-msgstr "تم اختيار سطح المكتب الإفتراضي 13"
+msgstr "تم اختيار سطح المكتب الافتراضي 13"
 
 #: kwin/kwin.notifyrc:2242
 msgctxt "Name"
@@ -1368,7 +1369,7 @@
 #: kwin/kwin.notifyrc:2324
 msgctxt "Comment"
 msgid "Virtual desktop fourteen is selected"
-msgstr "تم اختيار سطح المكتب الإفتراضي 14"
+msgstr "تم اختيار سطح المكتب الافتراضي 14"
 
 #: kwin/kwin.notifyrc:2407
 msgctxt "Name"
@@ -1378,7 +1379,7 @@
 #: kwin/kwin.notifyrc:2489
 msgctxt "Comment"
 msgid "Virtual desktop fifteen is selected"
-msgstr "تم اختيار سطح المكتب الإفتراضي 15"
+msgstr "تم اختيار سطح المكتب الافتراضي 15"
 
 #: kwin/kwin.notifyrc:2573
 msgctxt "Name"
@@ -1388,7 +1389,7 @@
 #: kwin/kwin.notifyrc:2655
 msgctxt "Comment"
 msgid "Virtual desktop sixteen is selected"
-msgstr "تم اختيار سطح المكتب الإفتراضي 16"
+msgstr "تم اختيار سطح المكتب الافتراضي 16"
 
 #: kwin/kwin.notifyrc:2739
 msgctxt "Name"
@@ -1398,7 +1399,7 @@
 #: kwin/kwin.notifyrc:2821
 msgctxt "Comment"
 msgid "Virtual desktop seventeen is selected"
-msgstr "تم اختيار سطح المكتب الإفتراضي 17"
+msgstr "تم اختيار سطح المكتب الافتراضي 17"
 
 #: kwin/kwin.notifyrc:2904
 msgctxt "Name"
@@ -1408,7 +1409,7 @@
 #: kwin/kwin.notifyrc:2986
 msgctxt "Comment"
 msgid "Virtual desktop eighteen is selected"
-msgstr "تم اختيار سطح المكتب الإفتراضي 18"
+msgstr "تم اختيار سطح المكتب الافتراضي 18"
 
 #: kwin/kwin.notifyrc:3070
 msgctxt "Name"
@@ -1418,7 +1419,7 @@
 #: kwin/kwin.notifyrc:3152
 msgctxt "Comment"
 msgid "Virtual desktop nineteen is selected"
-msgstr "تم اختيار سطح المكتب الإفتراضي 19"
+msgstr "تم اختيار سطح المكتب الافتراضي 19"
 
 #: kwin/kwin.notifyrc:3236
 msgctxt "Name"
@@ -1428,7 +1429,7 @@
 #: kwin/kwin.notifyrc:3318
 msgctxt "Comment"
 msgid "Virtual desktop twenty is selected"
-msgstr "تم اختيار سطح المكتب الإفتراضي 20"
+msgstr "تم اختيار سطح المكتب الافتراضي 20"
 
 #: kwin/kwin.notifyrc:3402
 msgctxt "Name"
@@ -1889,12 +1890,12 @@
 #: powerdevil/powerdevil.notifyrc:1742
 msgctxt "Name"
 msgid "Internal KDE Power Management System Error"
-msgstr ""
+msgstr "خطأ داخلي في نظام مراقب الطاقة لكدي"
 
 #: powerdevil/powerdevil.notifyrc:1787
 msgctxt "Comment"
 msgid "The KDE Power Management System has triggered an internal error"
-msgstr ""
+msgstr "أطلق مراقب الطاقة خطأً داخلياً"
 
 #: powerdevil/powerdevil.notifyrc:1893
 msgctxt "Name"
@@ -1909,7 +1910,7 @@
 #: powerdevil/powerdevil.notifyrc:1971
 msgctxt "Name"
 msgid "Broken battery notification"
-msgstr ""
+msgstr "تبليغ البطارية التالفة"
 
 #: powerdevil/powerdevil.notifyrc:2013
 msgctxt "Comment"
@@ -1917,6 +1918,8 @@
 "This notification will pop up if KDE Power Management System detects some "
 "troubles with one of your batteries"
 msgstr ""
+"هذا الإشعار سيظهر إذا إكتشف نظام إدارة الطاقة لكدي بعض المشاكل في واحدة من "
+"بطارياتك"
 
 #: plasma/generic/applets/devicenotifier/test-predicate-openinwindow.desktop:7
 msgctxt "Name"
@@ -2301,22 +2304,22 @@
 #: kcontrol/input/cursortheme.desktop:12
 msgctxt "Name"
 msgid "Cursor Theme"
-msgstr ""
+msgstr "سِمة المؤشر"
 
 #: kcontrol/input/cursortheme.desktop:63
 msgctxt "Comment"
 msgid "Customize the mouse cursor appearance"
-msgstr ""
+msgstr "خصص مظهر سِمة مؤشر الفأرة"
 
 #: kwin/kcmkwin/kwindesktop/desktop.desktop:14
 msgctxt "Name"
 msgid "Virtual Desktops"
-msgstr "أسطح المكتب الإفتراضية"
+msgstr "أسطح المكتب الافتراضية"
 
 #: kwin/kcmkwin/kwindesktop/desktop.desktop:67
 msgctxt "Comment"
 msgid "You can configure how many virtual desktops there are."
-msgstr "تستطيع ضبط عدد أسطح المكتب الإفتراضية"
+msgstr "تستطيع ضبط عدد أسطح المكتب الافتراضية"
 
 #: kcontrol/desktoppaths/desktoppath.desktop:14
 msgctxt "Name"
@@ -2341,7 +2344,7 @@
 #: kinfocenter/Categories/deviceinfocategory.desktop:7
 msgctxt "Name"
 msgid "Lost And Found"
-msgstr ""
+msgstr "فُقد و وُجد"
 
 #: kinfocenter/Modules/devinfo/devinfo.desktop:13
 msgctxt "Name"
@@ -2398,7 +2401,7 @@
 #: kinfocenter/Categories/graphicalinfocategory.desktop:7
 msgctxt "Name"
 msgid "Graphical Information"
-msgstr ""
+msgstr "المعلومات الرسومية"
 
 #: kinfocenter/Modules/info/interrupts.desktop:14
 msgctxt "Name"
@@ -2485,7 +2488,7 @@
 #: kcontrol/access/kaccess.desktop:3
 msgctxt "Name"
 msgid "KDE Accessibility Tool"
-msgstr "أداة كدي لإتاحة الوصول"
+msgstr "أداة كدي للإتاحة"
 
 #: kinfocenter/Modules/infosummary/kcm_infosummary.desktop:11
 msgctxt "Name"
@@ -2531,7 +2534,7 @@
 #: systemsettings/categories/settings-accessibility.desktop:8
 msgctxt "Name"
 msgid "Accessibility"
-msgstr "إتاحة الوصول"
+msgstr "الإتاحة"
 
 #: kcontrol/access/kcmaccess.desktop:105
 msgctxt "Comment"
@@ -2581,12 +2584,12 @@
 #: freespacenotifier/freespacenotifier.desktop:2
 msgctxt "Name"
 msgid "Free Space Notifier"
-msgstr "منبه المساحة الفارغة"
+msgstr "منبه المساحة الحرة"
 
 #: freespacenotifier/freespacenotifier.desktop:54
 msgctxt "Comment"
 msgid "Warns when running out of space on your home folder"
-msgstr "يحذر عندما توشك مساحة مجلد المنزل على النفاذ"
+msgstr "يحذر عندما توشك مساحة مجلد المنزل على النفاد"
 
 #: libs/kephal/service/kephal.desktop:10
 msgctxt "Name"
@@ -3005,12 +3008,12 @@
 #: kwin/effects/screenshot/screenshot.desktop:2
 msgctxt "Name"
 msgid "Screenshot"
-msgstr ""
+msgstr "لقطة شاشة"
 
 #: kwin/effects/screenshot/screenshot.desktop:56
 msgctxt "Comment"
 msgid "Saves screenshot of active window into the home directory"
-msgstr ""
+msgstr "يحفظ لقطة شاشة للنافذة الحالية إلى مجلد المنزل"
 
 #: kwin/effects/sheet/sheet.desktop:2
 msgctxt "Name"
@@ -3289,7 +3292,7 @@
 #: kinfocenter/Categories/networkinfocategory.desktop:7
 msgctxt "Name"
 msgid "Network Information"
-msgstr ""
+msgstr "معلومات الشبكة"
 
 #: kinfocenter/Modules/nics/nic.desktop:12
 msgctxt "Name"
@@ -3415,7 +3418,7 @@
 #: plasma/generic/runners/activities/plasma-runner-activityrunner.desktop:2
 msgctxt "Name"
 msgid "Activities"
-msgstr ""
+msgstr "الأنشطة"
 
 #: debian/tmp/usr/share/kde4/services/plasma-applet-org.kde.showActivityManager.desktop:50
 #: plasma/desktop/applets/showActivityManager/plasma-applet-org.kde.showActivityManager.desktop:50
@@ -3586,7 +3589,7 @@
 #: plasma/desktop/containments/desktop/plasma-containment-desktop.desktop:69
 msgctxt "Comment"
 msgid "Default desktop"
-msgstr ""
+msgstr "سطح المكتب الافتراضي"
 
 #: plasma/desktop/containments/desktop/plasma-containment-desktopdashboard.desktop:3
 msgctxt "Name|plasma containment"
@@ -3596,7 +3599,7 @@
 #: plasma/desktop/containments/desktop/plasma-containment-desktopdashboard.desktop:59
 msgctxt "Comment"
 msgid "Widget Dashboard"
-msgstr ""
+msgstr "لوحة الودجة"
 
 #: plasma/netbook/containments/netpanel/plasma-containment-netpanel.desktop:2
 msgctxt "Name"
@@ -3677,7 +3680,7 @@
 #: plasma/generic/containmentactions/switchdesktop/plasma-containmentactions-switchdesktop.desktop:66
 msgctxt "Comment"
 msgid "Switch to another virtual desktop"
-msgstr "بدّل إلى سطح مكتب إفتراضي آخر"
+msgstr "بدّل إلى سطح مكتب افتراضي آخر"
 
 #: plasma/generic/containmentactions/switchwindow/plasma-containmentactions-switchwindow.desktop:2
 msgctxt "Name"
@@ -3913,12 +3916,12 @@
 #: plasma/generic/dataengines/activities/plasma-engine-activities.desktop:2
 msgctxt "Name"
 msgid "Activities Engine"
-msgstr ""
+msgstr "محرك الأنشطة"
 
 #: plasma/generic/dataengines/activities/plasma-engine-activities.desktop:48
 msgctxt "Comment"
 msgid "Information on Plasma Activities"
-msgstr ""
+msgstr "معلومات عن أنشطة بلازما"
 
 #: plasma/generic/dataengines/akonadi/plasma-engine-akonadi.desktop:2
 msgctxt "Name"
@@ -4003,7 +4006,7 @@
 #: plasma/desktop/applets/pager/plasma-pager-default.desktop:81
 msgctxt "Comment"
 msgid "Switch between virtual desktops"
-msgstr "يبدل بين أسطح المكتب الإفتراضية"
+msgstr "يبدل بين أسطح المكتب الافتراضية"
 
 #: debian/tmp/usr/share/kde4/services/plasma-runner-activityrunner.desktop:50
 #: plasma/generic/runners/activities/plasma-runner-activityrunner.desktop:50
@@ -4354,12 +4357,12 @@
 #: plasma/desktop/shell/toolbox/plasma-toolbox-desktoptoolbox.desktop:2
 msgctxt "Comment"
 msgid "Default desktop toolbox for the Plasma desktop shell"
-msgstr ""
+msgstr "صندوق أدوات سطح المكتب الافتراضي لصدفة سطح مكتب بلازما"
 
 #: plasma/desktop/shell/toolbox/plasma-toolbox-desktoptoolbox.desktop:44
 msgctxt "Name"
 msgid "Desktop toolbox"
-msgstr ""
+msgstr "صندوق أدوات سطح المكتب"
 
 #: plasma/netbook/shell/nettoolbox/plasma-toolbox-nettoolbox.desktop:2
 msgctxt "Comment"
@@ -4374,12 +4377,12 @@
 #: plasma/desktop/shell/toolbox/plasma-toolbox-paneltoolbox.desktop:2
 msgctxt "Comment"
 msgid "Default panel toolbox for the Plasma desktop shell"
-msgstr ""
+msgstr "صندوق أدوات الشريط الافتراضي لصدفة سطح مكتب بلازما"
 
 #: plasma/desktop/shell/toolbox/plasma-toolbox-paneltoolbox.desktop:45
 msgctxt "Name"
 msgid "Panel toolbox"
-msgstr ""
+msgstr "صندوق أدوات الشريط"
 
 #: plasma/generic/wallpapers/color/plasma-wallpaper-color.desktop:2
 msgctxt "Name"
@@ -4405,7 +4408,7 @@
 #: kcontrol/keyboard/plasma_applet_keyboard.desktop:91
 msgctxt "Comment"
 msgid "View and switch between active keyboard layouts"
-msgstr ""
+msgstr "إعرض وبدل بين مخططات لوحة المفاتيح"
 
 #: plasma/generic/dataengines/statusnotifieritem/plasma_engine_statusnotifieritem.desktop:2
 msgctxt "Name"
@@ -4492,7 +4495,7 @@
 #: powerdevil/daemon/actions/bundled/powerdevilrunscriptaction.desktop:6
 msgctxt "Name"
 msgid "Run Script"
-msgstr ""
+msgstr "تشغيل سكربت"
 
 #: powerdevil/daemon/actions/bundled/powerdevilrunscriptaction.desktop:54
 msgctxt "Comment"
@@ -4587,7 +4590,7 @@
 #: systemsettings/categories/settings-desktop-appearance.desktop:67
 msgctxt "Comment"
 msgid "Customize the appearance of your desktop"
-msgstr ""
+msgstr "خصص مظهر سطح المكتب الخاص بك"
 
 #: systemsettings/categories/settings-display.desktop:8
 msgctxt "Name"
@@ -4726,7 +4729,7 @@
 #: solid/networkmanager_fake-0.9/solid_networkmanager09_fake.desktop:6
 msgctxt "Name"
 msgid "Fake NetworkManager 0.9"
-msgstr ""
+msgstr "مدير الشبكة المزيف 0.9"
 
 #: debian/tmp/usr/share/kde4/services/solidbackends/solid_networkmanager09_fake.desktop:25
 #: solid/networkmanager_fake-0.9/solid_networkmanager09_fake.desktop:25
@@ -4794,7 +4797,7 @@
 #: kinfocenter/Categories/kinfocentercategory.desktop:4
 msgctxt "Name"
 msgid "KInfoCenter Category"
-msgstr ""
+msgstr "فئة مركز معلومات كدي"
 
 #: kwin/effects/kwineffect.desktop:5
 msgctxt "Comment"
@@ -5864,7 +5867,7 @@
 #: obj-i686-linux-gnu/kdm/kfrontend/sessions/kde.desktop:6
 msgctxt "Name"
 msgid "KDE"
-msgstr ""
+msgstr "كدي"
 
 #: powerdevil/daemon/backends/upower/backlight_helper_actions.actions:53
 msgctxt "Name"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/dirfilterplugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/dirfilterplugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/dirfilterplugin.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/dirfilterplugin.po	2012-03-23 06:41:59.000000000 +0000
@@ -18,8 +18,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:33+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:15+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: dirfilterplugin.cpp:137
 msgid "View F&ilter"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/display.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/display.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/display.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/display.po	2012-03-23 06:42:02.000000000 +0000
@@ -20,8 +20,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:19+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:43+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: display.cpp:44
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/dolphin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/dolphin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/dolphin.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/dolphin.po	2012-03-23 06:41:59.000000000 +0000
@@ -2,59 +2,59 @@
 # translation of dolphin.po to
 # Copyright (C) YEAR This_file_is_part_of_KDE
 # This file is distributed under the same license as the PACKAGE package.
-#
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # محمد الحرقان <imksa@hotmail.com>, 2008.
 # Anas Husseini <linux.anas@gmail.com>, 2008.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
-# Osama Khalid <osamak.wfm@gmail.com>, 2009.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
+# OsamaKhalid <osamak.wfm@gmail.com>, 2009.
+# Abdalrahim G. Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: dolphin\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2012-01-25 10:59+0000\n"
-"Last-Translator: Osama Khalid <osamak.wfm@gmail.com>\n"
-"Language-Team: American English <kde-i18n-doc@kde.org>\n"
+"PO-Revision-Date: 2012-03-12 22:31+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:33+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:15+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: search/dolphinsearchbox.cpp:98
 #, kde-format
 msgctxt "action:button"
 msgid "From Here (%1)"
-msgstr ""
+msgstr "هنا (%1)"
 
 #: search/dolphinsearchbox.cpp:243
 msgctxt "@info:tooltip"
 msgid "Quit searching"
-msgstr ""
+msgstr "أنهِ البحث"
 
 #: search/dolphinsearchbox.cpp:268
 msgctxt "action:button"
 msgid "Filename"
-msgstr ""
+msgstr "الاسم"
 
 #: search/dolphinsearchbox.cpp:272
 msgctxt "action:button"
 msgid "Content"
-msgstr ""
+msgstr "المحتوى"
 
 #: search/dolphinsearchbox.cpp:283
 msgctxt "action:button"
 msgid "From Here"
-msgstr ""
+msgstr "هنا"
 
 #: search/dolphinsearchbox.cpp:287
 msgctxt "action:button"
 msgid "Everywhere"
-msgstr ""
+msgstr "كل الأمكنة"
 
 #: search/dolphinsearchbox.cpp:366
 #, kde-format
@@ -62,12 +62,12 @@
 "@title UDS_DISPLAY_NAME for a KIO directory listing. %1 is the query the "
 "user entered."
 msgid "Query Results from '%1'"
-msgstr ""
+msgstr "نتائج الاستعلام من '%1'"
 
 #: search/dolphinsearchbox.cpp:247
 msgctxt "@label:textbox"
 msgid "Find:"
-msgstr ""
+msgstr "ابحث:"
 
 #: dolphincontextmenu.cpp:119
 msgctxt "@action:inmenu"
@@ -102,12 +102,12 @@
 #: dolphincontextmenu.cpp:273
 msgctxt "@action:inmenu"
 msgid "Open Path in New Window"
-msgstr ""
+msgstr "افتح المسار في نافذة جديدة"
 
 #: dolphincontextmenu.cpp:279
 msgctxt "@action:inmenu"
 msgid "Open Path in New Tab"
-msgstr ""
+msgstr "افتح المسار في لسان جديد"
 
 #: dolphincontextmenu.cpp:406
 msgctxt "@action:inmenu"
@@ -117,12 +117,12 @@
 #: dolphincontextmenu.cpp:562
 msgctxt "@action:inmenu"
 msgid "&Move to Trash"
-msgstr ""
+msgstr "ا&نقل إلى المهملات"
 
 #: dolphincontextmenu.cpp:565
 msgctxt "@action:inmenu"
 msgid "&Delete"
-msgstr ""
+msgstr "ا&حذف"
 
 #: dolphinviewcontainer.cpp:304
 msgctxt "@info:progress"
@@ -132,12 +132,12 @@
 #: dolphinviewcontainer.cpp:296
 msgctxt "@info"
 msgid "Searching..."
-msgstr ""
+msgstr "يبحث..."
 
 #: dolphinviewcontainer.cpp:319
 msgctxt "@info:status"
 msgid "No items found."
-msgstr ""
+msgstr "لم يعثر على عناصر."
 
 #: dolphinviewcontainer.cpp:432
 msgctxt "@info:status"
@@ -157,7 +157,7 @@
 #: statusbar/statusbarspaceinfo.cpp:78 statusbar/statusbarspaceinfo.cpp:91
 msgctxt "@info:status"
 msgid "Unknown size"
-msgstr "حجم غير معروف"
+msgstr "حجم مجهول"
 
 #: statusbar/statusbarspaceinfo.cpp:102
 #, kde-format
@@ -168,22 +168,22 @@
 #: statusbar/dolphinstatusbar.cpp:294
 msgctxt "@action:inmenu"
 msgid "Copy Information Message"
-msgstr ""
+msgstr "انسخ رسالة المعلومات"
 
 #: statusbar/dolphinstatusbar.cpp:297
 msgctxt "@action:inmenu"
 msgid "Copy Error Message"
-msgstr ""
+msgstr "انسخ رسالة الخطأ"
 
 #: statusbar/dolphinstatusbar.cpp:304
 msgctxt "@action:inmenu"
 msgid "Show Zoom Slider"
-msgstr ""
+msgstr "أظهر مزلاق التكبير"
 
 #: statusbar/dolphinstatusbar.cpp:308
 msgctxt "@action:inmenu"
 msgid "Show Space Information"
-msgstr ""
+msgstr "أظهر معلومات المساحة"
 
 #: statusbar/dolphinstatusbar.cpp:345 settings/iconsizegroupbox.cpp:109
 #, kde-format
@@ -270,17 +270,17 @@
 #: main.cpp:73
 msgctxt "@info:shell"
 msgid "The files and directories passed as arguments will be selected."
-msgstr ""
+msgstr "الملفات و المجلدات التي  تمرر كمعاملات ستحدد."
 
 #: main.cpp:75
 msgctxt "@info:shell"
 msgid "Dolphin will get started with a split view."
-msgstr ""
+msgstr "سيبدأ دولفين في نمط العرض المنفصل"
 
 #: main.cpp:76
 msgctxt "@info:shell"
 msgid "Document to open"
-msgstr "Document to open"
+msgstr "المستند لفتحه"
 
 #: dolphinpart.cpp:165
 msgctxt "@action:inmenu Edit"
@@ -290,22 +290,22 @@
 #: dolphinpart.cpp:169
 msgctxt "@action:inmenu Edit"
 msgid "Select Items Matching..."
-msgstr ""
+msgstr "حدد العناصر المطابقة..."
 
 #: dolphinpart.cpp:174
 msgctxt "@action:inmenu Edit"
 msgid "Unselect Items Matching..."
-msgstr ""
+msgstr "ألغ تحديد العناصر المطابقة..."
 
 #: dolphinpart.cpp:180
 msgctxt "@action:inmenu Edit"
 msgid "Unselect All"
-msgstr ""
+msgstr "ألغ تحدد الكل"
 
 #: dolphinpart.cpp:184 dolphinmainwindow.cpp:1318
 msgctxt "@action:inmenu Edit"
 msgid "Invert Selection"
-msgstr "اعكس الاختيار"
+msgstr "اعكس التحديد"
 
 #: dolphinpart.cpp:197
 msgctxt "@action:inmenu Go"
@@ -350,45 +350,45 @@
 #: dolphinpart.cpp:519
 msgctxt "@title:window"
 msgid "Select"
-msgstr ""
+msgstr "حدد"
 
 #: dolphinpart.cpp:520
 msgid "Select all items matching this pattern:"
-msgstr ""
+msgstr "حدد جميع العناصر المطاقة لهذا النمط:"
 
 #: dolphinpart.cpp:526
 msgctxt "@title:window"
 msgid "Unselect"
-msgstr ""
+msgstr "ألغ التحديد"
 
 #: dolphinpart.cpp:527
 msgid "Unselect all items matching this pattern:"
-msgstr ""
+msgstr "ألغ تحديد جميع العناصر المطابقة لهذا النمط:"
 
 #: dolphinmainwindow.cpp:237
 msgctxt "@info:status"
 msgid "Successfully copied."
-msgstr ""
+msgstr "نسخ بنجاح."
 
 #: dolphinmainwindow.cpp:241
 msgctxt "@info:status"
 msgid "Successfully moved."
-msgstr ""
+msgstr "نقل بنجاح."
 
 #: dolphinmainwindow.cpp:245
 msgctxt "@info:status"
 msgid "Successfully linked."
-msgstr ""
+msgstr "ربط بنجاح."
 
 #: dolphinmainwindow.cpp:249
 msgctxt "@info:status"
 msgid "Successfully moved to trash."
-msgstr ""
+msgstr "نقل إلى المهملات بنجاح."
 
 #: dolphinmainwindow.cpp:253
 msgctxt "@info:status"
 msgid "Successfully renamed."
-msgstr ""
+msgstr "أعيدت التسمية بنجاح."
 
 #: dolphinmainwindow.cpp:258
 msgctxt "@info:status"
@@ -398,12 +398,12 @@
 #: dolphinmainwindow.cpp:364
 msgctxt "@info"
 msgid "Go back"
-msgstr ""
+msgstr "ارجع للخلف"
 
 #: dolphinmainwindow.cpp:370
 msgctxt "@info"
 msgid "Go forward"
-msgstr ""
+msgstr "اذهب للأمام"
 
 #: dolphinmainwindow.cpp:528
 msgctxt "@title:window"
@@ -431,7 +431,7 @@
 #: dolphinmainwindow.cpp:1107
 msgctxt "@action:inmenu"
 msgid "Detach Tab"
-msgstr ""
+msgstr "افصل اللسان"
 
 #: dolphinmainwindow.cpp:1047
 msgctxt "@action:inmenu"
@@ -446,22 +446,22 @@
 #: dolphinmainwindow.cpp:1453
 msgctxt "@action:inmenu"
 msgid "Location Bar"
-msgstr ""
+msgstr "شريط الموقع"
 
 #: dolphinmainwindow.cpp:1461
 msgctxt "@action:inmenu"
 msgid "Go"
-msgstr ""
+msgstr "اذهب"
 
 #: dolphinmainwindow.cpp:1471
 msgctxt "@action:inmenu"
 msgid "Tools"
-msgstr ""
+msgstr "أدوات"
 
 #: dolphinmainwindow.cpp:1485
 msgctxt "@action:inmenu"
 msgid "Help"
-msgstr ""
+msgstr "مساعدة"
 
 #: dolphinmainwindow.cpp:1275
 msgctxt "@action:inmenu File"
@@ -481,7 +481,7 @@
 #: dolphinmainwindow.cpp:1310
 msgctxt "@action:inmenu Edit"
 msgid "Paste"
-msgstr ""
+msgstr "ألصق"
 
 #: dolphinmainwindow.cpp:1313
 msgctxt "@action:inmenu Edit"
@@ -501,7 +501,7 @@
 #: dolphinmainwindow.cpp:1338
 msgctxt "@info"
 msgid "Stop loading"
-msgstr ""
+msgstr "أوقف التحميل"
 
 #: dolphinmainwindow.cpp:1343
 msgctxt "@action:inmenu Navigation Bar"
@@ -519,7 +519,7 @@
 
 #: dolphinmainwindow.cpp:1680
 msgid "Empty Recently Closed Tabs"
-msgstr ""
+msgstr "امسح الألسنة المُغلقة مؤخرًا"
 
 #: dolphinmainwindow.cpp:1387
 msgctxt "@action:inmenu Tools"
@@ -559,12 +559,12 @@
 #: dolphinmainwindow.cpp:1754
 msgctxt "@action:inmenu Panels"
 msgid "Unlock Panels"
-msgstr ""
+msgstr "افتح اللوحات"
 
 #: dolphinmainwindow.cpp:1756
 msgctxt "@action:inmenu Panels"
 msgid "Lock Panels"
-msgstr ""
+msgstr "أغلق اللوحات"
 
 #: dolphinmainwindow.cpp:1446 dolphinmainwindow.cpp:1454
 msgctxt "@title:window"
@@ -584,7 +584,7 @@
 #: dolphinmainwindow.cpp:1830
 msgctxt "@title:window"
 msgid "Search"
-msgstr ""
+msgstr "ابحث"
 
 #: dolphinmainwindow.cpp:1519 dolphinmainwindow.cpp:1529
 msgctxt "@title:window"
@@ -594,12 +594,12 @@
 #: dolphinmainwindow.cpp:1697
 msgctxt "@action:inmenu View"
 msgid "Panels"
-msgstr ""
+msgstr "اللوحات"
 
 #: dolphinmainwindow.cpp:1976
 msgctxt "@info:tooltip"
 msgid "Configure and control Dolphin"
-msgstr ""
+msgstr "اضبط وتحكم بدولفين"
 
 #: dolphinmainwindow.cpp:1662
 msgctxt "@action:intoolbar Close right view"
@@ -609,7 +609,7 @@
 #: dolphinmainwindow.cpp:1663
 msgctxt "@info"
 msgid "Close right view"
-msgstr ""
+msgstr "أغلق عرض اليمين"
 
 #: dolphinmainwindow.cpp:1666
 msgctxt "@action:intoolbar Close left view"
@@ -619,7 +619,7 @@
 #: dolphinmainwindow.cpp:1667
 msgctxt "@info"
 msgid "Close left view"
-msgstr ""
+msgstr "أغلق عرض اليسار"
 
 #: dolphinmainwindow.cpp:1671
 msgctxt "@action:intoolbar Split view"
@@ -629,12 +629,12 @@
 #: dolphinmainwindow.cpp:1672
 msgctxt "@info"
 msgid "Split view"
-msgstr ""
+msgstr "العرض المنقسم"
 
 #: dolphindirlister.cpp:41
 msgctxt "@info:status"
 msgid "Unknown error."
-msgstr ""
+msgstr "خطأ مجهول."
 
 #: dolphinremoteencoding.cpp:53
 msgid "Select Remote Charset"
@@ -646,7 +646,7 @@
 
 #: dolphinremoteencoding.cpp:118
 msgid "Default"
-msgstr "الافتراضي"
+msgstr "المبدئي"
 
 #: dolphinview.cpp:560
 #, kde-format
@@ -677,7 +677,7 @@
 msgctxt "@info:status"
 msgid "1 File selected"
 msgid_plural "%1 Files selected"
-msgstr[0] "لم يحدد شيء"
+msgstr[0] "لم يحدّد شيء"
 msgstr[1] "ملف واحد محدّد"
 msgstr[2] "ملفان محدّدان"
 msgstr[3] "%1 ملفات محدّدة"
@@ -735,7 +735,7 @@
 #: views/dolphinviewactionhandler.cpp:120
 msgctxt "@action \"Move to Trash\" for non-local files, etc."
 msgid "Delete (using shortcut for Trash)"
-msgstr ""
+msgstr "احذف (باستخدام اختصار للمهملات)"
 
 #: dolphinviewactionhandler.cpp:123
 msgctxt "@action:inmenu File"
@@ -745,7 +745,7 @@
 #: views/dolphinviewactionhandler.cpp:138
 msgctxt "@action:intoolbar"
 msgid "View Mode"
-msgstr ""
+msgstr "نمط العرض"
 
 #: dolphinviewactionhandler.cpp:145
 msgctxt "@action:intoolbar"
@@ -755,7 +755,7 @@
 #: dolphinviewactionhandler.cpp:146
 msgctxt "@info"
 msgid "Show preview of files and folders"
-msgstr ""
+msgstr "أعرض معاينة للملفات و المجلدات"
 
 #: dolphinviewactionhandler.cpp:151
 msgctxt "@action:inmenu Sort"
@@ -770,13 +770,13 @@
 #: views/dolphinviewactionhandler.cpp:172
 msgctxt "@action:inmenu View"
 msgid "Sort By"
-msgstr ""
+msgstr "افرز حسب"
 
 #: views/dolphinviewactionhandler.cpp:187
 #: views/dolphinviewactionhandler.cpp:213
 msgctxt "@action:inmenu View"
 msgid "Additional Information"
-msgstr ""
+msgstr "معلومات إضافية"
 
 #: dolphinviewactionhandler.cpp:165
 msgctxt "@action:inmenu View"
@@ -806,7 +806,7 @@
 #: dolphinviewactionhandler.cpp:428
 msgctxt "@info"
 msgid "Icons view mode"
-msgstr ""
+msgstr "وضع الأيقونات"
 
 #: dolphinviewactionhandler.cpp:438
 msgctxt "@action:inmenu View Mode"
@@ -816,7 +816,7 @@
 #: dolphinviewactionhandler.cpp:439
 msgctxt "@info"
 msgid "Details view mode"
-msgstr ""
+msgstr "وضع العرض التفصيلي"
 
 #: dolphinviewactionhandler.cpp:449
 msgctxt "@action:inmenu View Mode"
@@ -831,42 +831,42 @@
 #: views/additionalinfoaccessor.cpp:105
 msgctxt "@label"
 msgid "Size"
-msgstr ""
+msgstr "الحجم"
 
 #: views/additionalinfoaccessor.cpp:106
 msgctxt "@label"
 msgid "Date"
-msgstr ""
+msgstr "التاريخ"
 
 #: views/additionalinfoaccessor.cpp:107
 msgctxt "@label"
 msgid "Permissions"
-msgstr ""
+msgstr "التصاريح"
 
 #: views/additionalinfoaccessor.cpp:108
 msgctxt "@label"
 msgid "Owner"
-msgstr ""
+msgstr "المالك"
 
 #: views/additionalinfoaccessor.cpp:109
 msgctxt "@label"
 msgid "Group"
-msgstr ""
+msgstr "المجموعة"
 
 #: views/additionalinfoaccessor.cpp:110
 msgctxt "@label"
 msgid "Type"
-msgstr ""
+msgstr "النوع"
 
 #: views/additionalinfoaccessor.cpp:111
 msgctxt "@label"
 msgid "Link Destination"
-msgstr ""
+msgstr "مقصد الرابط"
 
 #: views/additionalinfoaccessor.cpp:112
 msgctxt "@label"
 msgid "Path"
-msgstr ""
+msgstr "المسار"
 
 #: selectiontoggle.cpp:128
 msgctxt "@info:tooltip"
@@ -881,12 +881,12 @@
 #: versioncontrol/versioncontrolobserver.cpp:192
 msgctxt "@info:status"
 msgid "Update of version information failed."
-msgstr ""
+msgstr "فشل تحديث معلومات الإصدارة."
 
 #: versioncontrol/versioncontrolobserver.cpp:245
 msgctxt "@info:status"
 msgid "Updating version information..."
-msgstr ""
+msgstr "تحديث معلومات الإصدارة..."
 
 #: views/dolphincolumnview.cpp:88
 msgctxt "@info:tooltip"
@@ -1108,17 +1108,17 @@
 #: panels/filter/filterpanel.cpp:110
 msgctxt "option:check Refers to a filter on image size"
 msgid "Small"
-msgstr ""
+msgstr "صغير"
 
 #: panels/filter/filterpanel.cpp:112
 msgctxt "option:check Refers to a filter on image size"
 msgid "Medium"
-msgstr ""
+msgstr "متوسط"
 
 #: panels/filter/filterpanel.cpp:115
 msgctxt "option:check Refers to a filter on image size"
 msgid "Large"
-msgstr ""
+msgstr "كبير"
 
 #: panels/information/informationpanelcontent.cpp:235
 #, kde-format
@@ -1140,12 +1140,12 @@
 #: panels/information/informationpanelcontent.cpp:281
 msgctxt "@action:inmenu"
 msgid "Configure..."
-msgstr ""
+msgstr "اضبط..."
 
 #: panels/information/informationpanelcontent.cpp:298
 msgctxt "@label::textbox"
 msgid "Select which data should be shown in the information panel:"
-msgstr ""
+msgstr "اختر أي البيانات يجب أن تعرض لوح المعلومات:"
 
 #: panels/information/phononwidget.cpp:139
 msgid "play"
@@ -1158,12 +1158,12 @@
 #: panels/information/kmetadataconfigurationdialog.cpp:62
 msgctxt "@title:window"
 msgid "Configure Shown Data"
-msgstr ""
+msgstr "اضبط المعلومات المعروضة"
 
 #: settings/filemetadataconfigurationdialog.cpp:39
 msgctxt "@label::textbox"
 msgid "Select which data should be shown:"
-msgstr ""
+msgstr "اختر أي البيانات ينبغي أن تعرض:"
 
 #: panels/folders/treeviewcontextmenu.cpp:61
 msgctxt "@action:inmenu"
@@ -1208,7 +1208,7 @@
 #: panels/folders/treeviewcontextmenu.cpp:125
 msgctxt "@action:inmenu"
 msgid "Automatic Scrolling"
-msgstr ""
+msgstr "تمرير آلي"
 
 #: settings/startupsettingspage.cpp:58
 msgctxt "@title:group"
@@ -1233,7 +1233,7 @@
 #: settings/startupsettingspage.cpp:86
 msgctxt "@option:check Startup Settings"
 msgid "Split view mode"
-msgstr "افصل نمط العرض"
+msgstr "نمط العرض المنقسم"
 
 #: settings/startupsettingspage.cpp:87
 msgctxt "@option:check Startup Settings"
@@ -1398,27 +1398,27 @@
 #: settings/behaviorsettingspage.cpp:119
 msgctxt "option:check"
 msgid "Natural sorting of items"
-msgstr ""
+msgstr "فرز طبيعي للعناصر"
 
 #: settings/general/previewssettingspage.cpp:63
 msgctxt "@title:group"
 msgid "Show previews for"
-msgstr ""
+msgstr "أظهر معايناتٍ لـ"
 
 #: settings/general/previewssettingspage.cpp:73
 msgctxt "@title:group"
 msgid "Do not create previews for"
-msgstr ""
+msgstr "لا تنشئ معايناتٍ لـ"
 
 #: settings/general/previewssettingspage.cpp:76
 msgctxt "@label Don't create previews for: <Local files above:> XX MByte"
 msgid "Local files above:"
-msgstr ""
+msgstr "ملفات محلية فوق:"
 
 #: settings/general/previewssettingspage.cpp:84
 msgctxt "@label Don't create previews for: <Remote files above:> XX MByte"
 msgid "Remote files above:"
-msgstr ""
+msgstr "ملفات بعيدة فوق:"
 
 #: kcm/kcmdolphingeneral.cpp:56 settings/generalsettingspage.cpp:48
 msgctxt "@title:tab Behavior settings"
@@ -1444,7 +1444,7 @@
 #, kde-format
 msgctxt "@title:window"
 msgid "Configure Preview for %1"
-msgstr ""
+msgstr "اضبط المعاينة لـ %1"
 
 #: settings/contextmenusettingspage.cpp:42
 msgctxt "@option:check"
@@ -1459,17 +1459,17 @@
 #: settings/services/servicessettingspage.cpp:55
 msgctxt "@label:textbox"
 msgid "Select which services should be shown in the context menu:"
-msgstr ""
+msgstr "اختر الخدمات التي ينبغي عرضها في شريط السياق:"
 
 #: settings/servicessettingspage.cpp:56
 msgctxt "@action:button"
 msgid "Download New Services..."
-msgstr ""
+msgstr "نزل خدمات جديدة..."
 
 #: settings/services/servicessettingspage.cpp:70
 msgctxt "@title:group"
 msgid "Version Control Systems"
-msgstr ""
+msgstr "أنظمة التحكم بالإصدارات"
 
 #: settings/services/servicessettingspage.cpp:122
 msgctxt "@info"
@@ -1477,12 +1477,13 @@
 "Dolphin must be restarted to apply the updated version control systems "
 "settings."
 msgstr ""
+"يجب أن يعاد تشغيل دولفين حتى تطبق الإعدادات الجديدة لأنظمة تحكم بالإصدارات."
 
 #: settings/services/servicessettingspage.cpp:172
 #, kde-format
 msgctxt "@item:inmenu"
 msgid "%1: %2"
-msgstr ""
+msgstr "%1: %2"
 
 #: settings/iconsizegroupbox.cpp:35
 msgctxt "@title:group"
@@ -1636,7 +1637,7 @@
 #: settings/additionalinfodialog.cpp:46
 msgctxt "@label"
 msgid "Select which additional information should be shown:"
-msgstr ""
+msgstr "اختر أي المعلومات الإضافية التي ينبغي أن تعرض:"
 
 #: settings/viewpropertiesdialog.cpp:78
 msgctxt "@title:window"
@@ -1756,7 +1757,7 @@
 #: settings/viewpropertiesdialog.cpp:186
 msgctxt "@option:radio Apply View Properties To"
 msgid "Current folder including all sub-folders"
-msgstr ""
+msgstr "المجلد الحالي وكل المجلدات الفرعية"
 
 #: settings/viewpropertiesdialog.cpp:187
 msgctxt "@option:radio Apply View Properties To"
@@ -1766,14 +1767,14 @@
 #: settings/viewpropertiesdialog.cpp:200
 msgctxt "@option:check"
 msgid "Use these view properties as default"
-msgstr ""
+msgstr "استخدم خصائص العرض هذه كإعدادات مبدئية"
 
 #: settings/viewpropertiesdialog.cpp:338
 msgctxt "@info"
 msgid ""
 "The view properties of all sub-folders will be changed. Do you want to "
 "continue?"
-msgstr ""
+msgstr "سيتم تغيير خصائص العرض لكل المجلدات الفرعية. هل تريد المتابعة؟"
 
 #: settings/viewpropertiesdialog.cpp:372
 msgctxt "@info"
@@ -1809,20 +1810,20 @@
 #. i18n: ectx: label, entry (Location), group (Search)
 #: rc.cpp:50
 msgid "Location"
-msgstr ""
+msgstr "الموقع"
 
 #. i18n: file: search/dolphin_searchsettings.kcfg:11
 #. i18n: ectx: label, entry (What), group (Search)
 #: rc.cpp:53
 msgid "What"
-msgstr ""
+msgstr "ماذا"
 
 #. i18n: file: dolphinui.rc:67
 #. i18n: ectx: Menu (navigation_bar)
 #: rc.cpp:39 rc.cpp:71
 msgctxt "@title:menu"
 msgid "Location Bar"
-msgstr ""
+msgstr "شريط الموقع"
 
 #. i18n: file: dolphinui.rc:122
 #. i18n: ectx: ToolBar (mainToolBar)
@@ -1847,13 +1848,13 @@
 #. i18n: ectx: label, entry (AutoScrolling), group (FoldersPanel)
 #: rc.cpp:47
 msgid "Automatic scrolling"
-msgstr ""
+msgstr "التمرير آلي"
 
 #. i18n: file: settings/dolphin_versioncontrolsettings.kcfg:10
 #. i18n: ectx: label, entry (enabledPlugins), group (VersionControl)
 #: rc.cpp:50
 msgid "Enabled plugins"
-msgstr ""
+msgstr "الملحقات الممكنة"
 
 #. i18n: file: settings/dolphin_generalsettings.kcfg:9
 #. i18n: ectx: label, entry (EditableUrl), group (General)
@@ -1894,7 +1895,7 @@
 msgid ""
 "Have the startup settings been modified (internal setting not shown in the "
 "UI)"
-msgstr ""
+msgstr "تم تعديل إعدادات البدء (الإعداد الدخلي لم يظهر في الواجهة الرسومية)"
 
 #. i18n: file: settings/dolphin_generalsettings.kcfg:25
 #. i18n: ectx: label, entry (HomeUrl), group (General)
@@ -1984,7 +1985,7 @@
 #. i18n: ectx: label, entry (LockPanels), group (General)
 #: rc.cpp:89
 msgid "Lock the layout of the panels"
-msgstr ""
+msgstr "أغلق تخطيط اللوحات"
 
 #. i18n: file: settings/dolphin_directoryviewpropertysettings.kcfg:11
 #. i18n: ectx: label, entry (ShowHiddenFiles), group (Settings)
@@ -2009,14 +2010,14 @@
 #: rc.cpp:116
 msgctxt "@label"
 msgid "Version"
-msgstr ""
+msgstr "الإصدار"
 
 #. i18n: file: settings/dolphin_directoryviewpropertysettings.kcfg:20
 #. i18n: ectx: whatsthis, entry (Version), group (Dolphin)
 #: rc.cpp:119
 msgctxt "@info:whatsthis"
 msgid "This option defines the used version of the view properties."
-msgstr ""
+msgstr "هذا الخيار يعرف الإصدارة المستخدمة في خصائص العرض."
 
 #. i18n: file: settings/dolphin_directoryviewpropertysettings.kcfg:19
 #. i18n: ectx: label, entry (ViewMode), group (Dolphin)
@@ -2244,7 +2245,7 @@
 #. i18n: ectx: label, entry (ColumnPositions), group (DetailsMode)
 #: rc.cpp:272
 msgid "Position of columns"
-msgstr ""
+msgstr "موضع الأعمدة"
 
 #. i18n: file: dolphinpart.rc:4
 #. i18n: ectx: Menu (edit)
@@ -2257,7 +2258,7 @@
 #: rc.cpp:6 rc.cpp:278
 msgctxt "@title:menu"
 msgid "Selection"
-msgstr ""
+msgstr "التحديد"
 
 #. i18n: file: dolphinpart.rc:23
 #. i18n: ectx: Menu (view)
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/domtreeviewer.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/domtreeviewer.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/domtreeviewer.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/domtreeviewer.po	2012-03-23 06:41:59.000000000 +0000
@@ -6,20 +6,21 @@
 # Isam Bayazidi <bayazidi@arabeyes.org>, 2002.
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# zayed <zayed.alsaidi@gmail.com>, 2008, 2009.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2009, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: domtreeviewer\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2010-12-31 11:14+0000\n"
+"PO-Revision-Date: 2012-03-12 22:32+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:34+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:16+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: domtreecommands.cpp:33
 msgid "No error"
@@ -125,7 +126,7 @@
 #: domtreeview.cpp:70
 msgctxt "@title:window"
 msgid "Edit Element"
-msgstr ""
+msgstr "حرر العنصر"
 
 #: domtreeview.cpp:72 domtreeview.cpp:92
 msgid "&Append as Child"
@@ -138,23 +139,23 @@
 #: domtreeview.cpp:90
 msgctxt "@title:window"
 msgid "Edit Text"
-msgstr ""
+msgstr "حرر النص"
 
 #: domtreeview.cpp:110
 msgctxt "@title:window"
 msgid "Edit Attribute"
-msgstr ""
+msgstr "حرر  الصفة"
 
 #: domtreeview.cpp:172
 #, kde-format
 msgctxt "@title:window"
 msgid "DOM Tree for %1"
-msgstr ""
+msgstr "شجرة DOM لـ%1"
 
 #: domtreeview.cpp:172
 msgctxt "@title:window"
 msgid "DOM Tree"
-msgstr ""
+msgstr "شجرة DOM"
 
 #: domtreeview.cpp:514
 msgid "Move Nodes"
@@ -167,7 +168,7 @@
 #: domtreeview.cpp:584
 msgctxt "@title:window"
 msgid "File Exists"
-msgstr ""
+msgstr "الملف موجود"
 
 #: domtreeview.cpp:585
 #, kde-format
@@ -185,7 +186,7 @@
 #: domtreeview.cpp:599
 msgctxt "@title:window"
 msgid "Unable to Open File"
-msgstr ""
+msgstr "تعذر فتح الملف"
 
 #: domtreeview.cpp:600
 #, kde-format
@@ -201,7 +202,7 @@
 #: domtreeview.cpp:604
 msgctxt "@title:window"
 msgid "Invalid URL"
-msgstr ""
+msgstr "الـعنوان غير صحيح"
 
 #: domtreeview.cpp:605
 #, kde-format
@@ -229,7 +230,7 @@
 #: domtreewindow.cpp:62
 msgctxt "@title:window"
 msgid "Message Log"
-msgstr ""
+msgstr "سجل الرسالة"
 
 #: domtreewindow.cpp:169
 msgid "Pure DOM Tree"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/dragonplayer.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/dragonplayer.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/dragonplayer.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/dragonplayer.po	2012-03-23 06:41:39.000000000 +0000
@@ -18,8 +18,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:59+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:55+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: src/app/mainWindow.cpp:154
 msgid "Aspect &Ratio"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/drkonqi.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/drkonqi.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/drkonqi.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/drkonqi.po	2012-03-23 06:41:56.000000000 +0000
@@ -20,18 +20,17 @@
 "Project-Id-Version: drkonqi\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:43+0000\n"
-"Last-Translator: Abderrahim Kitouni <a.kitouni@gmail.com>\n"
+"PO-Revision-Date: 2012-03-14 17:33+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:31+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:40+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
-"X-Poedit-Language: Arabic\n"
 
 #: aboutbugreportingdialog.cpp:34
 msgctxt "@title title of the dialog"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/filetypes.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/filetypes.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/filetypes.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/filetypes.po	2012-03-23 06:41:57.000000000 +0000
@@ -7,25 +7,25 @@
 # محمد الحرقان <imksa@hotmail.com>, 2008.
 # Anas Husseini <linux.anas@gmail.com>, 2008.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: filetypes\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:40+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
+"PO-Revision-Date: 2012-03-14 17:32+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
+"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:33+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Poedit-Language: Arabic\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:41+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: filegroupdetails.cpp:35 filetypedetails.cpp:147
 msgid "Left Click Action (only for Konqueror file manager)"
-msgstr ""
+msgstr "حدث النقر بالزرّ الأيسر للفأرة (فقط لمدير الملفات)"
 
 #: filegroupdetails.cpp:39 filetypedetails.cpp:152
 msgid "Show file in embedded viewer"
@@ -106,11 +106,11 @@
 
 #: filetypedetails.cpp:147
 msgid "Left Click Action in Konqueror"
-msgstr ""
+msgstr "حدث النقر بزر الفأرة الأيسر في مدير الملفات"
 
 #: filetypedetails.cpp:156
 msgid "Ask whether to save to disk instead (only for Konqueror browser)"
-msgstr ""
+msgstr "اسأل عن إمكانية الحفظ إلى القرص بدلاً من ذلك (لمدير الملفات فقط)"
 
 #: filetypedetails.cpp:171
 msgid ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/freespacenotifier.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/freespacenotifier.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/freespacenotifier.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/freespacenotifier.po	2012-03-23 06:42:02.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:20+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:43+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: freespacenotifier.cpp:89
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/fsview.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/fsview.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/fsview.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/fsview.po	2012-03-23 06:41:59.000000000 +0000
@@ -1,28 +1,29 @@
 # translation of fsview.po to Arabic
 # translation of fsview.po to
 # Copyright (C) 2003, 2004, 2006, 2007, 2009 Free Software Foundation, Inc.
-#
 # Nuriddin Aminagha <nuriddin@haydarlinux.org>, 2003.
 # Ahmad M. Zawawi <azawawi@emirates.net.ae>, 2004.
 # Mohammed Gamal <f2c2001@yahoo.com>, 2004.
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# zayed <zayed.alsaidi@gmail.com>, 2009.
+# zayed <zayed.alsaidi@gmail.com>, 2009, 2012.
+# Abdalrahim G. Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: fsview\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2010-12-31 11:20+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"PO-Revision-Date: 2012-03-12 22:32+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:35+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:17+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: fsview.cpp:50 fsview.cpp:388
 msgid "Name"
@@ -121,8 +122,8 @@
 #, kde-format
 msgid "Read 1 folder, in %2"
 msgid_plural "Read %1 folders, in %2"
-msgstr[0] "اقرأ مجلد في %1"
-msgstr[1] "اقرأ مجلد واحد في %1"
+msgstr[0] "لا تقرأ مجلدات في %1"
+msgstr[1] "اقرأ مجلداً واحداً في %1"
 msgstr[2] "اقرأ مجلدين في %1"
 msgstr[3] "اقرأ %1 مجلدات في %2"
 msgstr[4] "اقرأ %1 مجلدا في %2"
@@ -167,22 +168,22 @@
 #: fsview_part.cpp:183
 msgctxt "@action:inmenu File"
 msgid "Move to Trash"
-msgstr ""
+msgstr "انقل إلى المهملات"
 
 #: fsview_part.cpp:191
 msgctxt "@action:inmenu File"
 msgid "Delete"
-msgstr ""
+msgstr "احذف"
 
 #: fsview_part.cpp:196
 msgctxt "@action:inmenu Edit"
 msgid "&Edit File Type..."
-msgstr ""
+msgstr "&حرّر نوع الملف..."
 
 #: fsview_part.cpp:200
 msgctxt "@action:inmenu File"
 msgid "Properties"
-msgstr ""
+msgstr "الخصائص"
 
 #: fsview_part.cpp:241
 msgid ""
@@ -212,20 +213,21 @@
 msgid "Your names"
 msgstr ""
 "نورالدين شكري أمين آغا, أحمد محمد زواوي, محمد جمال, ,Launchpad "
-"Contributions:,Mohammad Gamal,Zayed Amer Al-Saidi,metehyi"
+"Contributions:,Abdalrahim G. Fakhouri,Mohammad Gamal,Zayed Amer Al-"
+"Saidi,metehyi"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
 msgstr ""
 "nuriddin@eminaga.de, "
-"azawawi@emirates.net.ae,,,f2c2001@yahoo.com,zayed.alsaidi@gmail.com,"
+"azawawi@emirates.net.ae,,,,f2c2001@yahoo.com,zayed.alsaidi@gmail.com,"
 
 #. i18n: file: fsview_part.rc:4
 #. i18n: ectx: Menu (edit)
 #: rc.cpp:5
 msgid "&Edit"
-msgstr ""
+msgstr "&حرّر"
 
 #. i18n: file: fsview_part.rc:13
 #. i18n: ectx: Menu (view)
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/gwenview.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/gwenview.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/gwenview.po	2012-02-23 06:20:05.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/gwenview.po	2012-03-23 06:41:37.000000000 +0000
@@ -10,7 +10,7 @@
 "Project-Id-Version: gwenview\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 16:36+0000\n"
-"PO-Revision-Date: 2012-01-25 20:22+0000\n"
+"PO-Revision-Date: 2012-03-13 06:52+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
@@ -18,8 +18,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:22+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:34+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: lib/historymodel.cpp:135
 #, kde-format
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/htmlsearch.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/htmlsearch.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/htmlsearch.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/htmlsearch.po	2012-03-23 06:41:57.000000000 +0000
@@ -12,16 +12,15 @@
 "Project-Id-Version: htmlsearch\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2011-12-12 19:22+0000\n"
+"PO-Revision-Date: 2012-03-14 17:32+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <ar@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:33+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:42+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
-"X-Poedit-Language: Arabic\n"
 
 #: index.cpp:13
 msgid "KHtmlIndex"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/imagerename_plugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/imagerename_plugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/imagerename_plugin.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/imagerename_plugin.po	2012-03-23 06:41:57.000000000 +0000
@@ -18,8 +18,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:34+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:42+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: image_plugin.cpp:71
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/imgalleryplugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/imgalleryplugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/imgalleryplugin.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/imgalleryplugin.po	2012-03-23 06:41:59.000000000 +0000
@@ -7,30 +7,31 @@
 # Ahmad M. Zawawi <azawawi@emirates.net.ae>, 2004.
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# zayed <zayed.alsaidi@gmail.com>, 2008, 2009.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2009, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: imgalleryplugin\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2009-03-20 07:27+0000\n"
+"PO-Revision-Date: 2012-03-12 22:31+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:36+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:17+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: imgallerydialog.cpp:53
 msgctxt "@title:window"
 msgid "Configure"
-msgstr ""
+msgstr "اضبط"
 
 #: imgallerydialog.cpp:61
 msgctxt "@title:window"
 msgid "Create Image Gallery"
-msgstr ""
+msgstr "أنشئ معرض الصور"
 
 #: imgallerydialog.cpp:62
 msgid "Create"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/jovie.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/jovie.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/jovie.po	2012-02-23 06:20:06.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/jovie.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,1252 +0,0 @@
-# translation of kttsd.po to
-#
-# محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
-# Youssef Chahibi <chahibi@gmail.com>, 2007.
-msgid ""
-msgstr ""
-"Project-Id-Version: kttsd\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 04:10+0000\n"
-"PO-Revision-Date: 2012-01-25 11:21+0000\n"
-"Last-Translator: Youssef Chahibi <Unknown>\n"
-"Language-Team: <en@li.org>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:29+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"Language: \n"
-
-#: rc.cpp:1
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr " ,Launchpad Contributions:"
-
-#: rc.cpp:2
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr ","
-
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:34
-#. i18n: ectx: attribute (title), widget (QWidget, tab)
-#: rc.cpp:5
-msgctxt "General, as title of window"
-msgid "General"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:40
-#. i18n: ectx: property (text), widget (QLabel, kttsdVersion)
-#: rc.cpp:8 kcmkttsmgr/kcmkttsmgr.cpp:1154
-msgid "Jovie not running"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:63
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, enableJovieCheckBox)
-#: rc.cpp:11
-msgid "Check to start the Jovie Daemon and enable Text-to-Speech."
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:66
-#. i18n: ectx: property (text), widget (QCheckBox, enableJovieCheckBox)
-#: rc.cpp:14
-msgid "&Enable Text-to-Speech System (Jovie)"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:74
-#. i18n: ectx: attribute (title), widget (QWidget, TabPage)
-#: rc.cpp:17
-msgid "Talkers"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:88
-#. i18n: ectx: property (whatsThis), widget (KPushButton, addTalkerButton)
-#: rc.cpp:20
-msgid "Click to add and configure a new Talker (speech synthesizer)."
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:91
-#. i18n: ectx: property (text), widget (KPushButton, addTalkerButton)
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:206
-#. i18n: ectx: property (text), widget (KPushButton, addFilterButton)
-#: rc.cpp:23 rc.cpp:50
-msgid "Add..."
-msgstr "أضف..."
-
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:104
-#. i18n: ectx: property (text), widget (KPushButton, higherTalkerPriorityButton)
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:222
-#. i18n: ectx: property (text), widget (KPushButton, higherFilterPriorityButton)
-#: rc.cpp:26 rc.cpp:56
-msgid "U&p"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:117
-#. i18n: ectx: property (text), widget (KPushButton, lowerTalkerPriorityButton)
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:238
-#. i18n: ectx: property (text), widget (KPushButton, lowerFilterPriorityButton)
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:291
-#. i18n: ectx: property (text), widget (QPushButton, downButton)
-#: rc.cpp:29 rc.cpp:62 rc.cpp:269
-msgid "Do&wn"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:133
-#. i18n: ectx: property (whatsThis), widget (KPushButton, configureTalkerButton)
-#: rc.cpp:32
-msgid "Click to configure options for the highlighted Talker."
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:136
-#. i18n: ectx: property (text), widget (KPushButton, configureTalkerButton)
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:257
-#. i18n: ectx: property (text), widget (KPushButton, configureFilterButton)
-#: rc.cpp:35 rc.cpp:68
-msgid "&Edit..."
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:152
-#. i18n: ectx: property (whatsThis), widget (KPushButton, removeTalkerButton)
-#: rc.cpp:38
-msgid "Click to remove the highlighted Talker."
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:155
-#. i18n: ectx: property (text), widget (KPushButton, removeTalkerButton)
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:276
-#. i18n: ectx: property (text), widget (KPushButton, removeFilterButton)
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:333
-#. i18n: ectx: property (text), widget (KPushButton, removeButton)
-#: rc.cpp:41 rc.cpp:74 rc.cpp:281
-msgid "&Remove"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:184
-#. i18n: ectx: attribute (title), widget (QWidget, TabPage)
-#: rc.cpp:44
-msgid "Filters"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:203
-#. i18n: ectx: property (whatsThis), widget (KPushButton, addFilterButton)
-#: rc.cpp:47
-msgid "Click to add and configure a new Filter."
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:219
-#. i18n: ectx: property (whatsThis), widget (KPushButton, higherFilterPriorityButton)
-#: rc.cpp:53
-msgid ""
-"Click to move selected filter up in the list.  Filters higher in the list "
-"are applied first."
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:235
-#. i18n: ectx: property (whatsThis), widget (KPushButton, lowerFilterPriorityButton)
-#: rc.cpp:59
-msgid ""
-"Click to move a filter down in the list.  Filters lower in the list are "
-"applied last."
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:254
-#. i18n: ectx: property (whatsThis), widget (KPushButton, configureFilterButton)
-#: rc.cpp:65
-msgid "Click to configure options for the highlighted Filter."
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kcmkttsmgrwidget.ui:273
-#. i18n: ectx: property (whatsThis), widget (KPushButton, removeFilterButton)
-#: rc.cpp:71
-msgid "Click to remove the highlighted Filter."
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kttsjobmgr.ui:14
-#. i18n: ectx: property (windowTitle), widget (QWidget, kttsjobmgr)
-#: rc.cpp:77 kcmkttsmgr/kcmkttsmgr.cpp:1092
-msgid "Jobs"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kttsjobmgr.ui:20
-#. i18n: ectx: property (title), widget (QGroupBox, groupBox_2)
-#: rc.cpp:80
-msgid "Speech Control"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kttsjobmgr.ui:31
-#. i18n: ectx: property (text), widget (KPushButton, stopButton)
-#: rc.cpp:83
-msgid "Stop"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kttsjobmgr.ui:41
-#. i18n: ectx: property (whatsThis), widget (KPushButton, cancelButton)
-#: rc.cpp:86
-msgid ""
-"<p>Deletes the job.  If it is currently speaking, it stops speaking.  The "
-"next speakable job in the list begins speaking.</p>"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kttsjobmgr.ui:44
-#. i18n: ectx: property (text), widget (KPushButton, cancelButton)
-#: rc.cpp:89
-msgid "Cancel"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kttsjobmgr.ui:54
-#. i18n: ectx: property (whatsThis), widget (KPushButton, pauseButton)
-#: rc.cpp:92
-msgid ""
-"<p>Changes a job to Paused state.  If currently speaking, the job stops "
-"speaking. Paused jobs prevent jobs that follow them from speaking, so either "
-"click <b>Resume</b> to make the job speakable, or click <b>Later</b> to move "
-"it down in the list.</p>"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kttsjobmgr.ui:57
-#. i18n: ectx: property (text), widget (KPushButton, pauseButton)
-#: rc.cpp:95
-msgid "Pause"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kttsjobmgr.ui:67
-#. i18n: ectx: property (whatsThis), widget (KPushButton, resumeButton)
-#: rc.cpp:98
-msgid ""
-"<p>Resumes a paused job or changes a Queued job to Waiting.  If the job is "
-"the top speakable job in the list, it begins speaking.</p>"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kttsjobmgr.ui:70
-#. i18n: ectx: property (text), widget (KPushButton, resumeButton)
-#: rc.cpp:101
-msgid "Resume"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kttsjobmgr.ui:81
-#. i18n: ectx: property (whatsThis), widget (KPushButton, speak_clipboard)
-#: rc.cpp:104
-msgid ""
-"<p>Queues the current contents of the clipboard for speaking and sets its "
-"state to Waiting.  If the job is the topmost in the list, it begins "
-"speaking.  The job will be spoken by the topmost Talker in the "
-"<b>Talkers</b> tab.</p>"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kttsjobmgr.ui:84
-#. i18n: ectx: property (text), widget (KPushButton, speak_clipboard)
-#: rc.cpp:107
-msgid "&Speak Clipboard"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kttsjobmgr.ui:91
-#. i18n: ectx: property (whatsThis), widget (KPushButton, speak_file)
-#: rc.cpp:110
-msgid ""
-"<p>Prompts you for a file name and queues the contents of the file for "
-"speaking.  You must click the <b>Resume</b> button before the job will be "
-"speakable.  The job will be spoken by the topmost Talker in the "
-"<b>Talkers</b> tab.</p>"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/kttsjobmgr.ui:94
-#. i18n: ectx: property (text), widget (KPushButton, speak_file)
-#: rc.cpp:113
-msgid "Spea&k File"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/talkerwidget.ui:21
-#. i18n: ectx: property (text), widget (QLabel, nameLabel)
-#: rc.cpp:116
-msgid "&Name"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/talkerwidget.ui:77
-#. i18n: ectx: property (text), widget (QTableWidget, AvailableTalkersTable)
-#: rc.cpp:119 libkttsd/selectlanguagedlg.cpp:56
-#: libkttsd/talkerlistmodel.cpp:132
-msgid "Language"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/talkerwidget.ui:82
-#. i18n: ectx: property (text), widget (QTableWidget, AvailableTalkersTable)
-#: rc.cpp:122 libkttsd/talkerlistmodel.cpp:133
-msgid "Synthesizer"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/talkerwidget.ui:90
-#. i18n: ectx: property (text), widget (QLabel, label_2)
-#: rc.cpp:125
-msgid "Voice &Type"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/talkerwidget.ui:101
-#. i18n: ectx: property (text), item, widget (KComboBox, voiceComboBox)
-#: rc.cpp:128
-msgid "Male 1"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/talkerwidget.ui:106
-#. i18n: ectx: property (text), item, widget (KComboBox, voiceComboBox)
-#: rc.cpp:131 libkttsd/talkercode.cpp:130
-msgid "Male 2"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/talkerwidget.ui:111
-#. i18n: ectx: property (text), item, widget (KComboBox, voiceComboBox)
-#: rc.cpp:134 libkttsd/talkercode.cpp:131
-msgid "Male 3"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/talkerwidget.ui:116
-#. i18n: ectx: property (text), item, widget (KComboBox, voiceComboBox)
-#: rc.cpp:137
-msgid "Female 1"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/talkerwidget.ui:121
-#. i18n: ectx: property (text), item, widget (KComboBox, voiceComboBox)
-#: rc.cpp:140 libkttsd/talkercode.cpp:133
-msgid "Female 2"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/talkerwidget.ui:126
-#. i18n: ectx: property (text), item, widget (KComboBox, voiceComboBox)
-#: rc.cpp:143 libkttsd/talkercode.cpp:134
-msgid "Female 3"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/talkerwidget.ui:131
-#. i18n: ectx: property (text), item, widget (KComboBox, voiceComboBox)
-#: rc.cpp:146
-msgid "Male Child"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/talkerwidget.ui:136
-#. i18n: ectx: property (text), item, widget (KComboBox, voiceComboBox)
-#: rc.cpp:149
-msgid "Female Child"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/talkerwidget.ui:144
-#. i18n: ectx: property (text), widget (QLabel, label_3)
-#: rc.cpp:152
-msgid "&Speed"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/talkerwidget.ui:190
-#. i18n: ectx: property (text), widget (QLabel, label_4)
-#: rc.cpp:155
-msgid "&Pitch"
-msgstr ""
-
-#. i18n: file: kcmkttsmgr/talkerwidget.ui:236
-#. i18n: ectx: property (text), widget (QLabel, label_5)
-#: rc.cpp:158
-msgid "&Volume"
-msgstr ""
-
-#. i18n: file: libkttsd/selecttalkerwidget.ui:21
-#. i18n: ectx: property (windowTitle), widget (QWidget, SelectTalkerWidget)
-#: rc.cpp:161 libkttsd/selecttalkerdlg.h:59
-#: filters/talkerchooser/talkerchooserconf.cpp:197
-msgid "Select Talker"
-msgstr ""
-
-#. i18n: file: libkttsd/selecttalkerwidget.ui:58
-#. i18n: ectx: property (whatsThis), widget (QRadioButton, useDefaultRadioButton)
-#: rc.cpp:164
-msgid ""
-"When checked, will use the default Talker, which is the topmost Talker "
-"listed in the Talkers tab."
-msgstr ""
-
-#. i18n: file: libkttsd/selecttalkerwidget.ui:61
-#. i18n: ectx: property (text), widget (QRadioButton, useDefaultRadioButton)
-#: rc.cpp:167
-msgid "&Use default Talker"
-msgstr ""
-
-#. i18n: file: libkttsd/selecttalkerwidget.ui:68
-#. i18n: ectx: property (whatsThis), widget (QRadioButton, useSpecificTalkerRadioButton)
-#: rc.cpp:170
-msgid ""
-"When checked, will use the specific Talker (if it is still configured), "
-"otherwise the Talker most closely matching."
-msgstr ""
-
-#. i18n: file: libkttsd/selecttalkerwidget.ui:71
-#. i18n: ectx: property (text), widget (QRadioButton, useSpecificTalkerRadioButton)
-#: rc.cpp:173
-msgid "Use specific &Talker"
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/editreplacementwidget.ui:23
-#. i18n: ectx: property (title), widget (QGroupBox, typeGroupBox)
-#: rc.cpp:176
-msgid "&Type"
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/editreplacementwidget.ui:35
-#. i18n: ectx: property (text), widget (QRadioButton, wordRadioButton)
-#: rc.cpp:179
-msgid "&Word"
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/editreplacementwidget.ui:45
-#. i18n: ectx: property (text), widget (QRadioButton, regexpRadioButton)
-#: rc.cpp:182
-msgid "Regular &expression"
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/editreplacementwidget.ui:63
-#. i18n: ectx: property (text), widget (QLabel, matchLabel)
-#: rc.cpp:185
-msgid "&Match:"
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/editreplacementwidget.ui:76
-#. i18n: ectx: property (text), widget (QLabel, substLabel)
-#: rc.cpp:188
-msgid "&Replace with:"
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/editreplacementwidget.ui:119
-#. i18n: ectx: property (text), widget (KPushButton, matchButton)
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:143
-#. i18n: ectx: property (text), widget (KPushButton, languageBrowseButton)
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:143
-#. i18n: ectx: property (text), widget (KPushButton, reEditorButton)
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:206
-#. i18n: ectx: property (text), widget (KPushButton, talkerButton)
-#: rc.cpp:191 rc.cpp:230 rc.cpp:332 rc.cpp:350
-msgid "..."
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/editreplacementwidget.ui:133
-#. i18n: ectx: property (text), widget (QCheckBox, matchCaseCheckBox)
-#: rc.cpp:194
-msgid "Match &case"
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:15
-#. i18n: ectx: property (windowTitle), widget (QWidget, StringReplacerConfWidget)
-#: rc.cpp:197
-msgid "Configure String Replacer"
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:35
-#. i18n: ectx: property (whatsThis), widget (QLabel, nameLabel)
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:35
-#. i18n: ectx: property (whatsThis), widget (QLabel, nameLabel)
-#: rc.cpp:200 rc.cpp:299
-msgctxt "What's this text"
-msgid "Enter any name you like for this filter."
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:38
-#. i18n: ectx: property (text), widget (QLabel, nameLabel)
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:38
-#. i18n: ectx: property (text), widget (QLabel, nameLabel)
-#. i18n: file: filters/xmltransformer/xmltransformerconfwidget.ui:92
-#. i18n: ectx: property (text), widget (QLabel, nameLabel)
-#: rc.cpp:203 rc.cpp:302 rc.cpp:386
-msgid "&Name:"
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:51
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, nameLineEdit)
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:51
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, nameLineEdit)
-#: rc.cpp:206 rc.cpp:305
-msgid "Enter any name you like for this filter."
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:60
-#. i18n: ectx: property (whatsThis), widget (QGroupBox, applyGroupBox)
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:60
-#. i18n: ectx: property (whatsThis), widget (QGroupBox, applyGroupBox)
-#. i18n: file: filters/xmltransformer/xmltransformerconfwidget.ui:139
-#. i18n: ectx: property (whatsThis), widget (QGroupBox, applyGroupBox)
-#: rc.cpp:209 rc.cpp:308 rc.cpp:401
-msgid "These settings determines when the filter is applied to text."
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:80
-#. i18n: ectx: property (whatsThis), widget (QLabel, languageLabel)
-#: rc.cpp:212
-msgctxt "What's this text"
-msgid ""
-"This filter is applied to text jobs of the specified language.  You may "
-"select more than one language by clicking the browse button and Ctrl-"
-"clicking on more than one in the list.  If blank the filter applies to all "
-"text jobs of any language."
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:83
-#. i18n: ectx: property (text), widget (QLabel, languageLabel)
-#: rc.cpp:215
-msgid "Lan&guage is:"
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:96
-#. i18n: ectx: property (whatsThis), widget (QLabel, appIdLabel)
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:99
-#. i18n: ectx: property (whatsThis), widget (QLabel, appIdLabel)
-#: rc.cpp:218 rc.cpp:320
-msgid ""
-"Enter a D-Bus Application ID.  This filter will only apply to text jobs "
-"queued by that application.  You may enter more than one ID separated by "
-"commas.  If blank, this filter applies to text jobs queued by all "
-"applications.  Tip: Use kdcop from the command line to get the Application "
-"IDs of running applications.  Example: \"konversation, kvirc,ksirc,kopete\""
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:99
-#. i18n: ectx: property (text), widget (QLabel, appIdLabel)
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:102
-#. i18n: ectx: property (text), widget (QLabel, appIdLabel)
-#: rc.cpp:221 rc.cpp:323
-msgid "Application &ID contains:"
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:133
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, languageLineEdit)
-#: rc.cpp:224
-msgid ""
-"This filter is applied to text jobs of the specified language.  You may "
-"select more than one language by clicking the browse button and Ctrl-"
-"clicking on more than one in the list.  If blank the filter applies to all "
-"text jobs of any language."
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:140
-#. i18n: ectx: property (whatsThis), widget (KPushButton, languageBrowseButton)
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:140
-#. i18n: ectx: property (whatsThis), widget (KPushButton, reEditorButton)
-#: rc.cpp:227 rc.cpp:329
-msgid ""
-"Click to select one or more languages.  This filter will be applied to text "
-"jobs of those languages."
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:152
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, appIdLineEdit)
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:152
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, appIdLineEdit)
-#: rc.cpp:233 rc.cpp:335
-msgid ""
-"<qt>Enter a D-Bus Application ID.  This filter will only apply to text jobs "
-"queued by that application.  You may enter more than one ID separated by "
-"commas.  Use <b>knotify</b> to match all messages sent as KDE notifications. "
-" If blank, this filter applies to text jobs queued by all applications.  "
-"Tip: Use kdcop from the command line to get the Application IDs of running "
-"applications.  Example: \"konversation, kvirc,ksirc,kopete\"</qt>"
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:180
-#. i18n: ectx: property (whatsThis), widget (KPushButton, loadButton)
-#: rc.cpp:236
-msgid "Click to load a word list from a file."
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:183
-#. i18n: ectx: property (text), widget (KPushButton, loadButton)
-#: rc.cpp:239
-msgctxt "Load a word list from a file"
-msgid "Load"
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:198
-#. i18n: ectx: property (whatsThis), widget (KPushButton, saveButton)
-#: rc.cpp:242
-msgid "Click to save word list to a file."
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:201
-#. i18n: ectx: property (text), widget (KPushButton, saveButton)
-#: rc.cpp:245
-msgid "&Save"
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:216
-#. i18n: ectx: property (whatsThis), widget (KPushButton, clearButton)
-#: rc.cpp:248
-msgid "Click to empty the word list."
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:219
-#. i18n: ectx: property (text), widget (KPushButton, clearButton)
-#: rc.cpp:251
-msgctxt "Clear the word list"
-msgid "Clear"
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:252
-#. i18n: ectx: property (whatsThis), widget (KPushButton, addButton)
-#: rc.cpp:254
-msgid "Click to add another word or regular expression to the list."
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:255
-#. i18n: ectx: property (text), widget (KPushButton, addButton)
-#: rc.cpp:257
-msgid "&Add"
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:270
-#. i18n: ectx: property (whatsThis), widget (QPushButton, upButton)
-#: rc.cpp:260
-msgid ""
-"Click to move selected word up in the list.  Words higher in the list are "
-"applied first."
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:273
-#. i18n: ectx: property (text), widget (QPushButton, upButton)
-#: rc.cpp:263
-msgid "&Up"
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:288
-#. i18n: ectx: property (whatsThis), widget (QPushButton, downButton)
-#: rc.cpp:266
-msgid ""
-"Click to move a word down in the list.  Words lower in the list are applied "
-"last."
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:309
-#. i18n: ectx: property (whatsThis), widget (KPushButton, editButton)
-#: rc.cpp:272
-msgid "Click to modify an existing word or regular expression in the list."
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:312
-#. i18n: ectx: property (text), widget (KPushButton, editButton)
-#: rc.cpp:275
-msgid "&Edit"
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:330
-#. i18n: ectx: property (whatsThis), widget (KPushButton, removeButton)
-#: rc.cpp:278
-msgid "Click to remove a word or regular expression from the list."
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:371
-#. i18n: ectx: property (text), widget (QTableWidget, substLView)
-#: rc.cpp:284
-msgid "Type"
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:376
-#. i18n: ectx: property (text), widget (QTableWidget, substLView)
-#: rc.cpp:287
-msgid "Match Case"
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:381
-#. i18n: ectx: property (text), widget (QTableWidget, substLView)
-#: rc.cpp:290
-msgid "Match"
-msgstr ""
-
-#. i18n: file: filters/stringreplacer/stringreplacerconfwidget.ui:386
-#. i18n: ectx: property (text), widget (QTableWidget, substLView)
-#: rc.cpp:293
-msgid "Replace With"
-msgstr ""
-
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:15
-#. i18n: ectx: property (windowTitle), widget (QWidget, TalkerChooserConfWidget)
-#: rc.cpp:296
-msgid "Configure Talker Chooser"
-msgstr ""
-
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:63
-#. i18n: ectx: property (title), widget (QGroupBox, applyGroupBox)
-#: rc.cpp:311
-msgid "&Apply This Filter When"
-msgstr ""
-
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:83
-#. i18n: ectx: property (whatsThis), widget (QLabel, reLabel)
-#: rc.cpp:314
-msgctxt "What's this text"
-msgid ""
-"This filter is applied to text jobs of the specified language.  You may "
-"select more than one language by clicking the browse button and Ctrl-"
-"clicking on more than one in the list.  If blank, the filter applies to all "
-"text jobs of any language."
-msgstr ""
-
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:86
-#. i18n: ectx: property (text), widget (QLabel, reLabel)
-#: rc.cpp:317
-msgid "Te&xt contains:"
-msgstr ""
-
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:133
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, reLineEdit)
-#: rc.cpp:326
-msgid ""
-"This filter is applied to text jobs of the specified language.  You may "
-"select more than one language by clicking the browse button and Ctrl-"
-"clicking on more than one in the list.  If blank, the filter applies to all "
-"text jobs of any language."
-msgstr ""
-
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:180
-#. i18n: ectx: property (whatsThis), widget (QLabel, talkerLabel)
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:196
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, talkerLineEdit)
-#: rc.cpp:338 rc.cpp:344
-msgid ""
-"The new Talker that will be used when the conditions above are met.  The "
-"default Talker is the topmost in the Talkers tab.  Click the button to "
-"choose a Talker."
-msgstr ""
-
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:183
-#. i18n: ectx: property (text), widget (QLabel, talkerLabel)
-#: rc.cpp:341
-msgid "&Talker:"
-msgstr ""
-
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:203
-#. i18n: ectx: property (whatsThis), widget (KPushButton, talkerButton)
-#: rc.cpp:347
-msgid "Click to select a Talker."
-msgstr ""
-
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:231
-#. i18n: ectx: property (whatsThis), widget (KPushButton, loadButton)
-#: rc.cpp:353
-msgid "Click to load a Talker Chooser configuration from a file."
-msgstr ""
-
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:234
-#. i18n: ectx: property (text), widget (KPushButton, loadButton)
-#: rc.cpp:356
-msgid "&Load..."
-msgstr ""
-
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:249
-#. i18n: ectx: property (whatsThis), widget (KPushButton, saveButton)
-#: rc.cpp:359
-msgid "Click to save this Talker Chooser to a file."
-msgstr ""
-
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:252
-#. i18n: ectx: property (text), widget (KPushButton, saveButton)
-#: rc.cpp:362
-msgid "&Save..."
-msgstr ""
-
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:267
-#. i18n: ectx: property (whatsThis), widget (KPushButton, clearButton)
-#: rc.cpp:365
-msgid "Click to clear everything."
-msgstr ""
-
-#. i18n: file: filters/talkerchooser/talkerchooserconfwidget.ui:270
-#. i18n: ectx: property (text), widget (KPushButton, clearButton)
-#: rc.cpp:368
-msgid "Cl&ear"
-msgstr ""
-
-#. i18n: file: filters/xmltransformer/xmltransformerconfwidget.ui:14
-#. i18n: ectx: property (windowTitle), widget (QWidget, XmlTransformerConfWidget)
-#: rc.cpp:371
-msgid "Configure XML Transformer"
-msgstr ""
-
-#. i18n: file: filters/xmltransformer/xmltransformerconfwidget.ui:42
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, nameLineEdit)
-#: rc.cpp:374
-msgid "Enter any descriptive name you like for this filter."
-msgstr ""
-
-#. i18n: file: filters/xmltransformer/xmltransformerconfwidget.ui:57
-#. i18n: ectx: property (whatsThis), widget (KUrlRequester, xsltPath)
-#. i18n: file: filters/xmltransformer/xmltransformerconfwidget.ui:105
-#. i18n: ectx: property (whatsThis), widget (QLabel, xsltLabel)
-#: rc.cpp:377 rc.cpp:389
-msgid ""
-"Enter the full path to an XML Style Language - Transforms (XSLT) stylesheet "
-"file.  XSLT files usually end with extension .xsl."
-msgstr ""
-
-#. i18n: file: filters/xmltransformer/xmltransformerconfwidget.ui:72
-#. i18n: ectx: property (whatsThis), widget (KUrlRequester, xsltprocPath)
-#. i18n: file: filters/xmltransformer/xmltransformerconfwidget.ui:121
-#. i18n: ectx: property (whatsThis), widget (QLabel, xsltprocLabel)
-#: rc.cpp:380 rc.cpp:395
-msgid ""
-"Enter the path to the xsltproc executable program.  If it is in the PATH "
-"environment variable, just enter \"xsltproc\"."
-msgstr ""
-
-#. i18n: file: filters/xmltransformer/xmltransformerconfwidget.ui:89
-#. i18n: ectx: property (whatsThis), widget (QLabel, nameLabel)
-#: rc.cpp:383
-msgctxt "What's this text"
-msgid "Enter any descriptive name you like for this filter."
-msgstr ""
-
-#. i18n: file: filters/xmltransformer/xmltransformerconfwidget.ui:108
-#. i18n: ectx: property (text), widget (QLabel, xsltLabel)
-#: rc.cpp:392
-msgid "&XSLT file:"
-msgstr ""
-
-#. i18n: file: filters/xmltransformer/xmltransformerconfwidget.ui:124
-#. i18n: ectx: property (text), widget (QLabel, xsltprocLabel)
-#: rc.cpp:398
-msgid "xsltproc &executable:"
-msgstr ""
-
-#. i18n: file: filters/xmltransformer/xmltransformerconfwidget.ui:142
-#. i18n: ectx: property (title), widget (QGroupBox, applyGroupBox)
-#: rc.cpp:404
-msgid "Apply This &Filter When"
-msgstr ""
-
-#. i18n: file: filters/xmltransformer/xmltransformerconfwidget.ui:170
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, rootElementLineEdit)
-#: rc.cpp:407
-msgid ""
-"This filter will be applied only to text having the specified XML root "
-"element.  If blank, applies to all text.  You may enter more than one root "
-"element separated by commas.  Example: \"html\"."
-msgstr ""
-
-#. i18n: file: filters/xmltransformer/xmltransformerconfwidget.ui:185
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, doctypeLineEdit)
-#. i18n: file: filters/xmltransformer/xmltransformerconfwidget.ui:233
-#. i18n: ectx: property (whatsThis), widget (QLabel, doctypeLabel)
-#: rc.cpp:410 rc.cpp:422
-msgid ""
-"This filter will be applied only to text having the specified DOCTYPE "
-"specification.  If blank, applies to all text.  You may enter more than one "
-"DOCTYPE separated by commas.  Example: \"xhtml\"."
-msgstr ""
-
-#. i18n: file: filters/xmltransformer/xmltransformerconfwidget.ui:200
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, appIdLineEdit)
-#. i18n: file: filters/xmltransformer/xmltransformerconfwidget.ui:249
-#. i18n: ectx: property (whatsThis), widget (QLabel, appIdLabel)
-#: rc.cpp:413 rc.cpp:428
-msgid ""
-"<qt>Enter a D-Bus Application ID.  This filter will only apply to text "
-"queued by that application.  You may enter more than one ID separated by "
-"commas.  Use <b>knotify</b> to match all messages sent as KDE notifications. "
-" If blank, this filter applies to text queued by all applications.  Tip: Use "
-"kdcop from the command line to get the Application IDs of running "
-"applications.  Example: \"konversation, kvirc,ksirc,kopete\"</qt>"
-msgstr ""
-
-#. i18n: file: filters/xmltransformer/xmltransformerconfwidget.ui:217
-#. i18n: ectx: property (whatsThis), widget (QLabel, rootElementLabel)
-#: rc.cpp:416
-msgctxt "What's this text"
-msgid ""
-"This filter will be applied only to text having the specified XML root "
-"element.  If blank, applies to all text.  You may enter more than one root "
-"element separated by commas.  Example: \"html\"."
-msgstr ""
-
-#. i18n: file: filters/xmltransformer/xmltransformerconfwidget.ui:220
-#. i18n: ectx: property (text), widget (QLabel, rootElementLabel)
-#: rc.cpp:419
-msgid "&Root element is:"
-msgstr ""
-
-#. i18n: file: filters/xmltransformer/xmltransformerconfwidget.ui:236
-#. i18n: ectx: property (text), widget (QLabel, doctypeLabel)
-#: rc.cpp:425
-msgid "or DOC&TYPE is:"
-msgstr ""
-
-#. i18n: file: filters/xmltransformer/xmltransformerconfwidget.ui:252
-#. i18n: ectx: property (text), widget (QLabel, appIdLabel)
-#: rc.cpp:431
-msgid "and Application &ID contains:"
-msgstr ""
-
-#: filters/main.cpp:18
-msgid "testfilter"
-msgstr ""
-
-#: filters/main.cpp:19
-msgid "A utility for testing Jovie filter plugins."
-msgstr ""
-
-#: filters/main.cpp:20
-msgid "Copyright 2005, Gary Cramblitt &lt;garycramblitt@comcast.net&gt;"
-msgstr ""
-
-#: filters/main.cpp:21 jovie/main.cpp:46 kcmkttsmgr/kcmkttsmgr.cpp:672
-msgid "Gary Cramblitt"
-msgstr ""
-
-#: filters/main.cpp:21 kcmkttsmgr/kcmkttsmgr.cpp:672
-msgid "Maintainer"
-msgstr ""
-
-#: filters/main.cpp:27
-msgid "Name of a Jovie filter plugin (required)"
-msgstr ""
-
-#: filters/main.cpp:29
-msgid "Talker code passed to filter"
-msgstr ""
-
-#: filters/main.cpp:31
-msgid "D-Bus application ID passed to filter"
-msgstr ""
-
-#: filters/main.cpp:33
-msgid "Config file group name passed to filter"
-msgstr ""
-
-#: filters/main.cpp:34
-msgid "Display list of available Filter PlugIns and exit"
-msgstr ""
-
-#: filters/main.cpp:36
-msgid "Display tabs as \\t, otherwise they are removed"
-msgstr ""
-
-#: filters/main.cpp:37
-msgid "Display list of available filter plugins and exit"
-msgstr ""
-
-#: jovie/jovie.cpp:454 jovie/jovietrayicon.cpp:166
-msgid "KDE Text-to-Speech"
-msgstr ""
-
-#: jovie/jovietrayicon.cpp:59
-msgid "KDE Text-to-Speech Manager"
-msgstr ""
-
-#: jovie/jovietrayicon.cpp:68
-msgid "&Stop/Delete"
-msgstr ""
-
-#: jovie/jovietrayicon.cpp:71
-msgid "&Pause"
-msgstr ""
-
-#: jovie/jovietrayicon.cpp:74
-msgid "&Resume"
-msgstr ""
-
-#: jovie/jovietrayicon.cpp:77
-msgid "R&epeat"
-msgstr ""
-
-#: jovie/jovietrayicon.cpp:81
-msgid "Spea&k Clipboard Contents"
-msgstr ""
-
-#: jovie/jovietrayicon.cpp:84
-msgid "&Configure"
-msgstr ""
-
-#: jovie/jovietrayicon.cpp:88
-msgid "Jovie &Handbook"
-msgstr ""
-
-#: jovie/jovietrayicon.cpp:91
-msgid "&About Jovie"
-msgstr ""
-
-#: jovie/main.cpp:41
-msgid "Jovie"
-msgstr ""
-
-#: jovie/main.cpp:42
-msgid "Text-to-speech synthesis daemon"
-msgstr ""
-
-#: jovie/main.cpp:43
-msgid "(C) 2002, José Pablo Ezequiel Fernández"
-msgstr ""
-
-#: jovie/main.cpp:44
-msgid "Jeremy Whiting"
-msgstr ""
-
-#: jovie/main.cpp:44
-msgid "Current Maintainer"
-msgstr ""
-
-#: jovie/main.cpp:45 kcmkttsmgr/kcmkttsmgr.cpp:671
-msgid "José Pablo Ezequiel Fernández"
-msgstr ""
-
-#: jovie/main.cpp:45
-msgid "Original Author"
-msgstr ""
-
-#: jovie/main.cpp:46
-msgid "Previous Maintainer"
-msgstr ""
-
-#: jovie/main.cpp:47
-msgid "Gunnar Schmi Dt"
-msgstr ""
-
-#: jovie/main.cpp:47 jovie/main.cpp:48 jovie/main.cpp:49
-#: kcmkttsmgr/kcmkttsmgr.cpp:673 kcmkttsmgr/kcmkttsmgr.cpp:674
-msgid "Contributor"
-msgstr ""
-
-#: jovie/main.cpp:48 kcmkttsmgr/kcmkttsmgr.cpp:673
-msgid "Olaf Schmidt"
-msgstr ""
-
-#: jovie/main.cpp:49 kcmkttsmgr/kcmkttsmgr.cpp:674
-msgid "Paul Giannaros"
-msgstr ""
-
-#: jovie/main.cpp:50
-msgid "Jorge Luis Arzola"
-msgstr ""
-
-#: jovie/main.cpp:50 jovie/main.cpp:51
-msgid "Testing"
-msgstr ""
-
-#: jovie/main.cpp:51
-msgid "David Powell"
-msgstr ""
-
-#: kcmkttsmgr/addtalker.cpp:39
-msgid "Add Talker"
-msgstr ""
-
-#: kcmkttsmgr/kcmkttsmgr.cpp:178 kcmkttsmgr/kcmkttsmgr.cpp:798
-msgid "Filter"
-msgstr ""
-
-#: kcmkttsmgr/kcmkttsmgr.cpp:617
-msgid ""
-"You have made changes to the configuration but have not saved them yet.  "
-"Click Apply to save the changes or Cancel to abandon the changes."
-msgstr ""
-
-#: kcmkttsmgr/kcmkttsmgr.cpp:658
-msgid ""
-"<h1>Text-to-Speech</h1><p>This is the configuration for the text-to-speech D-"
-"Bus service</p><p>This allows other applications to access text-to-speech "
-"resources</p><p>Be sure to configure a default language for the language you "
-"are using as this will be the language used by most of the applications</p>"
-msgstr ""
-
-#: kcmkttsmgr/kcmkttsmgr.cpp:667
-msgid "jovie"
-msgstr ""
-
-#: kcmkttsmgr/kcmkttsmgr.cpp:667
-msgid "KCMKttsMgr"
-msgstr ""
-
-#: kcmkttsmgr/kcmkttsmgr.cpp:669
-msgid "(c) 2010, Jeremy Whiting"
-msgstr ""
-
-#: kcmkttsmgr/kcmkttsmgr.cpp:671
-msgid "Author"
-msgstr ""
-
-#: kcmkttsmgr/kcmkttsmgr.cpp:797
-msgid "Select Filter"
-msgstr ""
-
-#: kcmkttsmgr/kcmkttsmgr.cpp:1114
-#, kde-format
-msgid "Jovie Version: %1"
-msgstr ""
-
-#: kcmkttsmgr/kcmkttsmgr.cpp:1263
-msgid "Filter Configuration"
-msgstr ""
-
-#: libkttsd/selectlanguagedlg.cpp:57
-msgid "Code"
-msgstr ""
-
-#: libkttsd/talkercode.cpp:121
-msgctxt "Default language code"
-msgid "default"
-msgstr ""
-
-#: libkttsd/talkercode.cpp:129
-msgctxt "The name of the first Male voice"
-msgid "Male 1"
-msgstr ""
-
-#: libkttsd/talkercode.cpp:132
-msgctxt "The name of the first Female voice"
-msgid "Female 1"
-msgstr ""
-
-#: libkttsd/talkercode.cpp:135
-msgctxt "The name of the male child voice"
-msgid "Boy"
-msgstr ""
-
-#: libkttsd/talkercode.cpp:136
-msgctxt "The name of the female child voice"
-msgid "Girl"
-msgstr ""
-
-#: libkttsd/talkercode.cpp:138
-msgctxt ""
-"Somehow user has gotten a voice type that is not valid, i.e. not Male1, "
-"Male2, etc."
-msgid "Invalid voice type"
-msgstr ""
-
-#: libkttsd/talkercode.cpp:166
-msgctxt "Other language"
-msgid "Other"
-msgstr ""
-
-#: libkttsd/talkercode.cpp:176
-msgctxt "full country name"
-msgid "United States of America"
-msgstr ""
-
-#: libkttsd/talkercode.cpp:177
-msgctxt "abbreviated country name"
-msgid "USA"
-msgstr ""
-
-#: libkttsd/talkercode.cpp:178
-msgctxt "full country name"
-msgid "United Kingdom"
-msgstr ""
-
-#: libkttsd/talkercode.cpp:179
-msgctxt "abbreviated country name"
-msgid "UK"
-msgstr ""
-
-#: libkttsd/talkerlistmodel.cpp:131
-msgid "Name"
-msgstr ""
-
-#: libkttsd/talkerlistmodel.cpp:134
-msgid "Voice Type"
-msgstr ""
-
-#: libkttsd/talkerlistmodel.cpp:135
-msgctxt "Volume of noise"
-msgid "Volume"
-msgstr ""
-
-#: libkttsd/talkerlistmodel.cpp:136
-msgid "Speed"
-msgstr ""
-
-#: libkttsd/talkerlistmodel.cpp:137
-msgid "Pitch"
-msgstr ""
-
-#: libkttsd/selectlanguagedlg.h:66
-msgid "Select Language"
-msgstr ""
-
-#: filters/stringreplacer/stringreplacerconf.cpp:128
-msgid "Unable to open file."
-msgstr ""
-
-#: filters/stringreplacer/stringreplacerconf.cpp:134
-msgid "File not in proper XML format."
-msgstr ""
-
-#: filters/stringreplacer/stringreplacerconf.cpp:217
-#: filters/stringreplacer/stringreplacerconf.cpp:559
-msgctxt "Abbreviation for 'Regular Expression'"
-msgid "RegExp"
-msgstr ""
-
-#: filters/stringreplacer/stringreplacerconf.cpp:217
-#: filters/stringreplacer/stringreplacerconf.cpp:303
-#: filters/stringreplacer/stringreplacerconf.cpp:372
-#: filters/stringreplacer/stringreplacerconf.cpp:527
-#: filters/stringreplacer/stringreplacerconf.cpp:557
-msgid "Word"
-msgstr ""
-
-#: filters/stringreplacer/stringreplacerconf.cpp:220
-#: filters/stringreplacer/stringreplacerconf.cpp:309
-#: filters/stringreplacer/stringreplacerconf.cpp:532
-#: filters/stringreplacer/stringreplacerconf.cpp:560
-msgctxt "Yes or no"
-msgid "Yes"
-msgstr ""
-
-#: filters/stringreplacer/stringreplacerconf.cpp:220
-#: filters/stringreplacer/stringreplacerconf.cpp:560
-msgctxt "Yes or no"
-msgid "No"
-msgstr ""
-
-#: filters/stringreplacer/stringreplacerconf.cpp:258
-msgid "Unable to open file "
-msgstr ""
-
-#: filters/stringreplacer/stringreplacerconf.cpp:340
-#: filters/stringreplacer/stringreplacerconf.cpp:362
-msgid "String Replacer"
-msgstr ""
-
-#: filters/stringreplacer/stringreplacerconf.cpp:360
-#: filters/stringreplacer/stringreplacerconf.cpp:401
-#: filters/stringreplacer/stringreplacerconf.cpp:405
-msgid "Multiple Languages"
-msgstr ""
-
-#: filters/stringreplacer/stringreplacerconf.cpp:373
-msgctxt "Abbreviation for 'Regular Expresion'"
-msgid "RegExp"
-msgstr ""
-
-#: filters/stringreplacer/stringreplacerconf.cpp:375
-msgid "Error"
-msgstr ""
-
-#: filters/stringreplacer/stringreplacerconf.cpp:382
-msgid "Select Languages"
-msgstr ""
-
-#: filters/stringreplacer/stringreplacerconf.cpp:548
-msgid "Edit String Replacement"
-msgstr ""
-
-#: filters/stringreplacer/stringreplacerconf.cpp:647
-#: filters/stringreplacer/stringreplacerconf.cpp:663
-msgid "String Replacer Word List (*.xml)"
-msgstr ""
-
-#: filters/stringreplacer/stringreplacerconf.cpp:654
-#: filters/stringreplacer/stringreplacerconf.cpp:670
-msgid "Error Opening File"
-msgstr ""
-
-#: filters/talkerchooser/talkerchooserconf.cpp:136
-msgid "Talker Chooser"
-msgstr ""
-
-#: filters/talkerchooser/talkerchooserconf.cpp:212
-#: filters/talkerchooser/talkerchooserconf.cpp:226
-msgid "Talker Chooser Config (*rc)"
-msgstr ""
-
-#: filters/xmltransformer/xmltransformerconf.cpp:115
-msgid "XML Transformer"
-msgstr ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/joystick.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/joystick.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/joystick.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/joystick.po	2012-03-23 06:42:02.000000000 +0000
@@ -5,21 +5,21 @@
 # AbdulAziz AlSharif <a.a-a.s@hotmail.com>, 2007.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: joystick\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2011-12-12 19:33+0000\n"
+"PO-Revision-Date: 2012-03-14 17:04+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
+"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:21+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Poedit-Language: Arabic\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:43+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: caldialog.cpp:41 joywidget.cpp:390
 msgid "Calibration"
@@ -159,7 +159,7 @@
 
 #: joystick.cpp:81
 msgid "KDE System Settings Module to test Joysticks"
-msgstr "نمط إعدادات نظام كدي لاختبار عصا التحكم"
+msgstr "وحدة مركز تحكم كدي لاختبار عصا الألعاب"
 
 #: joystick.cpp:82
 msgid "(c) 2004, Martin Koller"
@@ -283,12 +283,12 @@
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
 msgstr ""
-"Mohamed SAAD محمد سعد,زايد السعيدي, ,Launchpad Contributions:,Ahmed "
-"Shams,Youssef Chahibi,Zayed Amer Al-Saidi,tamimi"
+"Mohamed SAAD محمد سعد,زايد السعيدي, ,Launchpad Contributions:,Abdalrahim G. "
+"Fakhouri,Ahmed Shams,Youssef Chahibi,Zayed Amer Al-Saidi,tamimi"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
 msgstr ""
-"metehyi@free.fr,zayed.alsaidi@gmail.com,,,,,zayed.alsaidi@gmail.com,bakr.tami"
-"mi@gmail.com"
+"metehyi@free.fr,zayed.alsaidi@gmail.com,,,,,,zayed.alsaidi@gmail.com,bakr.tam"
+"imi@gmail.com"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/juk.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/juk.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/juk.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/juk.po	2012-03-23 06:41:39.000000000 +0000
@@ -12,7 +12,7 @@
 "Project-Id-Version: juk\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:45+0000\n"
-"PO-Revision-Date: 2011-12-12 19:13+0000\n"
+"PO-Revision-Date: 2012-03-14 17:37+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
@@ -20,8 +20,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:59+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:55+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: advancedsearchdialog.cpp:43
 msgid "Create Search Playlist"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/k3b.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/k3b.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/k3b.po	2012-02-23 06:20:06.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/k3b.po	2012-03-23 06:41:37.000000000 +0000
@@ -19,8 +19,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:24+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:36+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: projects/k3bvideodvdview.cpp:58
 msgid ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/k3bsetup.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/k3bsetup.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/k3bsetup.po	2012-02-23 06:20:06.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/k3bsetup.po	2012-03-23 06:41:37.000000000 +0000
@@ -12,8 +12,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:26+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:37+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: k3bsetup.cpp:77
 msgid "K3bSetup"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kabc_akonadi.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kabc_akonadi.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kabc_akonadi.po	2012-02-23 06:20:23.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kabc_akonadi.po	2012-03-23 06:41:54.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 01:32+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:55+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: resourceakonadi_p.cpp:292
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kabcclient.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kabcclient.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kabcclient.po	2012-02-23 06:20:10.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kabcclient.po	2012-03-23 06:41:41.000000000 +0000
@@ -8,14 +8,14 @@
 "Project-Id-Version: kabcclient\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 03:45+0000\n"
-"PO-Revision-Date: 2012-01-25 03:17+0000\n"
+"PO-Revision-Date: 2012-03-13 04:34+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:22+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:08+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: src/outputformatimpls.cpp:54
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kabc_dir.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kabc_dir.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kabc_dir.po	2012-02-23 06:20:16.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kabc_dir.po	2012-03-23 06:41:47.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 22:58+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:16+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: resourcedir.cpp:222
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kabc_file.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kabc_file.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kabc_file.po	2012-02-23 06:20:16.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kabc_file.po	2012-03-23 06:41:47.000000000 +0000
@@ -16,8 +16,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 22:59+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:16+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: resourcefile.cpp:211
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kabcformat_binary.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kabcformat_binary.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kabcformat_binary.po	2012-02-23 06:20:16.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kabcformat_binary.po	2012-03-23 06:41:47.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:00+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:16+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: binaryformat.cpp:139
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kabc_ldapkio.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kabc_ldapkio.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kabc_ldapkio.po	2012-02-23 06:20:16.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kabc_ldapkio.po	2012-03-23 06:41:47.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 22:59+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:16+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: resourceldapkioconfig.cpp:74
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kabc_net.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kabc_net.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kabc_net.po	2012-02-23 06:20:16.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kabc_net.po	2012-03-23 06:41:47.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:00+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:16+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: resourcenet.cpp:146
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kabc.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kabc.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kabc.po	2012-02-23 06:20:16.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kabc.po	2012-03-23 06:41:47.000000000 +0000
@@ -16,8 +16,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 22:58+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:15+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: address.cpp:367
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kaccess.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kaccess.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kaccess.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kaccess.po	2012-03-23 06:42:02.000000000 +0000
@@ -13,16 +13,15 @@
 "Project-Id-Version: kaccess\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2011-12-12 19:47+0000\n"
+"PO-Revision-Date: 2012-03-14 17:08+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:22+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:44+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kaccess.cpp:48
 msgid ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kaddressbook.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kaddressbook.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kaddressbook.po	2012-02-23 06:20:10.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kaddressbook.po	2012-03-23 06:41:41.000000000 +0000
@@ -20,8 +20,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:23+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:08+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: quicksearchwidget.cpp:38
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kalarm.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kalarm.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kalarm.po	2012-02-23 06:20:10.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kalarm.po	2012-03-23 06:41:41.000000000 +0000
@@ -9,7 +9,7 @@
 "Project-Id-Version: kalarm\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 03:45+0000\n"
-"PO-Revision-Date: 2011-12-12 18:24+0000\n"
+"PO-Revision-Date: 2012-03-14 17:54+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
@@ -17,8 +17,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:24+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:08+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: latecancel.cpp:44
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kalzium.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kalzium.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kalzium.po	2012-02-23 06:20:34.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kalzium.po	2012-03-23 06:42:07.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:18+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:53+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: rc.cpp:1
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kanagram.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kanagram.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kanagram.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kanagram.po	2012-03-23 06:42:06.000000000 +0000
@@ -9,17 +9,15 @@
 "Project-Id-Version: kanagram\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-09 14:12+0000\n"
-"PO-Revision-Date: 2012-01-25 11:06+0000\n"
+"PO-Revision-Date: 2012-03-12 23:10+0000\n"
 "Last-Translator: Youssef Chahibi <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:16+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Poedit-Country: JORDAN\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:52+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
-"X-Poedit-Language: Arabic\n"
 
 #: kanagram.cpp:61
 msgid "reveal word"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kapman.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kapman.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kapman.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kapman.po	2012-03-23 06:41:38.000000000 +0000
@@ -17,8 +17,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:41+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:46+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: gamescene.cpp:100
 msgid "GET READY!!!"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kateexternaltoolsplugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kateexternaltoolsplugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kateexternaltoolsplugin.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kateexternaltoolsplugin.po	2012-03-23 06:42:00.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:02+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:32+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kateexternaltools.cpp:296
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katefilebrowserplugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katefilebrowserplugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katefilebrowserplugin.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katefilebrowserplugin.po	2012-03-23 06:42:00.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:02+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:32+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: katefilebrowser.cpp:96
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katefiletemplates.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katefiletemplates.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katefiletemplates.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katefiletemplates.po	2012-03-23 06:42:01.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:03+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:33+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: filetemplates.cpp:85
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katefindinfilesplugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katefindinfilesplugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katefindinfilesplugin.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katefindinfilesplugin.po	2012-03-23 06:42:01.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:03+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:33+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: katefinddialog.cpp:50 kateresultview.cpp:52
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katehelloworld.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katehelloworld.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katehelloworld.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katehelloworld.po	2012-03-23 06:42:01.000000000 +0000
@@ -5,28 +5,29 @@
 # Isam Bayazidi <bayazidi@arabeyes.org>, 2002.
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: katehelloworld\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 17:20+0000\n"
-"PO-Revision-Date: 2012-01-04 02:19+0000\n"
-"Last-Translator: Youssef Chahibi <Unknown>\n"
-"Language-Team: <en@li.org>\n"
+"PO-Revision-Date: 2012-03-12 22:32+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:04+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:33+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: plugin_katehelloworld.cpp:16
 msgid "Hello World"
-msgstr ""
+msgstr "رسالة الترحيب"
 
 #: plugin_katehelloworld.cpp:16
 msgid "Example kate plugin"
-msgstr ""
+msgstr "نموذج لملحقات كيت"
 
 #: plugin_katehelloworld.cpp:38
 msgid "Insert Hello World"
@@ -35,15 +36,17 @@
 #: rc.cpp:1
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
-msgstr " ,Launchpad Contributions:,Youssef Chahibi"
+msgstr ""
+"عبدالرحيم الفاخوري, ,Launchpad Contributions:,Abdalrahim G. Fakhouri,Youssef "
+"Chahibi"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr ",,"
+msgstr "abdilra7eem@yahoo.com,,,,"
 
 #. i18n: file: ui.rc:4
 #. i18n: ectx: Menu (tools)
 #: rc.cpp:5
 msgid "&Tools"
-msgstr ""
+msgstr "أ&دوات"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katekonsoleplugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katekonsoleplugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katekonsoleplugin.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katekonsoleplugin.po	2012-03-23 06:42:01.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:05+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:34+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kateconsole.cpp:55
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katemailfilesplugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katemailfilesplugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katemailfilesplugin.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katemailfilesplugin.po	2012-03-23 06:42:01.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:05+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:34+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: katemailfiles.cpp:48
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kateopenheader.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kateopenheader.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kateopenheader.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kateopenheader.po	2012-03-23 06:42:01.000000000 +0000
@@ -5,45 +5,48 @@
 # Isam Bayazidi <bayazidi@arabeyes.org>, 2002.
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kateopenheader\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 17:20+0000\n"
-"PO-Revision-Date: 2012-01-04 02:17+0000\n"
-"Last-Translator: Youssef Chahibi <Unknown>\n"
-"Language-Team: <en@li.org>\n"
+"PO-Revision-Date: 2012-03-12 22:32+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:06+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:34+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: plugin_kateopenheader.cpp:41
 msgid "Open Header"
-msgstr ""
+msgstr "افتح الترويسة"
 
 #: plugin_kateopenheader.cpp:41
 msgid "Open header for a source file"
-msgstr ""
+msgstr "افتح الترويسة لملف مصدريّ"
 
 #: plugin_kateopenheader.cpp:51
 msgid "Open .h/.cpp/.c"
-msgstr "إفتح .h/.cpp/.c"
+msgstr "افتح .h/.cpp/.c"
 
 #: rc.cpp:1
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
-msgstr " ,Launchpad Contributions:,Youssef Chahibi"
+msgstr ""
+"عبدالرحيم الفاخوري, ,Launchpad Contributions:,Abdalrahim G. Fakhouri,Youssef "
+"Chahibi"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr ",,"
+msgstr "abdilra7eem@yahoo.com,,,,"
 
 #. i18n: file: ui.rc:4
 #. i18n: ectx: Menu (file)
 #: rc.cpp:5
 msgid "&File"
-msgstr ""
+msgstr "&ملف"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katepart4.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katepart4.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katepart4.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katepart4.po	2012-03-23 06:42:01.000000000 +0000
@@ -18,7 +18,7 @@
 "Project-Id-Version: katepart4\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 17:20+0000\n"
-"PO-Revision-Date: 2012-01-25 11:01+0000\n"
+"PO-Revision-Date: 2012-03-12 22:33+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
@@ -26,8 +26,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:07+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:35+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: search/katesearchbar.cpp:76
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kate.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kate.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kate.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kate.po	2012-03-23 06:42:00.000000000 +0000
@@ -14,7 +14,7 @@
 "Project-Id-Version: kate\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 17:20+0000\n"
-"PO-Revision-Date: 2012-01-25 11:01+0000\n"
+"PO-Revision-Date: 2012-03-12 22:32+0000\n"
 "Last-Translator: Youssef Chahibi <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
@@ -22,8 +22,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:59+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:31+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: rc.cpp:1 rc.cpp:1
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katequickdocumentswitcherplugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katequickdocumentswitcherplugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katequickdocumentswitcherplugin.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katequickdocumentswitcherplugin.po	2012-03-23 06:42:01.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:08+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:36+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: plugin_katequickdocumentswitcher.cpp:49
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katesymbolviewer.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katesymbolviewer.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katesymbolviewer.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katesymbolviewer.po	2012-03-23 06:42:01.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:09+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:37+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: bash_parser.cpp:43 fortran_parser.cpp:45 plugin_katesymbolviewer.cpp:103
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katetabbarextension.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katetabbarextension.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katetabbarextension.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katetabbarextension.po	2012-03-23 06:42:01.000000000 +0000
@@ -7,14 +7,14 @@
 "Project-Id-Version: katetabbarextension\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 17:20+0000\n"
-"PO-Revision-Date: 2012-01-25 11:01+0000\n"
+"PO-Revision-Date: 2012-03-12 22:32+0000\n"
 "Last-Translator: Youssef Chahibi <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:10+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:37+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: ktinytabbarconfigdialog.cpp:37
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katetextfilter.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katetextfilter.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katetextfilter.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katetextfilter.po	2012-03-23 06:42:01.000000000 +0000
@@ -10,14 +10,14 @@
 "Project-Id-Version: katetextfilter\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 17:20+0000\n"
-"PO-Revision-Date: 2012-01-25 10:58+0000\n"
+"PO-Revision-Date: 2012-03-12 22:33+0000\n"
 "Last-Translator: Youssef Chahibi <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:11+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:37+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: plugin_katetextfilter.cpp:55
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katexmlcheck.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katexmlcheck.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katexmlcheck.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katexmlcheck.po	2012-03-23 06:42:01.000000000 +0000
@@ -9,14 +9,14 @@
 "Project-Id-Version: katexmlcheck\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 17:20+0000\n"
-"PO-Revision-Date: 2012-01-26 21:28+0000\n"
+"PO-Revision-Date: 2012-03-14 07:31+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:11+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:38+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: plugin_katexmlcheck.cpp:84
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katexmltools.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katexmltools.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katexmltools.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katexmltools.po	2012-03-23 06:42:01.000000000 +0000
@@ -16,8 +16,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:12+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:38+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: plugin_katexmltools.cpp:128
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katomic.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katomic.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/katomic.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/katomic.po	2012-03-23 06:41:38.000000000 +0000
@@ -20,8 +20,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:42+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:46+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: chooselevelsetdialog.cpp:39
 msgid "Level Sets"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kbattleship.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kbattleship.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kbattleship.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kbattleship.po	2012-03-23 06:41:38.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:42+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:46+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: playerentity.cpp:167
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kblackbox.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kblackbox.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kblackbox.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kblackbox.po	2012-03-23 06:41:38.000000000 +0000
@@ -16,8 +16,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:43+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:46+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kbblevelconfigurationwidget.cpp:35
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kblankscrn.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kblankscrn.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kblankscrn.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kblankscrn.po	2012-03-23 06:42:02.000000000 +0000
@@ -16,10 +16,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:22+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:44+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: blankscrn.cpp:33
 msgid "KBlankScreen"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kblocks.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kblocks.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kblocks.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kblocks.po	2012-03-23 06:41:38.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:43+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:47+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: rc.cpp:13
 msgctxt "NAME OF TRANSLATORS"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kbounce.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kbounce.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kbounce.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kbounce.po	2012-03-23 06:41:38.000000000 +0000
@@ -16,8 +16,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:43+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:47+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: backgroundselector.cpp:110
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kbreakout.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kbreakout.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kbreakout.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kbreakout.po	2012-03-23 06:41:38.000000000 +0000
@@ -5,14 +5,14 @@
 "Project-Id-Version: desktop_extragear-base_plasma\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:39+0000\n"
-"PO-Revision-Date: 2012-01-25 11:46+0000\n"
+"PO-Revision-Date: 2012-03-12 22:56+0000\n"
 "Last-Translator: Osama Khalid <osamak.wfm@gmail.com>\n"
 "Language-Team: Arabic\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:44+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:47+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: gameengine.cpp:103
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kbruch.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kbruch.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kbruch.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kbruch.po	2012-03-23 06:42:06.000000000 +0000
@@ -6,7 +6,7 @@
 "Project-Id-Version: kbruch\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-09 14:18+0000\n"
-"PO-Revision-Date: 2012-01-25 11:02+0000\n"
+"PO-Revision-Date: 2012-03-12 23:08+0000\n"
 "Last-Translator: Youssef Chahibi <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
@@ -14,8 +14,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:14+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:51+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: AppMenuWidget.cpp:113
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcachegrind.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcachegrind.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcachegrind.po	2012-02-23 06:20:11.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcachegrind.po	2012-03-23 06:41:43.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:50+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:23+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: rc.cpp:1
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcal_akonadi.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcal_akonadi.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcal_akonadi.po	2012-02-23 06:20:23.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcal_akonadi.po	2012-03-23 06:41:54.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 01:33+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:56+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: resourceakonadi.cpp:371
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcalc.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcalc.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcalc.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcalc.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,1858 +0,0 @@
-# translation of kcalc.po to
-# Copyright (C) 2004, 2006, 2007 Free Software Foundation, Inc.
-# Waseem Bakr <bakr@mit.edu>, 2001.
-# Ahmad M. Zawawi <azawawi@emirates.net.ae>, 2004.
-# Youssef Chahibi <chahibi@gmail.com>, 2006, 2007.
-# Khaled Hosny <khaledhosny@eglug.org>, 2007.
-# Fahad Al-Saidi <fahad.alsaidi@gmail.com>, 2007.
-# Youness BOUTYOUR <niceboy@linuxac.org>, 2008.
-# Youness BOUTYOUR <niceboy120@gmail.com>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-#
-msgid ""
-msgstr ""
-"Project-Id-Version: kcalc\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 13:31+0000\n"
-"PO-Revision-Date: 2012-01-25 08:07+0000\n"
-"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:04+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"Language: ar\n"
-
-#: kcalc.cpp:69
-msgid "KDE Calculator"
-msgstr "حاسبة كدي"
-
-#: kcalc.cpp:122
-msgid "&Constants"
-msgstr "&ثوابت"
-
-#: kcalc.cpp:197
-msgid "Simple Mode"
-msgstr "النمط البسيط"
-
-#: kcalc.cpp:201
-msgid "Science Mode"
-msgstr "النمط العملي"
-
-#: kcalc.cpp:205
-msgid "Statistic Mode"
-msgstr "النمط الإحصائي"
-
-#. i18n: file: kcalc.kcfg:119
-#. i18n: ectx: label, entry (CalculatorMode), group (General)
-#: kcalc.cpp:209 rc.cpp:210 rc.cpp:1352
-msgid "Numeral System Mode"
-msgstr "نمط الأنظمة الرقمية"
-
-#: kcalc.cpp:212
-msgid "&Constants Buttons"
-msgstr "أزرار ال&ثوابت"
-
-#: kcalc.cpp:226
-msgid "Show B&it Edit"
-msgstr "أظهر تحرير ال&بت"
-
-#: kcalc.cpp:357
-msgctxt "Add display to memory"
-msgid "M+"
-msgstr "M+"
-
-#: kcalc.cpp:357
-msgid "Add display to memory"
-msgstr "إضافة المعروض إلى الذاكرة"
-
-#: kcalc.cpp:352
-msgctxt "Subtract from memory"
-msgid "M−"
-msgstr "M−"
-
-#: kcalc.cpp:358
-msgid "Subtract from memory"
-msgstr "طرح من الذاكرة"
-
-#: kcalc.cpp:674
-msgctxt "Third power"
-msgid "x<sup>3</sup>"
-msgstr "x<sup>3</sup>"
-
-#: kcalc.cpp:674
-msgid "Third power"
-msgstr "أس ثلاثة"
-
-#: kcalc.cpp:386
-msgid "Cube root"
-msgstr "جذر مكعب"
-
-#: kcalc.cpp:493
-msgctxt "Sine"
-msgid "Sin"
-msgstr "جيب"
-
-#. i18n: file: kcalc.ui:220
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbSin)
-#: kcalc.cpp:493 rc.cpp:321
-msgid "Sine"
-msgstr "جيب"
-
-#: kcalc.cpp:494
-msgctxt "Arc sine"
-msgid "Asin"
-msgstr "Asin"
-
-#: kcalc.cpp:494
-msgid "Arc sine"
-msgstr "قوس الجيب"
-
-#: kcalc.cpp:495
-msgctxt "Hyperbolic sine"
-msgid "Sinh"
-msgstr "Sinh"
-
-#: kcalc.cpp:495
-msgid "Hyperbolic sine"
-msgstr "الجيب الزائد"
-
-#: kcalc.cpp:497
-msgctxt "Inverse hyperbolic sine"
-msgid "Asinh"
-msgstr "Asinh"
-
-#: kcalc.cpp:497
-msgid "Inverse hyperbolic sine"
-msgstr "الجيب الزائد العكسي"
-
-#: kcalc.cpp:504
-msgctxt "Cosine"
-msgid "Cos"
-msgstr "Cos"
-
-#. i18n: file: kcalc.ui:286
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbCos)
-#: kcalc.cpp:504 rc.cpp:361
-msgid "Cosine"
-msgstr "جيب التمام"
-
-#: kcalc.cpp:505
-msgctxt "Arc cosine"
-msgid "Acos"
-msgstr "Acos"
-
-#: kcalc.cpp:505
-msgid "Arc cosine"
-msgstr "قوس جيب التمام"
-
-#: kcalc.cpp:506
-msgctxt "Hyperbolic cosine"
-msgid "Cosh"
-msgstr "Cosh"
-
-#: kcalc.cpp:506
-msgid "Hyperbolic cosine"
-msgstr "جيب التمام الزائد"
-
-#: kcalc.cpp:508
-msgctxt "Inverse hyperbolic cosine"
-msgid "Acosh"
-msgstr "Acosh"
-
-#: kcalc.cpp:508
-msgid "Inverse hyperbolic cosine"
-msgstr "جيب التمام الزائد العكسي"
-
-#: kcalc.cpp:515
-msgctxt "Tangent"
-msgid "Tan"
-msgstr "Tan"
-
-#. i18n: file: kcalc.ui:349
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbTan)
-#: kcalc.cpp:515 rc.cpp:398
-msgid "Tangent"
-msgstr "الظل"
-
-#: kcalc.cpp:516
-msgctxt "Arc tangent"
-msgid "Atan"
-msgstr "Atan"
-
-#: kcalc.cpp:516
-msgid "Arc tangent"
-msgstr "قوس الظل"
-
-#: kcalc.cpp:517
-msgctxt "Hyperbolic tangent"
-msgid "Tanh"
-msgstr "Tanh"
-
-#: kcalc.cpp:517
-msgid "Hyperbolic tangent"
-msgstr "الظل الزائد"
-
-#: kcalc.cpp:519
-msgctxt "Inverse hyperbolic tangent"
-msgid "Atanh"
-msgstr "Atanh"
-
-#: kcalc.cpp:519
-msgid "Inverse hyperbolic tangent"
-msgstr "الظل الزائد العكسي"
-
-#: kcalc.cpp:526
-msgctxt "Logarithm to base 10"
-msgid "Log"
-msgstr "Log"
-
-#. i18n: file: kcalc.ui:415
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbLog)
-#: kcalc.cpp:526 rc.cpp:438
-msgid "Logarithm to base 10"
-msgstr "لوغاريتم إلى الأساس 10"
-
-#: kcalc.cpp:527
-msgctxt "10 to the power of x"
-msgid "10<sup>x</sup>"
-msgstr "10<sup>x</sup>"
-
-#: kcalc.cpp:527
-msgid "10 to the power of x"
-msgstr "10 أس س"
-
-#: kcalc.cpp:533
-msgctxt "Natural log"
-msgid "Ln"
-msgstr "Ln"
-
-#. i18n: file: kcalc.ui:478
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbLn)
-#: kcalc.cpp:533 rc.cpp:475
-msgid "Natural log"
-msgstr "اللوغاريتم الطبيعي"
-
-#: kcalc.cpp:534
-msgctxt "Exponential function"
-msgid "e<sup>x</sup>"
-msgstr "e<sup>x</sup>"
-
-#: kcalc.cpp:534
-msgid "Exponential function"
-msgstr "الدالة الأسية"
-
-#: kcalc.cpp:550
-msgctxt "Number of data entered"
-msgid "N"
-msgstr "N"
-
-#. i18n: file: kcalc.ui:144
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbNData)
-#: kcalc.cpp:550 rc.cpp:278
-msgid "Number of data entered"
-msgstr "عدد المعلومات المدخلة"
-
-#: kcalc.cpp:552
-msgid "Sum of all data items"
-msgstr "مجموع كل العناصر البيانية"
-
-#: kcalc.cpp:559
-msgctxt "Mean"
-msgid "Mea"
-msgstr "Mea"
-
-#. i18n: file: kcalc.ui:210
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbMean)
-#: kcalc.cpp:559 rc.cpp:315
-msgid "Mean"
-msgstr "المعدَل"
-
-#: kcalc.cpp:562
-msgid "Sum of all data items squared"
-msgstr "مجموع كل العناصر البيانية مربعة"
-
-#. i18n: file: kcalc.ui:276
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbSd)
-#: kcalc.cpp:570 rc.cpp:355
-msgid "Standard deviation"
-msgstr "انحراف معياري"
-
-#: kcalc.cpp:572
-msgid "Sample standard deviation"
-msgstr "انحراف معياري عيّني"
-
-#: kcalc.cpp:583
-msgctxt "Enter data"
-msgid "Dat"
-msgstr "Dat"
-
-#. i18n: file: kcalc.ui:402
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbDat)
-#: kcalc.cpp:583 rc.cpp:429
-msgid "Enter data"
-msgstr "أدخل المعلومات"
-
-#: kcalc.cpp:584
-msgctxt "Delete last data item"
-msgid "CDat"
-msgstr "CDat"
-
-#: kcalc.cpp:584
-msgid "Delete last data item"
-msgstr "حذف العنصر البيانايات الأخير"
-
-#: kcalc.cpp:650
-msgctxt "Modulo"
-msgid "Mod"
-msgstr "Mod"
-
-#. i18n: file: kcalc.ui:180
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbMod)
-#: kcalc.cpp:650 rc.cpp:299
-msgid "Modulo"
-msgstr "مودولو- باقي القسمة"
-
-#: kcalc.cpp:651
-msgctxt "Integer division"
-msgid "IntDiv"
-msgstr "IntDiv"
-
-#: kcalc.cpp:651
-msgid "Integer division"
-msgstr "قسمة أعداد صحيحة"
-
-#: kcalc.cpp:659
-msgctxt "Reciprocal"
-msgid "1/x"
-msgstr "1/x"
-
-#. i18n: file: kcalc.ui:243
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbReci)
-#: kcalc.cpp:659 rc.cpp:336
-msgid "Reciprocal"
-msgstr "مقلوب"
-
-#: kcalc.cpp:660
-msgctxt "n Choose m"
-msgid "nCm"
-msgstr "nCm"
-
-#: kcalc.cpp:660
-msgid "n Choose m"
-msgstr "اختر من القائمة"
-
-#: kcalc.cpp:667
-msgctxt "Factorial"
-msgid "x!"
-msgstr "x!"
-
-#. i18n: file: kcalc.ui:309
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbFactorial)
-#: kcalc.cpp:667 rc.cpp:376
-msgid "Factorial"
-msgstr "مضروب"
-
-#: kcalc.cpp:673
-msgctxt "Square"
-msgid "x<sup>2</sup>"
-msgstr "x<sup>2</sup>"
-
-#. i18n: file: kcalc.ui:372
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbSquare)
-#: kcalc.cpp:673 rc.cpp:413
-msgid "Square"
-msgstr "مربع"
-
-#. i18n: file: kcalc.ui:552
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbRoot)
-#: kcalc.cpp:385 rc.cpp:509
-msgid "Square root"
-msgstr "جذر مربع"
-
-#: kcalc.cpp:683
-msgctxt "x to the power of y"
-msgid "x<sup>y</sup>"
-msgstr "x<sup>y</sup>"
-
-#. i18n: file: kcalc.ui:438
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbPower)
-#: kcalc.cpp:683 rc.cpp:453
-msgid "x to the power of y"
-msgstr "س للقوة ص"
-
-#: kcalc.cpp:684
-msgctxt "x to the power of 1/y"
-msgid "x<sup>1/y</sup>"
-msgstr "x<sup>1/y</sup>"
-
-#: kcalc.cpp:684
-msgid "x to the power of 1/y"
-msgstr "س أس 1/ص"
-
-#. i18n: file: kcalc.ui:501
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbEE)
-#: kcalc.cpp:693 rc.cpp:490
-msgid "Exponent"
-msgstr "القوَة"
-
-#: kcalc.cpp:890
-msgctxt "Second button functions are active"
-msgid "SHIFT"
-msgstr "SHIFT"
-
-#. i18n: file: kcalc.ui:827
-#. i18n: ectx: property (text), widget (KCalcButton, pbShift)
-#: kcalc.cpp:891 rc.cpp:628 rc.cpp:1201
-msgid "Shift"
-msgstr "Shift"
-
-#: kcalc.cpp:893
-msgctxt "Normal button functions are active"
-msgid "NORM"
-msgstr "NORM"
-
-#: kcalc.cpp:1011 kcalc.cpp:1012
-msgid "M"
-msgstr "M"
-
-#: kcalc.cpp:1420
-msgid "Last stat item erased"
-msgstr "أزيل آخر مواد الإحصاء"
-
-#: kcalc.cpp:1431
-msgid "Stat mem cleared"
-msgstr "مسح ذاكرة Stat"
-
-#. i18n: file: general.ui:13
-#. i18n: ectx: property (windowTitle), widget (QWidget, General)
-#: kcalc.cpp:1479 rc.cpp:69
-msgid "General"
-msgstr "عام"
-
-#: kcalc.cpp:1479
-msgid "General Settings"
-msgstr "الإعدادات العامة"
-
-#: kcalc.cpp:1484
-msgid "Font"
-msgstr "الخط"
-
-#: kcalc.cpp:1484
-msgid "Select Display Font"
-msgstr "اختر خط العرض"
-
-#: kcalc.cpp:1489
-msgid "Colors"
-msgstr "الألوان"
-
-#: kcalc.cpp:1489
-msgid "Button & Display Colors"
-msgstr "زر عرض الألوان"
-
-#. i18n: file: constants.ui:13
-#. i18n: ectx: property (windowTitle), widget (QWidget, Constants)
-#. i18n: file: constants.ui:19
-#. i18n: ectx: property (title), widget (QGroupBox, constantsBox)
-#: kcalc.cpp:1538 rc.cpp:33 rc.cpp:36
-msgid "Constants"
-msgstr "ثوابت"
-
-#: kcalc.cpp:1538
-msgid "Define Constants"
-msgstr "عرف الثوابت"
-
-#. i18n: file: kcalc.ui:14
-#. i18n: ectx: property (windowTitle), widget (QWidget, KCalculator)
-#: kcalc.cpp:1962 rc.cpp:239
-msgid "KCalc"
-msgstr "KCalc"
-
-#: kcalc.cpp:1966
-msgid ""
-"(c) 2000-2008, The KDE Team\n"
-"(c) 2003-2005, Klaus Niederkrüger\n"
-"(c) 1996-2000, Bernd Johannes Wuebben"
-msgstr ""
-"الحقوق محفوظة 2008-2000 (c) فريق كدي\n"
-"
الحقوق محفوظة 2005-2003 Klaus Niederkrüger \n"
-"الحقوق محفوظة 2000-1996 Bernd Johannes Wuebben"
-
-#: kcalc.cpp:1973
-msgid "Klaus Niederkrüger"
-msgstr "Klaus Niederkrüger"
-
-#: kcalc.cpp:1974
-msgid "Bernd Johannes Wuebben"
-msgstr "Bernd Johannes Wuebben"
-
-#: kcalc.cpp:1975
-msgid "Evan Teran"
-msgstr "Evan Teran"
-
-#: kcalc.cpp:1983
-msgid "Maintainer"
-msgstr "المشرف"
-
-#: kcalc.cpp:1976
-msgid "Espen Sand"
-msgstr "Espen Sand"
-
-#: kcalc.cpp:1977
-msgid "Chris Howells"
-msgstr "Chris Howells"
-
-#: kcalc.cpp:1978
-msgid "Aaron J. Seigo"
-msgstr "Aaron J. Seigo"
-
-#: kcalc.cpp:1979
-msgid "Charles Samuels"
-msgstr "Charles Samuels"
-
-#: kcalc.cpp:1981
-msgid "René Mérou"
-msgstr "René Mérou"
-
-#: kcalc.cpp:1982
-msgid "Michel Marti"
-msgstr "Michel Marti"
-
-#: kcalc.cpp:1983
-msgid "David Johnson"
-msgstr "David Johnson"
-
-#: kcalc_const_button.cpp:32 kcalc_const_button.cpp:44
-msgctxt "Write display data into memory"
-msgid "Store"
-msgstr "احفظ"
-
-#: kcalc_const_button.cpp:32 kcalc_const_button.cpp:44
-msgid "Write display data into memory"
-msgstr "اكتب البيانات المعروضة في الذاكرة"
-
-#: kcalc_const_button.cpp:76
-msgid "Set Name"
-msgstr "ضع الاسم"
-
-#: kcalc_const_button.cpp:79
-msgid "Choose From List"
-msgstr "اختر من القائمة"
-
-#: kcalc_const_button.cpp:92
-msgid "New Name for Constant"
-msgstr "اسم جديد للثابت"
-
-#: kcalc_const_button.cpp:92
-msgid "New name:"
-msgstr "الاسم الجديد:"
-
-#: kcalc_const_menu.cpp:91
-msgid "Mathematics"
-msgstr "الرياضيات"
-
-#: kcalc_const_menu.cpp:92
-msgid "Electromagnetism"
-msgstr "الكهرمغناطيسية"
-
-#: kcalc_const_menu.cpp:93
-msgid "Atomic && Nuclear"
-msgstr "فيزياء ذرية ونووية"
-
-#: kcalc_const_menu.cpp:94
-msgid "Thermodynamics"
-msgstr "الحركية الحرارية"
-
-#: kcalc_const_menu.cpp:95
-msgid "Gravitation"
-msgstr "الثقالة"
-
-#: rc.cpp:682
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr ""
-"عصام بايزيدي,ابراهيم الابراهيم,أحمد محمد زواوي,خالد حسني, فهد السعيدي, يونس "
-"بوطيور, ,Launchpad Contributions:,Ahmad M. Zawawi,Khaled Hosny,Youssef "
-"Chahibi,Zayed Amer Al-Saidi"
-
-#: rc.cpp:683
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr ""
-"bayazidi@arabeyes.org,,azawawi@emirates.net.ae,khaledhosny@eglug.org, "
-"Fahad.alsaidi@gmail.com, "
-"niceboy120@gmail.com,,,,khaledhosny@eglug.org,,zayed.alsaidi@gmail.com"
-
-#. i18n: file: kcalcui.rc:4
-#. i18n: ectx: Menu (settings)
-#: rc.cpp:681
-msgid "&Settings"
-msgstr "الإعدادات"
-
-#. i18n: file: colors.ui:16
-#. i18n: ectx: property (title), widget (QGroupBox, displayColorsBox)
-#: rc.cpp:3
-msgid "Display Colors"
-msgstr "اعرض بالألوان"
-
-#. i18n: file: colors.ui:24
-#. i18n: ectx: property (text), widget (QLabel, textLabel1)
-#: rc.cpp:6
-msgid "&Foreground:"
-msgstr "الواجهة الأ&مامية:"
-
-#. i18n: file: colors.ui:51
-#. i18n: ectx: property (text), widget (QLabel, textLabel2)
-#: rc.cpp:9
-msgid "&Background:"
-msgstr "ال&خلفية:"
-
-#. i18n: file: colors.ui:96
-#. i18n: ectx: property (title), widget (QGroupBox, buttonColorsBox)
-#: rc.cpp:12
-msgid "Button Colors"
-msgstr "زر الألوان"
-
-#. i18n: file: colors.ui:104
-#. i18n: ectx: property (text), widget (QLabel, textLabel3)
-#: rc.cpp:15
-msgid "&Functions:"
-msgstr "&دالات:"
-
-#. i18n: file: colors.ui:124
-#. i18n: ectx: property (text), widget (QLabel, textLabel4)
-#: rc.cpp:18
-msgid "St&atistic functions:"
-msgstr "الدَالات الإ&حصائية:"
-
-#. i18n: file: colors.ui:144
-#. i18n: ectx: property (text), widget (QLabel, textLabel5)
-#: rc.cpp:21
-msgid "He&xadecimals:"
-msgstr "&ستة عشري:"
-
-#. i18n: file: colors.ui:164
-#. i18n: ectx: property (text), widget (QLabel, textLabel6)
-#: rc.cpp:24
-msgid "&Numbers:"
-msgstr "أ&رقام:"
-
-#. i18n: file: colors.ui:184
-#. i18n: ectx: property (text), widget (QLabel, textLabel7)
-#: rc.cpp:27
-msgid "&Memory:"
-msgstr "ال&ذاكرة:"
-
-#. i18n: file: colors.ui:204
-#. i18n: ectx: property (text), widget (QLabel, textLabel8)
-#: rc.cpp:30
-msgid "O&perations:"
-msgstr "ال&عمليات:"
-
-#. i18n: file: constants.ui:39
-#. i18n: ectx: property (text), widget (QPushButton, pushButton0)
-#. i18n: file: constants.ui:60
-#. i18n: ectx: property (text), widget (QPushButton, pushButton1)
-#. i18n: file: constants.ui:81
-#. i18n: ectx: property (text), widget (QPushButton, pushButton2)
-#. i18n: file: constants.ui:102
-#. i18n: ectx: property (text), widget (QPushButton, pushButton3)
-#. i18n: file: constants.ui:123
-#. i18n: ectx: property (text), widget (QPushButton, pushButton4)
-#. i18n: file: constants.ui:144
-#. i18n: ectx: property (text), widget (QPushButton, pushButton5)
-#: rc.cpp:39 rc.cpp:42 rc.cpp:45 rc.cpp:48 rc.cpp:51 rc.cpp:54
-msgid "Predefined"
-msgstr "مسبق التعريف"
-
-#. i18n: file: fonts.ui:21
-#. i18n: ectx: property (text), widget (QLabel, buttonlabel)
-#: rc.cpp:57
-msgid "&Button font:"
-msgstr "&خط الزر:"
-
-#. i18n: file: fonts.ui:34
-#. i18n: ectx: property (toolTip), widget (KFontRequester, kcfg_ButtonFont)
-#: rc.cpp:60
-msgid "The font to use for the buttons"
-msgstr "الخط المستخدم في الأزرار."
-
-#. i18n: file: fonts.ui:41
-#. i18n: ectx: property (text), widget (QLabel, displaylabel)
-#: rc.cpp:63
-msgid "&Display font:"
-msgstr "خ&ط العرض:"
-
-#. i18n: file: fonts.ui:54
-#. i18n: ectx: property (toolTip), widget (KFontRequester, kcfg_DisplayFont)
-#: rc.cpp:66
-msgid "The font to use in the display"
-msgstr "الخط المستخدم في الشّاشة."
-
-#. i18n: file: general.ui:19
-#. i18n: ectx: property (title), widget (QGroupBox, precisionGroupBox)
-#: rc.cpp:72
-msgid "Precision"
-msgstr "الدقّة"
-
-#. i18n: file: general.ui:27
-#. i18n: ectx: property (text), widget (QLabel, textLabel1)
-#: rc.cpp:75
-msgid "&Maximum number of digits:"
-msgstr "الحد الأ&قصى للأرقام:"
-
-#. i18n: file: general.ui:40
-#. i18n: ectx: property (toolTip), widget (QSpinBox, kcfg_Precision)
-#: rc.cpp:78
-msgid "Maximum number of digits displayed"
-msgstr "الحد الأقصى للأرقام المعروضة."
-
-#. i18n: file: general.ui:43
-#. i18n: ectx: property (whatsThis), widget (QSpinBox, kcfg_Precision)
-#: rc.cpp:81
-msgid ""
-"KCalc can compute with many more digits than the number that fits on the "
-"display. This setting gives the maximum number of digits displayed, before "
-"KCalc starts using scientific notation, i.e. notation of the type 2.34e12."
-msgstr ""
-"يمكن ل ك حاسبة أن تحسب بأرقام أكبر من ما يطابقشاشة العرض. يحدد هذا الإعداد "
-"العدد القصوي للأرقامالمعروضة، قبل أن  تستعمل ك حاسبة كتابة علمية، يعني من "
-"نوع 2.34أ12."
-
-#. i18n: file: general.ui:50
-#. i18n: ectx: property (toolTip), widget (QCheckBox, kcfg_Fixed)
-#: rc.cpp:84
-msgid "Whether to use fixed decimal places"
-msgstr "لإستعمال خانات عشرية ثابته."
-
-#. i18n: file: general.ui:53
-#. i18n: ectx: property (text), widget (QCheckBox, kcfg_Fixed)
-#: rc.cpp:87
-msgid "Set &decimal precision"
-msgstr "ضبط الدقَة ال&عشرية"
-
-#. i18n: file: general.ui:63
-#. i18n: ectx: property (toolTip), widget (QSpinBox, kcfg_FixedPrecision)
-#: rc.cpp:90
-msgid "Number of fixed decimal digits"
-msgstr "عدد الأرقام العشرية الثابتة."
-
-#. i18n: file: general.ui:88
-#. i18n: ectx: property (title), widget (QGroupBox, groupBox)
-#: rc.cpp:93
-msgid "Numbers"
-msgstr "الأرقام"
-
-#. i18n: file: general.ui:94
-#. i18n: ectx: property (toolTip), widget (QCheckBox, kcfg_GroupDigits)
-#: rc.cpp:96
-msgid "Whether to group digits"
-msgstr "إذا تجمع الخانات أم لا"
-
-#. i18n: file: general.ui:97
-#. i18n: ectx: property (text), widget (QCheckBox, kcfg_GroupDigits)
-#: rc.cpp:99
-msgid "Group digits"
-msgstr "جمّع الأرقام"
-
-#. i18n: file: general.ui:107
-#. i18n: ectx: property (toolTip), widget (QCheckBox, kcfg_TwosComplement)
-#: rc.cpp:102
-msgid "Whether to use Two's Complement for non-decimal numbers"
-msgstr "استخدام المتمم الثنائي للأعداد غير العشرية"
-
-#. i18n: file: general.ui:110
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, kcfg_TwosComplement)
-#: rc.cpp:105
-msgid ""
-"Select to use Two's Complement notation for Binary, Octal and Hexidecimal "
-"numbers. This is a common notation to represent negative numbers for non-"
-"decimal numbers in computers."
-msgstr ""
-"اختر استخدام المتمم الثنائي للأرقام الثانئية و الثمانية و الستة عشر ، هذه "
-"طريقة عامة لعرض الأرقام السالبة للأرقام غير العشرية في الحواسيب."
-
-#. i18n: file: general.ui:113
-#. i18n: ectx: property (text), widget (QCheckBox, kcfg_TwosComplement)
-#: rc.cpp:108
-msgid "Two's complement"
-msgstr "المتمم الثنائي"
-
-#. i18n: file: general.ui:126
-#. i18n: ectx: property (title), widget (QGroupBox, miscGroupBox)
-#: rc.cpp:111
-msgid "Misc"
-msgstr "متفرقات"
-
-#. i18n: file: general.ui:132
-#. i18n: ectx: property (toolTip), widget (QCheckBox, kcfg_Beep)
-#: rc.cpp:114
-msgid "Whether to beep on error"
-msgstr "للتصفير عند الخطأ."
-
-#. i18n: file: general.ui:135
-#. i18n: ectx: property (text), widget (QCheckBox, kcfg_Beep)
-#: rc.cpp:117
-msgid "&Beep on error"
-msgstr "أ&حدث صفيرا عند حدوث خطأ"
-
-#. i18n: file: general.ui:145
-#. i18n: ectx: property (toolTip), widget (QCheckBox, kcfg_CaptionResult)
-#: rc.cpp:120
-msgid "Whether to show the result in the window title"
-msgstr "لإظهار النَتيجة في عنوان النَافذة."
-
-#. i18n: file: general.ui:148
-#. i18n: ectx: property (text), widget (QCheckBox, kcfg_CaptionResult)
-#: rc.cpp:123
-msgid "Show &result in window title"
-msgstr "أظهر ال&نتيجة على عنوان النافذة"
-
-#. i18n: file: kcalc.ui:35
-#. i18n: ectx: property (toolTip), widget (KCalcBitset, mBitset)
-#: rc.cpp:242
-msgid "Click on a Bit to toggle it."
-msgstr "انقر فوق البت لتثبيته"
-
-#. i18n: file: kcalc.ui:44
-#. i18n: ectx: property (text), widget (QRadioButton, degRadio)
-#: rc.cpp:245
-msgid "Deg"
-msgstr "درجة"
-
-#. i18n: file: kcalc.ui:51
-#. i18n: ectx: property (text), widget (QRadioButton, radRadio)
-#: rc.cpp:248
-msgid "Rad"
-msgstr "راديان"
-
-#. i18n: file: kcalc.ui:58
-#. i18n: ectx: property (text), widget (QRadioButton, gradRadio)
-#: rc.cpp:251
-msgid "Grad"
-msgstr "جراديان"
-
-#. i18n: file: kcalc.ui:78
-#. i18n: ectx: property (toolTip), widget (QRadioButton, hexRadio)
-#: rc.cpp:254
-msgid "Switch base to hexadecimal."
-msgstr "تحويل الأساس إلى. الست عشرى."
-
-#. i18n: file: kcalc.ui:81
-#. i18n: ectx: property (text), widget (QRadioButton, hexRadio)
-#: rc.cpp:257
-msgid "He&x"
-msgstr "&ست عشرى"
-
-#. i18n: file: kcalc.ui:88
-#. i18n: ectx: property (toolTip), widget (QRadioButton, decRadio)
-#: rc.cpp:260
-msgid "Switch base to decimal."
-msgstr "حوّل الأساس إلى العشري."
-
-#. i18n: file: kcalc.ui:91
-#. i18n: ectx: property (text), widget (QRadioButton, decRadio)
-#: rc.cpp:263
-msgid "&Dec"
-msgstr "&عشري"
-
-#. i18n: file: kcalc.ui:98
-#. i18n: ectx: property (toolTip), widget (QRadioButton, octRadio)
-#: rc.cpp:266
-msgid "Switch base to octal."
-msgstr "حوّل الأساس إلى الثماني."
-
-#. i18n: file: kcalc.ui:101
-#. i18n: ectx: property (text), widget (QRadioButton, octRadio)
-#: rc.cpp:269
-msgid "&Oct"
-msgstr "&ثماني"
-
-#. i18n: file: kcalc.ui:108
-#. i18n: ectx: property (toolTip), widget (QRadioButton, binRadio)
-#: rc.cpp:272
-msgid "Switch base to binary."
-msgstr "حوّل الأساس إلى ثنائى."
-
-#. i18n: file: kcalc.ui:111
-#. i18n: ectx: property (text), widget (QRadioButton, binRadio)
-#: rc.cpp:275
-msgid "&Bin"
-msgstr "ثنائي"
-
-#. i18n: file: kcalc.ui:147
-#. i18n: ectx: property (text), widget (KCalcButton, pbNData)
-#. i18n: file: kcalc.ui:484
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pbLn)
-#: rc.cpp:281 rc.cpp:481
-msgid "N"
-msgstr "N"
-
-#. i18n: file: kcalc.ui:154
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbHyp)
-#: rc.cpp:284
-msgid "Hyperbolic mode"
-msgstr "نمط الخيار الزائدي"
-
-#. i18n: file: kcalc.ui:157
-#. i18n: ectx: property (text), widget (KCalcButton, pbHyp)
-#: rc.cpp:287
-msgid "Hyp"
-msgstr "Hyp"
-
-#. i18n: file: kcalc.ui:160
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pbHyp)
-#: rc.cpp:290
-msgid "H"
-msgstr "H"
-
-#. i18n: file: kcalc.ui:170
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbAND)
-#: rc.cpp:293
-msgid "Bitwise AND"
-msgstr "عملية AND بت"
-
-#. i18n: file: kcalc.ui:173
-#. i18n: ectx: property (text), widget (KCalcButton, pbAND)
-#: rc.cpp:296
-msgid "AND"
-msgstr "AND"
-
-#. i18n: file: kcalc.ui:183
-#. i18n: ectx: property (text), widget (KCalcButton, pbMod)
-#: rc.cpp:302
-msgid "Mod"
-msgstr "موديلو- باقي القسمة"
-
-#. i18n: file: kcalc.ui:190
-#. i18n: ectx: property (text), widget (KCalcButton, pbA)
-#. i18n: file: kcalc.ui:193
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pbA)
-#: rc.cpp:305 rc.cpp:308
-msgid "A"
-msgstr "A"
-
-#. i18n: file: kcalc.ui:200
-#. i18n: ectx: property (text), widget (KCalcConstButton, pbC1)
-#: rc.cpp:311
-msgid "C1"
-msgstr "C1"
-
-#. i18n: file: kcalc.ui:213
-#. i18n: ectx: property (text), widget (KCalcButton, pbMean)
-#: rc.cpp:318
-msgid "Mea"
-msgstr "المعدَل"
-
-#. i18n: file: kcalc.ui:223
-#. i18n: ectx: property (text), widget (KCalcButton, pbSin)
-#: rc.cpp:324
-msgid "Sin"
-msgstr "الجيب"
-
-#. i18n: file: kcalc.ui:226
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pbSin)
-#: rc.cpp:327
-msgid "S"
-msgstr "S"
-
-#. i18n: file: kcalc.ui:233
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbOR)
-#: rc.cpp:330
-msgid "Bitwise OR"
-msgstr "عملية OR بت"
-
-#. i18n: file: kcalc.ui:236
-#. i18n: ectx: property (text), widget (KCalcButton, pbOR)
-#: rc.cpp:333
-msgid "OR"
-msgstr "OR"
-
-#. i18n: file: kcalc.ui:246
-#. i18n: ectx: property (text), widget (KCalcButton, pbReci)
-#: rc.cpp:339
-msgid "1/X"
-msgstr "1/X"
-
-#. i18n: file: kcalc.ui:249
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pbReci)
-#: rc.cpp:342
-msgid "R"
-msgstr "R"
-
-#. i18n: file: kcalc.ui:256
-#. i18n: ectx: property (text), widget (KCalcButton, pbB)
-#. i18n: file: kcalc.ui:259
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pbB)
-#: rc.cpp:345 rc.cpp:348
-msgid "B"
-msgstr "B"
-
-#. i18n: file: kcalc.ui:266
-#. i18n: ectx: property (text), widget (KCalcConstButton, pbC2)
-#: rc.cpp:351
-msgid "C2"
-msgstr "C2"
-
-#. i18n: file: kcalc.ui:279
-#. i18n: ectx: property (text), widget (KCalcButton, pbSd)
-#: rc.cpp:358
-msgid "SD"
-msgstr "SD"
-
-#. i18n: file: kcalc.ui:289
-#. i18n: ectx: property (text), widget (KCalcButton, pbCos)
-#: rc.cpp:364
-msgid "Cos"
-msgstr "جيب التمام"
-
-#. i18n: file: kcalc.ui:292
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pbCos)
-#. i18n: file: kcalc.ui:319
-#. i18n: ectx: property (text), widget (KCalcButton, pbC)
-#. i18n: file: kcalc.ui:322
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pbC)
-#. i18n: file: kcalc.ui:843
-#. i18n: ectx: property (text), widget (KCalcButton, pbClear)
-#: rc.cpp:367 rc.cpp:382 rc.cpp:385 rc.cpp:623
-msgid "C"
-msgstr "C"
-
-#. i18n: file: kcalc.ui:299
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbXOR)
-#: rc.cpp:370
-msgid "Bitwise XOR"
-msgstr "عملية XOR بت"
-
-#. i18n: file: kcalc.ui:302
-#. i18n: ectx: property (text), widget (KCalcButton, pbXOR)
-#: rc.cpp:373
-msgid "XOR"
-msgstr "XOR"
-
-#. i18n: file: kcalc.ui:312
-#. i18n: ectx: property (text), widget (KCalcButton, pbFactorial)
-#: rc.cpp:379
-msgid "x!"
-msgstr "x!"
-
-#. i18n: file: kcalc.ui:329
-#. i18n: ectx: property (text), widget (KCalcConstButton, pbC3)
-#: rc.cpp:388
-msgid "C3"
-msgstr "C3"
-
-#. i18n: file: kcalc.ui:339
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbMed)
-#: rc.cpp:392
-msgid "Median"
-msgstr "متوسط"
-
-#. i18n: file: kcalc.ui:342
-#. i18n: ectx: property (text), widget (KCalcButton, pbMed)
-#: rc.cpp:395
-msgid "Med"
-msgstr "متوسط"
-
-#. i18n: file: kcalc.ui:352
-#. i18n: ectx: property (text), widget (KCalcButton, pbTan)
-#: rc.cpp:401
-msgid "Tan"
-msgstr "الظل"
-
-#. i18n: file: kcalc.ui:355
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pbTan)
-#: rc.cpp:404
-msgid "T"
-msgstr "T"
-
-#. i18n: file: kcalc.ui:362
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbLsh)
-#: rc.cpp:407
-msgid "Left bit shift"
-msgstr "تحريك البت لليسار"
-
-#. i18n: file: kcalc.ui:365
-#. i18n: ectx: property (text), widget (KCalcButton, pbLsh)
-#: rc.cpp:410
-msgid "Lsh"
-msgstr "Lsh"
-
-#. i18n: file: kcalc.ui:375
-#. i18n: ectx: property (text), widget (KCalcButton, pbSquare)
-#: rc.cpp:416
-msgid "x2"
-msgstr "x2"
-
-#. i18n: file: kcalc.ui:382
-#. i18n: ectx: property (text), widget (KCalcButton, pbD)
-#. i18n: file: kcalc.ui:385
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pbD)
-#. i18n: file: kcalc.ui:408
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pbDat)
-#: rc.cpp:419 rc.cpp:422 rc.cpp:435
-msgid "D"
-msgstr "D"
-
-#. i18n: file: kcalc.ui:392
-#. i18n: ectx: property (text), widget (KCalcConstButton, pbC4)
-#: rc.cpp:425
-msgid "C4"
-msgstr "C4"
-
-#. i18n: file: kcalc.ui:405
-#. i18n: ectx: property (text), widget (KCalcButton, pbDat)
-#: rc.cpp:432
-msgid "Dat"
-msgstr "Dat"
-
-#. i18n: file: kcalc.ui:418
-#. i18n: ectx: property (text), widget (KCalcButton, pbLog)
-#: rc.cpp:441
-msgid "Log"
-msgstr "Log"
-
-#. i18n: file: kcalc.ui:421
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pbLog)
-#: rc.cpp:444
-msgid "L"
-msgstr "L"
-
-#. i18n: file: kcalc.ui:428
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbRsh)
-#: rc.cpp:447
-msgid "Right bit shift"
-msgstr "تحريك البت لليمين"
-
-#. i18n: file: kcalc.ui:431
-#. i18n: ectx: property (text), widget (KCalcButton, pbRsh)
-#: rc.cpp:450
-msgid "Rsh"
-msgstr "Rsh"
-
-#. i18n: file: kcalc.ui:441
-#. i18n: ectx: property (text), widget (KCalcButton, pbPower)
-#: rc.cpp:456
-msgid "pow"
-msgstr "pow"
-
-#. i18n: file: kcalc.ui:448
-#. i18n: ectx: property (text), widget (KCalcButton, pbE)
-#. i18n: file: kcalc.ui:451
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pbE)
-#. i18n: file: kcalc.ui:507
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pbEE)
-#: rc.cpp:459 rc.cpp:462 rc.cpp:496
-msgid "E"
-msgstr "E"
-
-#. i18n: file: kcalc.ui:458
-#. i18n: ectx: property (text), widget (KCalcConstButton, pbC5)
-#: rc.cpp:465
-msgid "C5"
-msgstr "C5"
-
-#. i18n: file: kcalc.ui:468
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbCSt)
-#: rc.cpp:469
-msgid "Clear data store"
-msgstr "امسح مخزن المعلومات"
-
-#. i18n: file: kcalc.ui:471
-#. i18n: ectx: property (text), widget (KCalcButton, pbCSt)
-#: rc.cpp:472
-msgid "CSt"
-msgstr "CSt"
-
-#. i18n: file: kcalc.ui:481
-#. i18n: ectx: property (text), widget (KCalcButton, pbLn)
-#: rc.cpp:478
-msgid "Ln"
-msgstr "Ln"
-
-#. i18n: file: kcalc.ui:491
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbCmp)
-#: rc.cpp:484
-msgid "One's complement"
-msgstr "مكمَل الواحد"
-
-#. i18n: file: kcalc.ui:494
-#. i18n: ectx: property (text), widget (KCalcButton, pbCmp)
-#: rc.cpp:487
-msgid "Cmp"
-msgstr "Cmp"
-
-#. i18n: file: kcalc.ui:504
-#. i18n: ectx: property (text), widget (KCalcButton, pbEE)
-#: rc.cpp:493
-msgid "EXP"
-msgstr "EXP"
-
-#. i18n: file: kcalc.ui:514
-#. i18n: ectx: property (text), widget (KCalcButton, pbF)
-#. i18n: file: kcalc.ui:517
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pbF)
-#: rc.cpp:499 rc.cpp:502
-msgid "F"
-msgstr "F"
-
-#. i18n: file: kcalc.ui:524
-#. i18n: ectx: property (text), widget (KCalcConstButton, pbC6)
-#: rc.cpp:505
-msgid "C6"
-msgstr "C6"
-
-#. i18n: file: kcalc.ui:552
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbCube)
-#: rc.cpp:523 rc.cpp:1096
-msgid "Cube"
-msgstr "جذر مكعب"
-
-#. i18n: file: kcalc.ui:555
-#. i18n: ectx: property (text), widget (KCalcButton, pbCube)
-#: rc.cpp:526 rc.cpp:1099
-msgid "x3"
-msgstr "x3"
-
-#. i18n: file: kcalc.ui:568
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbDivision)
-#: rc.cpp:515
-msgid "Division"
-msgstr "قسمة"
-
-#. i18n: file: kcalc.ui:571
-#. i18n: ectx: property (text), widget (KCalcButton, pbDivision)
-#: rc.cpp:532 rc.cpp:1105
-msgid "÷"
-msgstr "÷"
-
-#. i18n: file: kcalc.ui:584
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbMultiplication)
-#: rc.cpp:521
-msgid "Multiplication"
-msgstr "ضرب"
-
-#. i18n: file: kcalc.ui:587
-#. i18n: ectx: property (text), widget (KCalcButton, pbMultiplication)
-#: rc.cpp:538 rc.cpp:1111
-msgid "×"
-msgstr "×"
-
-#. i18n: file: kcalc.ui:600
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbMinus)
-#: rc.cpp:527
-msgid "Minus"
-msgstr "طرح"
-
-#. i18n: file: kcalc.ui:603
-#. i18n: ectx: property (text), widget (KCalcButton, pbMinus)
-#: rc.cpp:544 rc.cpp:1117
-msgctxt "- calculator button"
-msgid "−"
-msgstr "−"
-
-#. i18n: file: kcalc.ui:616
-#. i18n: ectx: property (text), widget (KCalcButton, pb7)
-#. i18n: file: kcalc.ui:619
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pb7)
-#: rc.cpp:533 rc.cpp:536
-msgid "7"
-msgstr "7"
-
-#. i18n: file: kcalc.ui:632
-#. i18n: ectx: property (text), widget (KCalcButton, pb8)
-#. i18n: file: kcalc.ui:635
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pb8)
-#: rc.cpp:539 rc.cpp:542
-msgid "8"
-msgstr "8"
-
-#. i18n: file: kcalc.ui:648
-#. i18n: ectx: property (text), widget (KCalcButton, pb9)
-#. i18n: file: kcalc.ui:651
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pb9)
-#: rc.cpp:545 rc.cpp:548
-msgid "9"
-msgstr "9"
-
-#. i18n: file: kcalc.ui:664
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbPlus)
-#: rc.cpp:551
-msgid "Plus"
-msgstr "جمع"
-
-#. i18n: file: kcalc.ui:667
-#. i18n: ectx: property (text), widget (KCalcButton, pbPlus)
-#: rc.cpp:554
-msgctxt "+ calculator button"
-msgid "+"
-msgstr "+"
-
-#. i18n: file: kcalc.ui:680
-#. i18n: ectx: property (text), widget (KCalcButton, pb4)
-#. i18n: file: kcalc.ui:683
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pb4)
-#: rc.cpp:557 rc.cpp:560
-msgid "4"
-msgstr "4"
-
-#. i18n: file: kcalc.ui:696
-#. i18n: ectx: property (text), widget (KCalcButton, pb5)
-#. i18n: file: kcalc.ui:699
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pb5)
-#: rc.cpp:563 rc.cpp:566
-msgid "5"
-msgstr "5"
-
-#. i18n: file: kcalc.ui:712
-#. i18n: ectx: property (text), widget (KCalcButton, pb6)
-#. i18n: file: kcalc.ui:715
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pb6)
-#: rc.cpp:569 rc.cpp:572
-msgid "6"
-msgstr "6"
-
-#. i18n: file: kcalc.ui:728
-#. i18n: ectx: property (text), widget (KCalcButton, pb1)
-#. i18n: file: kcalc.ui:731
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pb1)
-#: rc.cpp:575 rc.cpp:578
-msgid "1"
-msgstr "1"
-
-#. i18n: file: kcalc.ui:744
-#. i18n: ectx: property (text), widget (KCalcButton, pb2)
-#. i18n: file: kcalc.ui:747
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pb2)
-#: rc.cpp:581 rc.cpp:584
-msgid "2"
-msgstr "2"
-
-#. i18n: file: kcalc.ui:760
-#. i18n: ectx: property (text), widget (KCalcButton, pb3)
-#. i18n: file: kcalc.ui:763
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pb3)
-#: rc.cpp:587 rc.cpp:590
-msgid "3"
-msgstr "3"
-
-#. i18n: file: kcalc.ui:776
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbEqual)
-#: rc.cpp:593
-msgid "Result"
-msgstr "النتيجة"
-
-#. i18n: file: kcalc.ui:779
-#. i18n: ectx: property (text), widget (KCalcButton, pbEqual)
-#: rc.cpp:596
-msgctxt "= calculator button"
-msgid "="
-msgstr "="
-
-#. i18n: file: kcalc.ui:786
-#. i18n: ectx: property (text), widget (KCalcButton, pb0)
-#. i18n: file: kcalc.ui:789
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pb0)
-#: rc.cpp:599 rc.cpp:602
-msgid "0"
-msgstr "0"
-
-#. i18n: file: kcalc.ui:802
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbPeriod)
-#: rc.cpp:605
-msgid "Decimal point"
-msgstr "علامة عشرية"
-
-#. i18n: file: kcalc.ui:805
-#. i18n: ectx: property (text), widget (KCalcButton, pbPeriod)
-#: rc.cpp:608
-msgctxt ". calculator button"
-msgid "."
-msgstr "."
-
-#. i18n: file: kcalc.ui:824
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbShift)
-#: rc.cpp:625 rc.cpp:1198
-msgid "Second button function"
-msgstr "الوظيفة الثانية للزر"
-
-#. i18n: file: kcalc.ui:830
-#. i18n: ectx: property (shortcut), widget (KCalcButton, pbShift)
-#: rc.cpp:631 rc.cpp:1204
-msgid "Ctrl+2"
-msgstr "Ctrl+2"
-
-#. i18n: file: kcalc.ui:840
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbClear)
-#: rc.cpp:620
-msgid "Clear"
-msgstr "امسح"
-
-#. i18n: file: kcalc.ui:850
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbAllClear)
-#: rc.cpp:626
-msgid "Clear all"
-msgstr "أمسح الكل"
-
-#. i18n: file: kcalc.ui:853
-#. i18n: ectx: property (text), widget (KCalcButton, pbAllClear)
-#: rc.cpp:629
-msgid "AC"
-msgstr "AC"
-
-#. i18n: file: kcalc.ui:860
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbParenOpen)
-#: rc.cpp:632
-msgid "Open parenthesis"
-msgstr "قوس مفتوح"
-
-#. i18n: file: kcalc.ui:863
-#. i18n: ectx: property (text), widget (KCalcButton, pbParenOpen)
-#: rc.cpp:635
-msgctxt "( calculator button"
-msgid "("
-msgstr "("
-
-#. i18n: file: kcalc.ui:870
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbParenClose)
-#: rc.cpp:638
-msgid "Close parenthesis"
-msgstr "قوس مغلق"
-
-#. i18n: file: kcalc.ui:873
-#. i18n: ectx: property (text), widget (KCalcButton, pbParenClose)
-#: rc.cpp:641
-msgctxt ") calculator button"
-msgid ")"
-msgstr ")"
-
-#. i18n: file: kcalc.ui:880
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbMemRecall)
-#: rc.cpp:644
-msgid "Memory recall"
-msgstr "استرجاع الذاكرة"
-
-#. i18n: file: kcalc.ui:883
-#. i18n: ectx: property (text), widget (KCalcButton, pbMemRecall)
-#: rc.cpp:647
-msgid "MR"
-msgstr "MR"
-
-#. i18n: file: kcalc.ui:890
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbMemClear)
-#: rc.cpp:650
-msgid "Memory clear"
-msgstr "تفريغ الذاكرة"
-
-#. i18n: file: kcalc.ui:893
-#. i18n: ectx: property (text), widget (KCalcButton, pbMemClear)
-#: rc.cpp:653
-msgid "MC"
-msgstr "MC"
-
-#. i18n: file: kcalc.ui:900
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbMemPlusMinus)
-#: rc.cpp:656
-msgid "Add to memory"
-msgstr "الإضافة إلى الذاكرة"
-
-#. i18n: file: kcalc.ui:903
-#. i18n: ectx: property (text), widget (KCalcButton, pbMemPlusMinus)
-#: rc.cpp:659
-msgid "M+"
-msgstr "M+"
-
-#. i18n: file: kcalc.ui:910
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbMemStore)
-#: rc.cpp:662
-msgid "Memory store"
-msgstr "محفظ الذاكرة"
-
-#. i18n: file: kcalc.ui:913
-#. i18n: ectx: property (text), widget (KCalcButton, pbMemStore)
-#: rc.cpp:665
-msgid "MS"
-msgstr "MS"
-
-#. i18n: file: kcalc.ui:920
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbPercent)
-#: rc.cpp:668
-msgid "Percent"
-msgstr "مئوي"
-
-#. i18n: file: kcalc.ui:923
-#. i18n: ectx: property (text), widget (KCalcButton, pbPercent)
-#: rc.cpp:672
-#, no-c-format
-msgid "%"
-msgstr "%"
-
-#. i18n: file: kcalc.ui:930
-#. i18n: ectx: property (toolTip), widget (KCalcButton, pbPlusMinus)
-#: rc.cpp:675
-msgid "Change sign"
-msgstr "اعكس الإشارة"
-
-#. i18n: file: kcalc.ui:933
-#. i18n: ectx: property (text), widget (KCalcButton, pbPlusMinus)
-#: rc.cpp:692 rc.cpp:1265
-msgid "+/−"
-msgstr "+/−"
-
-#. i18n: file: kcalc.kcfg:13
-#. i18n: ectx: label, entry (ForeColor), group (Colors)
-#: rc.cpp:126
-msgid "The foreground color of the display."
-msgstr "لون الواجهة الأمامية للشاشة."
-
-#. i18n: file: kcalc.kcfg:19
-#. i18n: ectx: label, entry (BackColor), group (Colors)
-#: rc.cpp:129
-msgid "The background color of the display."
-msgstr "لون الخلفية للشاشة."
-
-#. i18n: file: kcalc.kcfg:24
-#. i18n: ectx: label, entry (NumberButtonsColor), group (Colors)
-#: rc.cpp:132
-msgid "The color of number buttons."
-msgstr "لون أزرار الأرقام."
-
-#. i18n: file: kcalc.kcfg:30
-#. i18n: ectx: label, entry (FunctionButtonsColor), group (Colors)
-#: rc.cpp:135
-msgid "The color of function buttons."
-msgstr "لون أزرار الدَالات."
-
-#. i18n: file: kcalc.kcfg:34
-#. i18n: ectx: label, entry (StatButtonsColor), group (Colors)
-#: rc.cpp:138
-msgid "The color of statistical buttons."
-msgstr "لون أزرار الإحصاءات"
-
-#. i18n: file: kcalc.kcfg:38
-#. i18n: ectx: label, entry (HexButtonsColor), group (Colors)
-#: rc.cpp:141
-msgid "The color of hex buttons."
-msgstr "لون أزرار الستة عشري"
-
-#. i18n: file: kcalc.kcfg:42
-#. i18n: ectx: label, entry (MemoryButtonsColor), group (Colors)
-#: rc.cpp:144
-msgid "The color of memory buttons."
-msgstr "لون أزرار الذاكرة"
-
-#. i18n: file: kcalc.kcfg:46
-#. i18n: ectx: label, entry (OperationButtonsColor), group (Colors)
-#: rc.cpp:147
-msgid "The color of operation buttons."
-msgstr "لون أزرار العمليات"
-
-#. i18n: file: kcalc.kcfg:52
-#. i18n: ectx: label, entry (ButtonFont), group (Font)
-#: rc.cpp:150
-msgid "The font to use for the buttons."
-msgstr "الخط المستخدم في الأزرار."
-
-#. i18n: file: kcalc.kcfg:56
-#. i18n: ectx: label, entry (DisplayFont), group (Font)
-#: rc.cpp:153
-msgid "The font to use in the display."
-msgstr "الخط المستخدم في الشّاشة."
-
-#. i18n: file: kcalc.kcfg:62
-#. i18n: ectx: label, entry (Precision), group (Precision)
-#: rc.cpp:156
-msgid "Maximum number of digits displayed."
-msgstr "الحد الأقصى للأرقام المعروضة"
-
-#. i18n: file: kcalc.kcfg:68
-#. i18n: ectx: whatsthis, entry (Precision), group (Precision)
-#: rc.cpp:159
-msgid ""
-"\n"
-"\tKCalc can compute with many more digits than the number that\n"
-"\tfits on the display. This setting gives the maximum number of\n"
-"\tdigits displayed, before KCalc starts using scientific notation,\n"
-"\ti.e. notation of the type 2.34e12.\n"
-"      "
-msgstr ""
-"\n"
-"\tيمكن ل ك حاسبة أن تحسب بأرقام أكبر من ما يطابق\n"
-"\tشاشة العرض. يحدد هذا الإعداد العدد القصوي للأرقام\n"
-"\tالمعروضة، قبل أن  تستعمل ك حاسبة كتابة علمية،\n"
-"\tيعني من نوع 2.34أ12.\n"
-"      "
-
-#. i18n: file: kcalc.kcfg:74
-#. i18n: ectx: label, entry (FixedPrecision), group (Precision)
-#: rc.cpp:167
-msgid "Number of fixed decimal digits."
-msgstr "عدد الأرقام العشرية الثابتة."
-
-#. i18n: file: kcalc.kcfg:78
-#. i18n: ectx: label, entry (Fixed), group (Precision)
-#: rc.cpp:170
-msgid "Whether to use fixed decimal places."
-msgstr "لإستعمال خانات عشرية ثابته."
-
-#. i18n: file: kcalc.kcfg:84
-#. i18n: ectx: label, entry (Beep), group (General)
-#: rc.cpp:173
-msgid "Whether to beep on error."
-msgstr "للتصفير عند الخطأ."
-
-#. i18n: file: kcalc.kcfg:88
-#. i18n: ectx: label, entry (CaptionResult), group (General)
-#: rc.cpp:176
-msgid "Whether to show the result in the window title."
-msgstr "لإظهار النَتيجة في عنوان النَافذة."
-
-#. i18n: file: kcalc.kcfg:92
-#. i18n: ectx: label, entry (GroupDigits), group (General)
-#: rc.cpp:179
-msgid "Whether to group digits."
-msgstr "لتجميع الأرقام"
-
-#. i18n: file: kcalc.kcfg:96
-#. i18n: ectx: label, entry (TwosComplement), group (General)
-#: rc.cpp:182
-msgid "Whether to use Two's Complement for non-decimal numbers."
-msgstr "إذا ما يجب استخدام المتمم الثنائي للأرقام غير العشرية."
-
-#. i18n: file: kcalc.kcfg:101
-#. i18n: ectx: whatsthis, entry (TwosComplement), group (General)
-#: rc.cpp:185
-msgid ""
-"\n"
-"        Select to use Two's Complement notation for Binary, Octal\n"
-"        and Hexidecimal numbers. This is a common notation to represent\n"
-"        negative numbers in computers.\n"
-"      "
-msgstr ""
-"\n"
-"        اختر استخدام المتمم الثنائي للأرقام الثنائية و الثمانية \n"
-"        و الستة عشر ، هذه طريقة عامة لعرض الأرقام السالبة\n"
-"         للأرقام غير العشرية في الحواسيب.\n"
-"      "
-
-#. i18n: file: kcalc.kcfg:107
-#. i18n: ectx: label, entry (CalculatorMode), group (General)
-#: rc.cpp:192 rc.cpp:1334
-msgid "Easy Calculator Mode"
-msgstr "نمط الحاسبة السهلة"
-
-#. i18n: file: kcalc.kcfg:108
-#. i18n: ectx: whatsthis, entry (CalculatorMode), group (General)
-#: rc.cpp:195 rc.cpp:1337
-msgid "A very simple mode where only the basic calculator buttons are shown"
-msgstr "نمط بسيط جدا حيث تعرض أزرار العمليات الحسابية الأساسية فقط"
-
-#. i18n: file: kcalc.kcfg:111
-#. i18n: ectx: label, entry (CalculatorMode), group (General)
-#: rc.cpp:198 rc.cpp:1340
-msgid "Science Calculator Mode"
-msgstr "نمط الحاسبة العلمية"
-
-#. i18n: file: kcalc.kcfg:112
-#. i18n: ectx: whatsthis, entry (CalculatorMode), group (General)
-#: rc.cpp:201 rc.cpp:1343
-msgid "Mode with science buttons and optional constants buttons"
-msgstr "نمط مع الأزرار العلمية و اختياريا أزرار الثوابت"
-
-#. i18n: file: kcalc.kcfg:115
-#. i18n: ectx: label, entry (CalculatorMode), group (General)
-#: rc.cpp:204 rc.cpp:1346
-msgid "Statistic Calculator Mode"
-msgstr "نمط الحاسبة الإحصائية"
-
-#. i18n: file: kcalc.kcfg:116
-#. i18n: ectx: whatsthis, entry (CalculatorMode), group (General)
-#: rc.cpp:207 rc.cpp:1349
-msgid ""
-"Mode with additional statistics buttons and optional constants buttons"
-msgstr "نمط بأزرار إحصائية إضافية و اختياريا أزرار الثوابت"
-
-#. i18n: file: kcalc.kcfg:120
-#. i18n: ectx: whatsthis, entry (CalculatorMode), group (General)
-#: rc.cpp:213 rc.cpp:1355
-msgid ""
-"Mode with logic buttons and selectable base. Optional bit edit available."
-msgstr ""
-"نمط بأزرار منطقية بالإعتماد على الإختيار ، و اختياريا يمكن تحرير البت."
-
-#. i18n: file: kcalc.kcfg:105
-#. i18n: ectx: label, entry (ShowBitset), group (General)
-#: rc.cpp:192
-msgid "Whether to show the bit edit widget."
-msgstr "إذا ما يجب إظهار ودجة تحرير البت"
-
-#. i18n: file: kcalc.kcfg:122
-#. i18n: ectx: label, entry (ShowConstants), group (General)
-#: rc.cpp:205
-msgid "Whether to show constant buttons."
-msgstr "لإظهار أزرار الأرقام الثَابته."
-
-#. i18n: file: kcalc.kcfg:126
-#. i18n: ectx: label, entry (AngleMode), group (General)
-#: rc.cpp:208
-msgid "Degrees, radians or grads"
-msgstr "الدرجات ، أو الراديان ، أو جراديان"
-
-#. i18n: file: kcalc.kcfg:130
-#. i18n: ectx: label, entry (BaseMode), group (General)
-#: rc.cpp:211
-msgid "Numeric base"
-msgstr "أساس رقمي"
-
-#. i18n: file: kcalc.kcfg:136
-#. i18n: ectx: label, entry (nameConstant$(ConstIndex)), group (UserConstants)
-#: rc.cpp:214
-msgid "Name of the user programmable constants."
-msgstr "اسم الثوابت التي يبرمجها المستخدم."
-
-#. i18n: file: kcalc.kcfg:155
-#. i18n: ectx: label, entry (valueConstant$(ConstIndex)), group (UserConstants)
-#: rc.cpp:217
-msgid "List of user programmable constants"
-msgstr "قائمة الثوابت التي يبرمجها المستخدم."
-
-#. i18n: file: kcalc.kcfg:146
-#: rc.cpp:225
-msgctxt "Name of the user programmable constant"
-msgid "C1"
-msgstr "C1"
-
-#. i18n: file: kcalc.kcfg:147
-#: rc.cpp:227
-msgctxt "Name of the user programmable constant"
-msgid "C2"
-msgstr "C2"
-
-#. i18n: file: kcalc.kcfg:148
-#: rc.cpp:229
-msgctxt "Name of the user programmable constant"
-msgid "C3"
-msgstr "C3"
-
-#. i18n: file: kcalc.kcfg:149
-#: rc.cpp:231
-msgctxt "Name of the user programmable constant"
-msgid "C4"
-msgstr "C4"
-
-#. i18n: file: kcalc.kcfg:150
-#: rc.cpp:233
-msgctxt "Name of the user programmable constant"
-msgid "C5"
-msgstr "C5"
-
-#. i18n: file: kcalc.kcfg:151
-#: rc.cpp:235
-msgctxt "Name of the user programmable constant"
-msgid "C6"
-msgstr "C6"
-
-#. i18n: tag constant attribute name
-#. i18n: file: scienceconstants.xml:3
-#: rc.cpp:686
-msgid "Pi"
-msgstr "Pi"
-
-#. i18n: tag constant attribute name
-#. i18n: file: scienceconstants.xml:7
-#: rc.cpp:689
-msgid "Euler Number"
-msgstr "عدد أولير"
-
-#. i18n: tag constant attribute name
-#. i18n: file: scienceconstants.xml:11
-#: rc.cpp:692
-msgid "Golden Ratio"
-msgstr "نسبة Golden"
-
-#. i18n: tag constant attribute name
-#. i18n: file: scienceconstants.xml:15
-#: rc.cpp:695
-msgid "Light Speed"
-msgstr "سرعة الضوء"
-
-#. i18n: tag constant attribute name
-#. i18n: file: scienceconstants.xml:19
-#: rc.cpp:698
-msgid "Planck's Constant"
-msgstr "ثابثة Planck"
-
-#. i18n: tag constant attribute name
-#. i18n: file: scienceconstants.xml:23
-#: rc.cpp:701
-msgid "Gravitational Constant"
-msgstr "ثابت الجاذبية"
-
-#. i18n: tag constant attribute name
-#. i18n: file: scienceconstants.xml:27
-#: rc.cpp:704
-msgid "Earth Acceleration"
-msgstr "تسارع الأرض"
-
-#. i18n: tag constant attribute name
-#. i18n: file: scienceconstants.xml:31
-#. i18n: tag constant attribute name
-#. i18n: file: scienceconstants.xml:35
-#: rc.cpp:707 rc.cpp:710
-msgid "Elementary Charge"
-msgstr "الشحنة الإبتدائية"
-
-#. i18n: tag constant attribute name
-#. i18n: file: scienceconstants.xml:39
-#: rc.cpp:713
-msgid "Impedance of Vacuum"
-msgstr "المعاوقة الكهربائية ل Vacuum"
-
-#. i18n: tag constant attribute name
-#. i18n: file: scienceconstants.xml:43
-#: rc.cpp:716
-msgid "Fine-Structure Constant"
-msgstr "ثابتة التشكيلة الدقيقة (Fine-Structure)"
-
-#. i18n: tag constant attribute name
-#. i18n: file: scienceconstants.xml:48
-#: rc.cpp:719
-msgid "Permeability of Vacuum"
-msgstr "نفاذية Vacuum"
-
-#. i18n: tag constant attribute name
-#. i18n: file: scienceconstants.xml:52
-#: rc.cpp:722
-msgid "Permittivity of Vacuum"
-msgstr "تبادلية vacuum"
-
-#. i18n: tag constant attribute name
-#. i18n: file: scienceconstants.xml:56
-#: rc.cpp:725
-msgid "Boltzmann Constant"
-msgstr "ثابثة Boltzmann"
-
-#. i18n: tag constant attribute name
-#. i18n: file: scienceconstants.xml:61
-#: rc.cpp:728
-msgid "Atomic Mass Unit"
-msgstr "وحدة كتلة الذرة"
-
-#. i18n: tag constant attribute name
-#. i18n: file: scienceconstants.xml:65
-#: rc.cpp:731
-msgid "Molar Gas Constant"
-msgstr "ثابثة المول للغاز"
-
-#. i18n: tag constant attribute name
-#. i18n: file: scienceconstants.xml:69
-#: rc.cpp:734
-msgid "Stefan-Boltzmann Constant"
-msgstr "ثابثة Stefan-Boltzmann"
-
-#. i18n: tag constant attribute name
-#. i18n: file: scienceconstants.xml:73
-#: rc.cpp:737
-msgid "Avogadro's Number"
-msgstr "عدد أفوكادرو"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcertpart.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcertpart.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcertpart.po	2012-02-23 06:20:15.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcertpart.po	2012-03-23 06:41:46.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 22:43+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:07+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: rc.cpp:4
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcharselect.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcharselect.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcharselect.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcharselect.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,151 +0,0 @@
-# translation of kcharselect.po to
-# Copyright (C) 2002, 2004, 2006, 2007 Free Software Foundation, Inc.
-# Mohammed Gamal <f2c2001@yahoo.com>, 2002.
-# Ahmad M. Zawawi <azawawi@emirates.net.ae>, 2004.
-# Khaled Hosny <dr.khaled.hosny@gmail.com>, 2006.
-# Fahad Al-Saidi <fahad.alsaidi@gmail.com>, 2007.
-# Youssef Chahibi <chahibi@gmail.com>, 2007.
-# Youness BOUTYOUR <niceboy@linuxac.org>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-#
-msgid ""
-msgstr ""
-"Project-Id-Version: kcharselect\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 13:31+0000\n"
-"PO-Revision-Date: 2012-01-25 11:07+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:06+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"Language: ar\n"
-
-#: kcharselectdia.cc:79 kcharselectdia.cc:89
-msgid "&To Clipboard"
-msgstr "إلى ال&حافظة"
-
-#: kcharselectdia.cc:95
-msgid "To Clipboard &UTF-8"
-msgstr "إلى الحافظة &UTF-8"
-
-#: kcharselectdia.cc:98
-msgid "To Clipboard &HTML"
-msgstr "إلى الحافظة &HTML"
-
-#: kcharselectdia.cc:102
-msgid "&From Clipboard"
-msgstr "&من الحافظة"
-
-#: kcharselectdia.cc:107
-msgid "From Clipboard UTF-8"
-msgstr "من الحافظة UTF-8"
-
-#: kcharselectdia.cc:110
-msgid "From Clipboard HTML"
-msgstr "من الحافظة HTML"
-
-#: kcharselectdia.cc:113
-msgid "&Flip Text"
-msgstr "قلب النص"
-
-#: kcharselectdia.cc:116
-msgid "&Reverse Direction"
-msgstr "ا&عكس الإتجاه"
-
-#: main.cc:25
-msgid "KDE character selection utility"
-msgstr "أداة كدى لاختيار الرموز"
-
-#: main.cc:26
-msgid "A wrapper around the KCharSelect widget."
-msgstr "إزار حول القطعة KCharSelect"
-
-#: main.cc:32
-msgid "KCharSelect"
-msgstr "KCharSelect"
-
-#: main.cc:36 main.cc:39
-msgid "Daniel Laidig"
-msgstr "Daniel Laidig"
-
-#: main.cc:36
-msgid "Author and maintainer"
-msgstr "المؤلف والمشرف"
-
-#: main.cc:37
-msgid "Reginald Stadlbauer"
-msgstr "Reginald Stadlbauer"
-
-#: main.cc:37
-msgid "Author"
-msgstr "المؤلف"
-
-#: main.cc:39
-msgid ""
-"New GUI, Unicode information, incremental search, and general improvements"
-msgstr "واجهة رسومية جديدة و معلومات ب Unicode وبحث تصاعدي ، و تحسينات عامة"
-
-#: main.cc:41
-msgid "Constantin Berzan"
-msgstr "ثابثة Berzan"
-
-#: main.cc:41
-msgid "Previous maintainer"
-msgstr "المشرف السابق"
-
-#: main.cc:42
-msgid "Nadeem Hasan"
-msgstr "Nadeem Hasan"
-
-#: main.cc:42 main.cc:44
-msgid "GUI cleanup and fixes"
-msgstr "تنظيف و تصليحات الواجهة الرسومية"
-
-#: main.cc:44
-msgid "Ryan Cumming"
-msgstr "Ryan Cumming"
-
-#: main.cc:46
-msgid "Benjamin C. Meyer"
-msgstr "Benjamin C. Meyer"
-
-#: main.cc:46
-msgid "XMLUI conversion"
-msgstr "تحويل XMLUI"
-
-#: main.cc:48
-msgid "Bryce Nesbitt"
-msgstr "Bryce Nesbitt"
-
-#: main.cc:48
-msgid "RTL support"
-msgstr "دعم RTL"
-
-#: rc.cpp:7
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr ""
-"محمد جمال, محمد عَصَر, خالد حسنى , فهد السعيدي, يونس بوطيور, ,Launchpad "
-"Contributions:,Khaled Hosny,Youssef Chahibi"
-
-#: rc.cpp:8
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr ""
-"f2c2001@yahoo.com, aser@arabeyes.org, dr.khaled.hosny@gmail.com, "
-"Fahad.alsaidi@gmail.com, niceboy120@gmail.com,,,khaledhosny@eglug.org,"
-
-#. i18n: file: kcharselectui.rc:4
-#. i18n: ectx: Menu (edit)
-#: rc.cpp:3 rc.cpp:11
-msgid "&Edit"
-msgstr "&حرر"
-
-#. i18n: file: kcharselectui.rc:16
-#. i18n: ectx: ToolBar (mainToolBar)
-#: rc.cpp:6 rc.cpp:14
-msgid "Main Toolbar"
-msgstr "شريط الأدوات الرئيسي"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmaccess.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmaccess.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmaccess.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmaccess.po	2012-03-23 06:42:02.000000000 +0000
@@ -15,16 +15,15 @@
 "Project-Id-Version: kcmaccess\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2011-12-12 19:21+0000\n"
+"PO-Revision-Date: 2012-03-14 17:08+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:32+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:50+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kcmaccess.cpp:195
 msgid "AltGraph"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_akonadicontact_actions.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_akonadicontact_actions.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_akonadicontact_actions.po	2012-02-23 06:20:16.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_akonadicontact_actions.po	2012-03-23 06:41:47.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:01+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:17+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: kcmakonadicontactactions.cpp:42
 msgid "kcmakonadicontactactions"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_akonadi.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_akonadi.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_akonadi.po	2012-02-23 06:20:23.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_akonadi.po	2012-03-23 06:41:54.000000000 +0000
@@ -15,8 +15,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 01:33+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:56+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #. i18n: file: resourcesmanagementwidget.ui:36
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_attica.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_attica.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_attica.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_attica.po	2012-03-23 06:41:57.000000000 +0000
@@ -13,9 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:36+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:43+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: atticamodule.cpp:46
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmaudiocd.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmaudiocd.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmaudiocd.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmaudiocd.po	2012-03-23 06:41:39.000000000 +0000
@@ -13,14 +13,14 @@
 "Project-Id-Version: kcmaudiocd\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:45+0000\n"
-"PO-Revision-Date: 2011-12-12 19:13+0000\n"
+"PO-Revision-Date: 2012-03-14 17:37+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:00+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:56+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kcmaudiocd.cpp:65
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_autostart.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_autostart.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_autostart.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_autostart.po	2012-03-23 06:42:02.000000000 +0000
@@ -5,19 +5,20 @@
 #
 # محمد ابراهيم الحرقان <malham1@hotmail.com>, 2008.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kcm_autostart\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2011-01-06 04:35+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-12 22:26+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:23+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:45+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: addscriptdialog.cpp:36
@@ -61,7 +62,7 @@
 
 #: autostart.cpp:76
 msgid "Copyright © 2006–2010 Autostart Manager team"
-msgstr ""
+msgstr "(c) 2006-2010 فريق مدير بدء التشغيل التلقائي"
 
 #: autostart.cpp:77
 msgid "Stephen Leaf"
@@ -108,17 +109,19 @@
 #: autostart.cpp:390
 msgid ""
 "Only files with “.sh” extensions are allowed for setting up the environment."
-msgstr ""
+msgstr "يُسمح فقط للملفات ذات الامتداد \".sh\" بضبط البيئة."
 
 #: rc.cpp:16
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
-msgstr "زايد السعيدي, ,Launchpad Contributions:,Zayed Amer Al-Saidi"
+msgstr ""
+"زايد السعيدي, ,Launchpad Contributions:,Abdalrahim G. Fakhouri,Zayed Amer Al-"
+"Saidi"
 
 #: rc.cpp:17
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "zayed.alsaidi@gmail.com,,,zayed.alsaidi@gmail.com"
+msgstr "zayed.alsaidi@gmail.com,,,,zayed.alsaidi@gmail.com"
 
 #. i18n: file: autostartconfig.ui:26
 #. i18n: ectx: property (text), widget (QPushButton, btnAddProgram)
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmbackground.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmbackground.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmbackground.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmbackground.po	2012-03-23 06:42:02.000000000 +0000
@@ -10,12 +10,13 @@
 # AbdulAziz AlSharif <a.a-a.s@hotmail.com>, 2007.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kcmbackground\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-26 11:49+0000\n"
+"PO-Revision-Date: 2012-03-14 17:16+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
@@ -23,10 +24,9 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:32+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:51+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: bgadvanced.cpp:53
 msgid "Advanced Background Settings"
@@ -305,8 +305,12 @@
 #: bgwallpaper.cpp:116
 msgid " minute"
 msgid_plural " minutes"
-msgstr[0] ""
-msgstr[1] ""
+msgstr[0] " لا شيء"
+msgstr[1] " دقيقة واحدة"
+msgstr[2] " دقيقتان"
+msgstr[3] " دقائق"
+msgstr[4] " دقيقة"
+msgstr[5] " دقيقة"
 
 #: bgwallpaper.cpp:164
 msgid "Select Image"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmbell.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmbell.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmbell.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmbell.po	2012-03-23 06:42:02.000000000 +0000
@@ -15,16 +15,15 @@
 "Project-Id-Version: kcmbell\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2011-12-12 19:30+0000\n"
+"PO-Revision-Date: 2012-03-14 17:07+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:33+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:51+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: bell.cpp:83
 msgid "Bell Settings"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmcddb.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmcddb.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmcddb.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmcddb.po	2012-03-23 06:41:39.000000000 +0000
@@ -18,8 +18,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:01+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:56+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: cddbconfigwidget.cpp:52
 msgid "Cache Locations"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmcgi.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmcgi.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmcgi.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmcgi.po	2012-03-23 06:41:57.000000000 +0000
@@ -11,16 +11,15 @@
 "Project-Id-Version: kcmcgi\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2011-12-12 19:52+0000\n"
+"PO-Revision-Date: 2012-03-14 17:31+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:40+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:46+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kcmcgi.cpp:47
 msgid "Paths to Local CGI Programs"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmcolors.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmcolors.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmcolors.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmcolors.po	2012-03-23 06:42:02.000000000 +0000
@@ -2,6 +2,7 @@
 # translation of kcmcolors.po to
 # Color Management
 # Copyright (C) 2001,2002, 2004, 2006, 2007, 2008 Free Software Foundation, Inc.
+#
 # Mohamed Eldesoky <mohamed@handasarabia.org>, 2001.
 # Isam Bayazidi <bayazidi@arabeyes.org>, 2002.
 # Ossama Khayat <okhayat@yahoo.com>, 2004.
@@ -11,22 +12,22 @@
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # Amine Roukh <amineroukh@gmail.com>, 2008.
 # zayed <zayed.alsaidi@gmail.com>, 2008, 2010. , 2010.
-#
+# Hajur Alasefer <frostbutterfly@gmail.com>, 2012.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kcmcolors\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:12+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-14 17:12+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:34+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:52+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #. i18n: file: colorsettings.ui:267
 #. i18n: ectx: attribute (title), widget (QWidget, pageColors)
@@ -93,7 +94,7 @@
 
 #: colorscm.cpp:341
 msgid "Notice"
-msgstr ""
+msgstr "إشعار"
 
 #: colorscm.cpp:411
 msgid "Please save the color scheme before uploading it."
@@ -227,13 +228,13 @@
 #. i18n: ectx: property (toolTip), widget (KPushButton, schemeKnsUploadButton)
 #: rc.cpp:12 rc.cpp:620
 msgid "Share the selected scheme on the Internet"
-msgstr ""
+msgstr "انشر  مخطط الألوان المحدد على الإنترنت"
 
 #. i18n: file: colorsettings.ui:64
 #. i18n: ectx: property (text), widget (KPushButton, schemeKnsUploadButton)
 #: rc.cpp:15 rc.cpp:623
 msgid "&Upload Scheme..."
-msgstr ""
+msgstr "&ارفعال مخطوطة اللونية..."
 
 #. i18n: file: colorsettings.ui:71
 #. i18n: ectx: property (toolTip), widget (KPushButton, schemeImportButton)
@@ -332,7 +333,7 @@
 #. i18n: ectx: property (title), widget (QGroupBox, groupBox_5)
 #: rc.cpp:57 rc.cpp:665
 msgid "Shading"
-msgstr ""
+msgstr "ظلّل"
 
 #. i18n: file: colorsettings.ui:203
 #. i18n: ectx: property (text), widget (QLabel, label_9)
@@ -356,7 +357,7 @@
 #. i18n: ectx: property (text), widget (QLabel, label_7)
 #: rc.cpp:72 rc.cpp:680
 msgid "Color set:"
-msgstr ""
+msgstr "طقم ألوان:"
 
 #. i18n: file: colorsettings.ui:292
 #. i18n: ectx: property (toolTip), widget (QComboBox, colorSet)
@@ -369,42 +370,42 @@
 #: rc.cpp:78 rc.cpp:686
 msgctxt "color-sets"
 msgid "Common Colors"
-msgstr ""
+msgstr "ألوان الشائعة"
 
 #. i18n: file: colorsettings.ui:301
 #. i18n: ectx: property (text), item, widget (QComboBox, colorSet)
 #: rc.cpp:81 rc.cpp:689
 msgctxt "color-sets"
 msgid "View"
-msgstr ""
+msgstr "العرض"
 
 #. i18n: file: colorsettings.ui:306
 #. i18n: ectx: property (text), item, widget (QComboBox, colorSet)
 #: rc.cpp:84 rc.cpp:692
 msgctxt "color-sets"
 msgid "Window"
-msgstr ""
+msgstr "ال&نافذة"
 
 #. i18n: file: colorsettings.ui:311
 #. i18n: ectx: property (text), item, widget (QComboBox, colorSet)
 #: rc.cpp:87 rc.cpp:695
 msgctxt "color-sets"
 msgid "Button"
-msgstr ""
+msgstr "الزر"
 
 #. i18n: file: colorsettings.ui:316
 #. i18n: ectx: property (text), item, widget (QComboBox, colorSet)
 #: rc.cpp:90 rc.cpp:698
 msgctxt "color-sets"
 msgid "Selection"
-msgstr ""
+msgstr "التحديد"
 
 #. i18n: file: colorsettings.ui:321
 #. i18n: ectx: property (text), item, widget (QComboBox, colorSet)
 #: rc.cpp:93 rc.cpp:701
 msgctxt "color-sets"
 msgid "Tooltip"
-msgstr ""
+msgstr "تلميحة"
 
 #. i18n: file: colorsettings.ui:355
 #. i18n: ectx: property (text), widget (QTableWidget, commonColorTable)
@@ -607,7 +608,7 @@
 #. i18n: ectx: property (text), item, widget (QTableWidget, commonColorTable)
 #: rc.cpp:254
 msgid "Active Titlebar Secondary"
-msgstr ""
+msgstr "نص شريط العنوان النشط ثانوي"
 
 #. i18n: file: colorsettings.ui:595
 #. i18n: ectx: property (text), item, widget (QTableWidget, commonColorTable)
@@ -625,14 +626,14 @@
 #. i18n: ectx: property (text), item, widget (QTableWidget, commonColorTable)
 #: rc.cpp:263
 msgid "Inactive Titlebar Secondary"
-msgstr ""
+msgstr "نص شريط العنوان الخامل ثانوي"
 
 #. i18n: file: colorsettings.ui:715
 #. i18n: ectx: attribute (title), widget (QWidget, pageInactice)
 #: rc.cpp:249 rc.cpp:857
 msgctxt "@title:tab color transformations on inactive elements"
 msgid "Inactive"
-msgstr ""
+msgstr "خامل"
 
 #. i18n: file: colorsettings.ui:721
 #. i18n: ectx: property (text), widget (QLabel, label)
@@ -657,7 +658,7 @@
 #: rc.cpp:258 rc.cpp:866
 msgctxt "no inactive intensity effect"
 msgid "None"
-msgstr ""
+msgstr "بدون"
 
 #. i18n: file: colorsettings.ui:740
 #. i18n: ectx: property (text), item, widget (QComboBox, inactiveIntensityBox)
@@ -724,7 +725,7 @@
 #: rc.cpp:279 rc.cpp:887
 msgctxt "no inactive color effect"
 msgid "None"
-msgstr ""
+msgstr "بدون"
 
 #. i18n: file: colorsettings.ui:812
 #. i18n: ectx: property (text), item, widget (QComboBox, inactiveColorBox)
@@ -815,7 +816,7 @@
 #: rc.cpp:303 rc.cpp:911
 msgctxt "no inactive contrast effect"
 msgid "None"
-msgstr ""
+msgstr "بدون"
 
 #. i18n: file: colorsettings.ui:894
 #. i18n: ectx: property (toolTip), widget (QSlider, inactiveContrastSlider)
@@ -828,7 +829,7 @@
 #: rc.cpp:318 rc.cpp:926
 msgctxt "@title:tab color transformations on disabled elements"
 msgid "Disabled"
-msgstr ""
+msgstr "معطل"
 
 #. i18n: file: colorsettings.ui:981
 #. i18n: ectx: property (toolTip), widget (QComboBox, disabledIntensityBox)
@@ -841,7 +842,7 @@
 #: rc.cpp:327 rc.cpp:935
 msgctxt "no disabled intensity effect"
 msgid "None"
-msgstr ""
+msgstr "بدون"
 
 #. i18n: file: colorsettings.ui:1011
 #. i18n: ectx: property (toolTip), widget (QSlider, disabledIntensitySlider)
@@ -860,7 +861,7 @@
 #: rc.cpp:348 rc.cpp:956
 msgctxt "no disabled color effect"
 msgid "None"
-msgstr ""
+msgstr "بدون"
 
 #. i18n: file: colorsettings.ui:1083
 #. i18n: ectx: property (toolTip), widget (QSlider, disabledColorSlider)
@@ -885,7 +886,7 @@
 #: rc.cpp:372 rc.cpp:980
 msgctxt "no disabled contrast"
 msgid "None"
-msgstr ""
+msgstr "بدون"
 
 #. i18n: file: colorsettings.ui:1144
 #. i18n: ectx: property (toolTip), widget (QSlider, disabledContrastSlider)
@@ -897,14 +898,14 @@
 #. i18n: ectx: property (toolTip), widget (QLabel, label)
 #: rc.cpp:387 rc.cpp:995
 msgid "Window text on Window Background"
-msgstr ""
+msgstr "النص في خلفية النافذة"
 
 #. i18n: file: preview.ui:32
 #. i18n: ectx: property (text), widget (QLabel, label)
 #: rc.cpp:390 rc.cpp:998
 msgctxt "color-kcm-preview"
 msgid "Window text"
-msgstr ""
+msgstr "نص النافذة"
 
 #. i18n: file: preview.ui:63
 #. i18n: ectx: property (toolTip), widget (QLabel, labelView0)
@@ -917,7 +918,7 @@
 #: rc.cpp:396 rc.cpp:1004
 msgctxt "color-kcm-preview"
 msgid "Normal text"
-msgstr ""
+msgstr "نص عادي"
 
 #. i18n: file: preview.ui:78
 #. i18n: ectx: property (toolTip), widget (QLabel, labelView3)
@@ -936,7 +937,7 @@
 #: rc.cpp:402 rc.cpp:450 rc.cpp:1010 rc.cpp:1058
 msgctxt "color-kcm-preview"
 msgid "link"
-msgstr ""
+msgstr "رابط"
 
 #. i18n: file: preview.ui:93
 #. i18n: ectx: property (toolTip), widget (QLabel, labelView4)
@@ -955,7 +956,7 @@
 #: rc.cpp:408 rc.cpp:456 rc.cpp:1016 rc.cpp:1064
 msgctxt "color-kcm-preview"
 msgid "visited"
-msgstr ""
+msgstr "مُزار"
 
 #. i18n: file: preview.ui:103
 #. i18n: ectx: property (toolTip), widget (QLabel, labelView2)
@@ -1012,7 +1013,7 @@
 #: rc.cpp:426 rc.cpp:474 rc.cpp:1034 rc.cpp:1082
 msgctxt "color-kcm-preview"
 msgid "!"
-msgstr ""
+msgstr "!"
 
 #. i18n: file: preview.ui:133
 #. i18n: ectx: property (toolTip), widget (QLabel, labelView6)
@@ -1031,7 +1032,7 @@
 #: rc.cpp:432 rc.cpp:480 rc.cpp:1040 rc.cpp:1088
 msgctxt "color-kcm-preview"
 msgid "="
-msgstr ""
+msgstr "="
 
 #. i18n: file: preview.ui:143
 #. i18n: ectx: property (toolTip), widget (QLabel, labelView7)
@@ -1050,7 +1051,7 @@
 #: rc.cpp:438 rc.cpp:486 rc.cpp:1046 rc.cpp:1094
 msgctxt "color-kcm-preview"
 msgid "+"
-msgstr ""
+msgstr "+"
 
 #. i18n: file: preview.ui:181
 #. i18n: ectx: property (toolTip), widget (QLabel, labelSelection0)
@@ -1063,7 +1064,7 @@
 #: rc.cpp:444 rc.cpp:1052
 msgctxt "color-kcm-preview"
 msgid "Selected text"
-msgstr ""
+msgstr "النص المنتقى"
 
 #. i18n: file: preview.ui:196
 #. i18n: ectx: property (toolTip), widget (QLabel, labelSelection3)
@@ -1111,14 +1112,14 @@
 #. i18n: ectx: property (toolTip), widget (QPushButton, pushButton)
 #: rc.cpp:489 rc.cpp:1097
 msgid "Button text on Button Background"
-msgstr ""
+msgstr "نص الزر على خلفية الزر"
 
 #. i18n: file: preview.ui:296
 #. i18n: ectx: property (text), widget (QPushButton, pushButton)
 #: rc.cpp:492 rc.cpp:1100
 msgctxt "color-kcm-preview"
 msgid "Push Button"
-msgstr ""
+msgstr "زر الضغط"
 
 #. i18n: file: setpreview.ui:35
 #. i18n: ectx: property (toolTip), widget (QLabel, labelFore0)
@@ -1130,7 +1131,7 @@
 #. i18n: ectx: property (toolTip), widget (QLabel, labelBack0)
 #: rc.cpp:495 rc.cpp:549 rc.cpp:1103 rc.cpp:1157
 msgid "Normal Text on Normal Background"
-msgstr ""
+msgstr "نص عادي على خلفية عادية"
 
 #. i18n: file: setpreview.ui:38
 #. i18n: ectx: property (text), widget (QLabel, labelFore0)
@@ -1143,13 +1144,13 @@
 #: rc.cpp:498 rc.cpp:552 rc.cpp:1106 rc.cpp:1160
 msgctxt "color-kcm-set-preview"
 msgid "normal"
-msgstr ""
+msgstr "عادي"
 
 #. i18n: file: setpreview.ui:56
 #. i18n: ectx: property (toolTip), widget (QLabel, labelFore3)
 #: rc.cpp:501 rc.cpp:1109
 msgid "Link Text on Normal Background"
-msgstr ""
+msgstr "نص الرابط على الخلفية العادية"
 
 #. i18n: file: setpreview.ui:59
 #. i18n: ectx: property (text), widget (QLabel, labelFore3)
@@ -1162,13 +1163,13 @@
 #: rc.cpp:504 rc.cpp:559 rc.cpp:1112 rc.cpp:1167
 msgctxt "color-kcm-set-preview"
 msgid "link"
-msgstr ""
+msgstr "رابط"
 
 #. i18n: file: setpreview.ui:77
 #. i18n: ectx: property (toolTip), widget (QLabel, labelFore4)
 #: rc.cpp:507 rc.cpp:1115
 msgid "Visited Text on Normal Background"
-msgstr ""
+msgstr "نص مزار على خلفية عادية"
 
 #. i18n: file: setpreview.ui:80
 #. i18n: ectx: property (text), widget (QLabel, labelFore4)
@@ -1181,13 +1182,13 @@
 #: rc.cpp:510 rc.cpp:566 rc.cpp:1118 rc.cpp:1174
 msgctxt "color-kcm-set-preview"
 msgid "visited"
-msgstr ""
+msgstr "مُزار"
 
 #. i18n: file: setpreview.ui:90
 #. i18n: ectx: property (toolTip), widget (QWidget, widgetFore2)
 #: rc.cpp:513 rc.cpp:1121
 msgid "Active Text on Normal Background"
-msgstr ""
+msgstr "نص نشط على خلفية عادية"
 
 #. i18n: file: setpreview.ui:96
 #. i18n: ectx: property (text), widget (QLabel, labelFore2)
@@ -1200,26 +1201,26 @@
 #: rc.cpp:516 rc.cpp:573 rc.cpp:1124 rc.cpp:1181
 msgctxt "color-kcm-set-preview"
 msgid "active"
-msgstr ""
+msgstr "نشط"
 
 #. i18n: file: setpreview.ui:109
 #. i18n: ectx: property (toolTip), widget (QLabel, labelFore1)
 #: rc.cpp:519 rc.cpp:1127
 msgid "Inactive Text on Normal Background"
-msgstr ""
+msgstr "نص خامل على خلفية عادية"
 
 #. i18n: file: setpreview.ui:112
 #. i18n: ectx: property (text), widget (QLabel, labelFore1)
 #: rc.cpp:522 rc.cpp:1130
 msgctxt "color-kcm-set-preview"
 msgid "inactive"
-msgstr ""
+msgstr "خامل"
 
 #. i18n: file: setpreview.ui:125
 #. i18n: ectx: property (toolTip), widget (QLabel, labelFore5)
 #: rc.cpp:525 rc.cpp:1133
 msgid "Negative Text on Normal Background"
-msgstr ""
+msgstr "نص سلبي على خلفية عادية"
 
 #. i18n: file: setpreview.ui:128
 #. i18n: ectx: property (text), widget (QLabel, labelFore5)
@@ -1232,13 +1233,13 @@
 #: rc.cpp:528 rc.cpp:586 rc.cpp:1136 rc.cpp:1194
 msgctxt "color-kcm-set-preview"
 msgid "negative"
-msgstr ""
+msgstr "سلبي"
 
 #. i18n: file: setpreview.ui:141
 #. i18n: ectx: property (toolTip), widget (QLabel, labelFore6)
 #: rc.cpp:531 rc.cpp:1139
 msgid "Neutral Text on Normal Background"
-msgstr ""
+msgstr "نص محايد على خلفية عادية"
 
 #. i18n: file: setpreview.ui:144
 #. i18n: ectx: property (text), widget (QLabel, labelFore6)
@@ -1251,13 +1252,13 @@
 #: rc.cpp:534 rc.cpp:593 rc.cpp:1142 rc.cpp:1201
 msgctxt "color-kcm-set-preview"
 msgid "neutral"
-msgstr ""
+msgstr "محايد"
 
 #. i18n: file: setpreview.ui:157
 #. i18n: ectx: property (toolTip), widget (QLabel, labelFore7)
 #: rc.cpp:537 rc.cpp:1145
 msgid "Positive Text on Normal Background"
-msgstr ""
+msgstr "نص إيجابي على خلفية عادية"
 
 #. i18n: file: setpreview.ui:160
 #. i18n: ectx: property (text), widget (QLabel, labelFore7)
@@ -1270,13 +1271,13 @@
 #: rc.cpp:540 rc.cpp:600 rc.cpp:1148 rc.cpp:1208
 msgctxt "color-kcm-set-preview"
 msgid "positive"
-msgstr ""
+msgstr "إيجابي"
 
 #. i18n: file: setpreview.ui:170
 #. i18n: ectx: property (toolTip), widget (QWidget, widgetFore8)
 #: rc.cpp:543 rc.cpp:1151
 msgid "Hover on Normal Background"
-msgstr ""
+msgstr "تحويم(لمؤشر الفأرة) في الخلفية العادية"
 
 #. i18n: file: setpreview.ui:176
 #. i18n: ectx: property (text), widget (QLabel, labelFore8)
@@ -1316,14 +1317,14 @@
 #. i18n: ectx: property (toolTip), widget (QLabel, labelBack1)
 #: rc.cpp:576 rc.cpp:1184
 msgid "Inactive Text on Alternate Background"
-msgstr ""
+msgstr "نص خامل على خلفية بديلة"
 
 #. i18n: file: setpreview.ui:269
 #. i18n: ectx: property (text), widget (QLabel, labelBack1)
 #: rc.cpp:579 rc.cpp:1187
 msgctxt "color-kcm-set-preview"
 msgid "alternate"
-msgstr ""
+msgstr "بديل"
 
 #. i18n: file: setpreview.ui:283
 #. i18n: ectx: property (toolTip), widget (QLabel, labelBack5)
@@ -1356,11 +1357,11 @@
 #. i18n: ectx: property (toolTip), widget (QLabel, labelFore9)
 #: rc.cpp:603 rc.cpp:1211
 msgid "Focus on Normal Background"
-msgstr ""
+msgstr "ركز على الخلفية العادية"
 
 #. i18n: file: setpreview.ui:336
 #. i18n: ectx: property (text), widget (QLabel, labelFore9)
 #: rc.cpp:606 rc.cpp:1214
 msgctxt "color-kcm-set-preview"
 msgid "focus"
-msgstr ""
+msgstr "ركز"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmcomponentchooser.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmcomponentchooser.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmcomponentchooser.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmcomponentchooser.po	2012-03-23 06:41:57.000000000 +0000
@@ -15,7 +15,7 @@
 "Project-Id-Version: kcmcomponentchooser\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:44+0000\n"
+"PO-Revision-Date: 2012-03-12 22:37+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
@@ -23,8 +23,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:41+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:46+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: componentchooser.cpp:135
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmcrypto.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmcrypto.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmcrypto.po	2012-02-23 06:20:15.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmcrypto.po	2012-03-23 06:41:46.000000000 +0000
@@ -20,8 +20,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 22:44+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:07+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: certexport.cpp:49
 msgid "X509 Certificate Export"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_desktoppaths.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_desktoppaths.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_desktoppaths.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_desktoppaths.po	2012-03-23 06:42:02.000000000 +0000
@@ -10,21 +10,21 @@
 # AbdulAziz AlSharif <a.a-a.s@hotmail.com>, 2007.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kcmkonq\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:15+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-12 22:24+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:24+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:46+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: globalpaths.cpp:76
 msgid ""
@@ -162,16 +162,18 @@
 "The path for '%1' has been changed.\n"
 "Do you want to move the directory '%2' to '%3'?"
 msgstr ""
+"تم تغيير مسار '%1'.\n"
+"هل تريد نقل المجلد '%2' إلى '%3' ؟"
 
 #: globalpaths.cpp:349
 msgctxt "Move the directory"
 msgid "Move"
-msgstr ""
+msgstr "انقل"
 
 #: globalpaths.cpp:350
 msgctxt "Use the new directory but do not move anything"
 msgid "Do not Move"
-msgstr ""
+msgstr "لا تنقل"
 
 #: globalpaths.cpp:354
 msgid "Confirmation Required"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_desktopthemedetails.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_desktopthemedetails.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_desktopthemedetails.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_desktopthemedetails.po	2012-03-23 06:42:02.000000000 +0000
@@ -9,14 +9,14 @@
 "Project-Id-Version: kcm_desktopthemedetails\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:14+0000\n"
+"PO-Revision-Date: 2012-03-12 22:23+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:24+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:46+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: desktopthemedetails.cpp:37
 msgctxt "plasma name"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_device_automounter.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_device_automounter.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_device_automounter.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_device_automounter.po	2012-03-23 06:41:57.000000000 +0000
@@ -13,9 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:36+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:43+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: DeviceAutomounterKCM.cpp:47
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmdevinfo.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmdevinfo.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmdevinfo.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmdevinfo.po	2012-03-23 06:42:02.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:35+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:52+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: infopanel.h:59 devicelisting.cpp:113 soldevice.cpp:69
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_emoticons.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_emoticons.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_emoticons.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_emoticons.po	2012-03-23 06:41:57.000000000 +0000
@@ -5,20 +5,21 @@
 #
 # محمد ابراهيم الحرقان <malham1@hotmail.com>, 2008.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kcm_emoticons\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2011-01-06 03:22+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
+"PO-Revision-Date: 2012-03-12 22:37+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:37+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:43+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: emoticonslist.cpp:66
 msgid ""
@@ -79,12 +80,12 @@
 #: rc.cpp:70
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
-msgstr "زايد السعيدي, ,Launchpad Contributions:"
+msgstr "زايد السعيدي, ,Launchpad Contributions:,Abdalrahim G. Fakhouri"
 
 #: rc.cpp:71
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "zayed.alsaidi@gmail.com,,"
+msgstr "zayed.alsaidi@gmail.com,,,"
 
 #. i18n: file: emoticonslist.ui:13
 #. i18n: ectx: property (windowTitle), widget (QWidget, EmoticonsManager)
@@ -178,7 +179,7 @@
 #. i18n: ectx: property (toolTip), widget (KPushButton, btGetNew)
 #: rc.cpp:45
 msgid "Get new icon themes from the Internet"
-msgstr ""
+msgstr "احصل على سمات أيقونات جديدة من الإنترنت"
 
 #. i18n: file: emoticonslist.ui:123
 #. i18n: ectx: property (whatsThis), widget (KPushButton, btGetNew)
@@ -197,7 +198,7 @@
 #. i18n: ectx: property (text), widget (KPushButton, btGetNew)
 #: rc.cpp:51
 msgid "Get New Icon Themes..."
-msgstr ""
+msgstr "احصل على سِمات أيقونات جديدة..."
 
 #. i18n: file: emoticonslist.ui:133
 #. i18n: ectx: property (toolTip), widget (KPushButton, btInstall)
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmfonts.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmfonts.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmfonts.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmfonts.po	2012-03-23 06:42:02.000000000 +0000
@@ -10,21 +10,21 @@
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # Amine Roukh <amineroukh@gmail.com>, 2008.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kcmfonts\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2011-01-06 03:27+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-12 22:24+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:36+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:53+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: fonts.cpp:229
 msgid "Configure Anti-Alias Settings"
@@ -76,42 +76,42 @@
 #: fonts.cpp:504
 msgctxt "font usage"
 msgid "General"
-msgstr ""
+msgstr "عام"
 
 #: fonts.cpp:505
 msgctxt "font usage"
 msgid "Fixed width"
-msgstr ""
+msgstr "خط ثابت العرض"
 
 #: fonts.cpp:506
 msgctxt "font usage"
 msgid "Small"
-msgstr ""
+msgstr "صغير"
 
 #: fonts.cpp:507
 msgctxt "font usage"
 msgid "Toolbar"
-msgstr ""
+msgstr "شريط الأدوات"
 
 #: fonts.cpp:508
 msgctxt "font usage"
 msgid "Menu"
-msgstr ""
+msgstr "قائمة"
 
 #: fonts.cpp:509
 msgctxt "font usage"
 msgid "Window title"
-msgstr ""
+msgstr "عنوا&ن النافذة"
 
 #: fonts.cpp:510
 msgctxt "font usage"
 msgid "Taskbar"
-msgstr ""
+msgstr "شريط المهام"
 
 #: fonts.cpp:511
 msgctxt "font usage"
 msgid "Desktop"
-msgstr ""
+msgstr "سطح المكتب"
 
 #: fonts.cpp:541
 msgid "Used for normal text (e.g. button labels, list items)."
@@ -247,7 +247,7 @@
 #: kxftconfig.cpp:456
 msgctxt "no subpixel rendering"
 msgid "None"
-msgstr ""
+msgstr "بدون"
 
 #: kxftconfig.cpp:458
 msgid "RGB"
@@ -272,7 +272,7 @@
 #: kxftconfig.cpp:496
 msgctxt "no hinting"
 msgid "None"
-msgstr ""
+msgstr "بدون"
 
 #: kxftconfig.cpp:498
 msgid "Slight"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmhtmlsearch.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmhtmlsearch.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmhtmlsearch.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmhtmlsearch.po	2012-03-23 06:41:57.000000000 +0000
@@ -16,16 +16,15 @@
 "Project-Id-Version: kcmhtmlsearch\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2011-12-12 19:38+0000\n"
+"PO-Revision-Date: 2012-03-14 17:33+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:42+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:47+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kcmhtmlsearch.cpp:48
 msgid "ht://dig"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmicons.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmicons.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmicons.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmicons.po	2012-03-23 06:41:57.000000000 +0000
@@ -22,10 +22,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:43+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:47+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: icons.cpp:49
 msgid "Use of Icon"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcminfo.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcminfo.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcminfo.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcminfo.po	2012-03-23 06:42:02.000000000 +0000
@@ -11,26 +11,25 @@
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # Amine Roukh <amineroukh@gmail.com>, 2008.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kcminfo\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2011-12-12 19:51+0000\n"
+"PO-Revision-Date: 2012-03-14 17:04+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:37+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:53+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
-"X-Poedit-Laسوّاقnguage: Arabic\n"
 
 #: info.cpp:40
 msgid "System Information Control Module"
-msgstr ""
+msgstr "وحدة مركز التحكّم لمعلومات النظام"
 
 #: info.cpp:29
 msgid ""
@@ -92,10 +91,10 @@
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
 msgstr ""
-"Mohamed SAAD محمد سعد, ,Launchpad Contributions:,Youssef Chahibi,Zayed Amer "
-"Al-Saidi,metehyi"
+"Mohamed SAAD محمد سعد, ,Launchpad Contributions:,Abdalrahim G. "
+"Fakhouri,Youssef Chahibi,Zayed Amer Al-Saidi,metehyi"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "metehyi@free.fr,,,,zayed.alsaidi@gmail.com,"
+msgstr "metehyi@free.fr,,,,,zayed.alsaidi@gmail.com,"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcminit.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcminit.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcminit.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcminit.po	2012-03-23 06:42:02.000000000 +0000
@@ -16,8 +16,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:37+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:53+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: main.cpp:172
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcminput.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcminput.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcminput.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcminput.po	2012-03-23 06:42:02.000000000 +0000
@@ -10,35 +10,35 @@
 # AbdulAziz AlSharif <a.a-a.s@hotmail.com>, 2007.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kcminput\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:13+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-14 17:13+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:38+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:54+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kcmcursortheme.cpp:40
 msgid "Cursor Theme"
-msgstr ""
+msgstr "سِمة المؤشر"
 
 #: kcmcursortheme.cpp:41
 msgid "(c) 2003-2007 Fredrik Höglund"
-msgstr ""
+msgstr "(c) 2003-2007 Fredrik Höglund"
 
 #: kcmcursortheme.cpp:42
 msgid "Fredrik Höglund"
-msgstr ""
+msgstr "Fredrik Höglund"
 
 #: logitechmouse.cpp:46 logitechmouse.cpp:88
 #, kde-format
@@ -64,7 +64,7 @@
 #: logitechmouse.cpp:360
 msgctxt "no cordless mouse"
 msgid "none"
-msgstr ""
+msgstr "بدون"
 
 #: logitechmouse.cpp:363 logitechmouse.cpp:393
 msgid "Cordless Mouse"
@@ -532,14 +532,14 @@
 #: rc.cpp:33 rc.cpp:107
 msgctxt "label. delay (on milliseconds) to automatically select icons"
 msgid "Delay"
-msgstr ""
+msgstr "التأخير"
 
 #. i18n: file: kmousedlg.ui:207
 #. i18n: ectx: property (suffix), widget (KIntNumInput, slAutoSelect)
 #: rc.cpp:36 rc.cpp:110
 msgctxt "milliseconds. time to automatically select the items"
 msgid " ms"
-msgstr ""
+msgstr " مللي ثانية"
 
 #. i18n: file: xcursor/themepage.ui:31
 #. i18n: ectx: property (text), widget (QLabel, label)
@@ -553,19 +553,19 @@
 #. i18n: ectx: property (toolTip), widget (KPushButton, installKnsButton)
 #: rc.cpp:71
 msgid "Get new color schemes from the Internet"
-msgstr ""
+msgstr "احصل على مخطط ألوان جديد من الإنترنت"
 
 #. i18n: file: xcursor/themepage.ui:59
 #. i18n: ectx: property (text), widget (KPushButton, installKnsButton)
 #: rc.cpp:74
 msgid "Get New Theme..."
-msgstr ""
+msgstr "احصل على سمة جديدة..."
 
 #. i18n: file: xcursor/themepage.ui:66
 #. i18n: ectx: property (text), widget (KPushButton, installButton)
 #: rc.cpp:77
 msgid "Install From File..."
-msgstr ""
+msgstr "ثبت من ملف..."
 
 #. i18n: file: xcursor/themepage.ui:38
 #. i18n: ectx: property (text), widget (KPushButton, removeButton)
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkamera.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkamera.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkamera.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkamera.po	2012-03-23 06:42:06.000000000 +0000
@@ -6,21 +6,21 @@
 # Munzir Taha <munzir@kacst.edu.sa>, 2004.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # Mohammed Berdai <stuntgp2000@gmail.com>, 2008.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kcmkamera\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-09 13:28+0000\n"
-"PO-Revision-Date: 2011-01-05 22:40+0000\n"
+"PO-Revision-Date: 2012-03-12 22:23+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:15+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:52+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: kamera.cpp:99
 msgid "Unable to initialize the gPhoto2 libraries."
@@ -173,7 +173,7 @@
 #: kameradevice.cpp:298
 msgctxt "@title:column"
 msgid "Supported Cameras"
-msgstr ""
+msgstr "الكاميرات المدعومة"
 
 #: kameradevice.cpp:314 kameradevice.cpp:333
 msgid "Port"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkclock.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkclock.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkclock.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkclock.po	2012-03-23 06:42:02.000000000 +0000
@@ -2,28 +2,28 @@
 # translation of kcmkclock.po to
 # KDE Clock Control Module
 # Copyright (C) 2001,2002,2003, 2006, 2007, 2008 Free Software Foundation, Inc.
+#
 # Isam Bayazidi <bayazidi@arabeyes.org>, 2001,2002,2003.
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # AbdulAziz AlSharif <a.a-a.s@hotmail.com>, 2007.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
 # Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-#
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kcmkclock\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:13+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-14 17:03+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:39+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:54+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: dtime.cpp:79
 msgid ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkded.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkded.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkded.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkded.po	2012-03-23 06:41:57.000000000 +0000
@@ -13,16 +13,15 @@
 "Project-Id-Version: kcmkded\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2011-12-12 19:29+0000\n"
+"PO-Revision-Date: 2012-03-14 17:31+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:43+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:47+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kcmkded.cpp:72
 msgid "kcmkded"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkdnssd.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkdnssd.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkdnssd.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkdnssd.po	2012-03-23 06:41:57.000000000 +0000
@@ -10,16 +10,15 @@
 "Project-Id-Version: kcmkdnssd\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2011-12-12 19:41+0000\n"
+"PO-Revision-Date: 2012-03-14 17:32+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:44+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:48+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kcmdnssd.cpp:55
 msgid "ZeroConf configuration"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkeyboard.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkeyboard.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkeyboard.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkeyboard.po	2012-03-23 06:42:02.000000000 +0000
@@ -1,39 +1,41 @@
 # translation of kcmkeyboard.po to Arabic
 # Copyright (C) YEAR This_file_is_part_of_KDE
 # This file is distributed under the same license as the PACKAGE package.
+#
 # Amine <amineroukh@gmail.com>, 2008.
 # Amine Roukh <amineroukh@gmail.com>, 2008.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
 # Tariq AlWarhi <tariq.alwarhi@gmail.com>, 2010.
 # Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-#
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kcmkeyboard\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2011-01-26 05:03+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-12 22:26+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: American English <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:39+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:55+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: rc.cpp:171
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
 msgstr ""
-"طارق الورهي,زايد السعيدي, ,Launchpad Contributions:,Tariq AlWarhi,Zayed Amer "
-"Al-Saidi"
+"طارق الورهي,زايد السعيدي،عبدالرحيم الفاخوري, ,Launchpad "
+"Contributions:,Abdalrahim G. Fakhouri,Tariq AlWarhi,Zayed Amer Al-Saidi"
 
 #: rc.cpp:172
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
 msgstr ""
-"tariq.alwarhi@gmail.com,zayed.alsaidi@gmail.com,,,,zayed.alsaidi@gmail.com"
+"tariq.alwarhi@gmail.com,zayed.alsaidi@gmail.com,abdilra7eem@yahoo.com,,,,,zay"
+"ed.alsaidi@gmail.com"
 
 #. i18n: file: kcm_add_layout_dialog.ui:14
 #. i18n: ectx: property (windowTitle), widget (QDialog, AddLayoutDialog)
@@ -57,25 +59,25 @@
 #. i18n: ectx: property (text), widget (QLabel, label_2)
 #: rc.cpp:11
 msgid "Layout:"
-msgstr ""
+msgstr "التخطيط:"
 
 #. i18n: file: kcm_add_layout_dialog.ui:47
 #. i18n: ectx: property (text), widget (QLabel, label_3)
 #: rc.cpp:14
 msgid "Variant:"
-msgstr ""
+msgstr "التنويعة"
 
 #. i18n: file: kcm_add_layout_dialog.ui:57
 #. i18n: ectx: property (text), widget (QLabel, labelLabel)
 #: rc.cpp:17
 msgid "Label:"
-msgstr ""
+msgstr "التسمية:"
 
 #. i18n: file: kcm_add_layout_dialog.ui:74
 #. i18n: ectx: property (text), widget (QLabel, labelLabel_2)
 #: rc.cpp:20
 msgid "Shortcut:"
-msgstr ""
+msgstr "إختصار:"
 
 #. i18n: file: kcm_keyboard.ui:18
 #. i18n: ectx: attribute (title), widget (QWidget, tabHardware)
@@ -140,7 +142,7 @@
 #. i18n: ectx: property (text), widget (QRadioButton, showLabelRadioBtn)
 #: rc.cpp:43 rc.cpp:215
 msgid "Show label"
-msgstr ""
+msgstr "اعرض اللاصقة"
 
 #. i18n: file: kcm_keyboard.ui:136
 #. i18n: ectx: property (whatsThis), widget (KButtonGroup, switchingPolicyButtonGroup)
@@ -273,37 +275,37 @@
 #. i18n: ectx: property (text), widget (QPushButton, addLayoutBtn)
 #: rc.cpp:105
 msgid "Add"
-msgstr ""
+msgstr "أضف"
 
 #. i18n: file: kcm_keyboard.ui:300
 #. i18n: ectx: property (text), widget (QPushButton, removeLayoutBtn)
 #: rc.cpp:108
 msgid "Remove"
-msgstr ""
+msgstr "أزِل"
 
 #. i18n: file: kcm_keyboard.ui:310
 #. i18n: ectx: property (text), widget (QPushButton, moveUpBtn)
 #: rc.cpp:111
 msgid "Move Up"
-msgstr ""
+msgstr "حرّك لأعلى"
 
 #. i18n: file: kcm_keyboard.ui:320
 #. i18n: ectx: property (text), widget (QPushButton, moveDownBtn)
 #: rc.cpp:114
 msgid "Move Down"
-msgstr ""
+msgstr "حرّك لأسفل"
 
 #. i18n: file: kcm_keyboard.ui:355
 #. i18n: ectx: property (text), widget (QCheckBox, layoutLoopingCheckBox)
 #: rc.cpp:106 rc.cpp:278
 msgid "Spare layouts"
-msgstr ""
+msgstr "المخططات الاحتياطية"
 
 #. i18n: file: kcm_keyboard.ui:368
 #. i18n: ectx: property (text), widget (QLabel, label_5)
 #: rc.cpp:109 rc.cpp:281
 msgid "Main layout count:"
-msgstr ""
+msgstr "التعداد الاساسي للمخطط"
 
 #. i18n: file: kcm_keyboard.ui:385
 #. i18n: ectx: attribute (title), widget (QWidget, tabAdvanced)
@@ -419,7 +421,7 @@
 #. i18n: ectx: property (text), widget (QLabel, label)
 #: rc.cpp:180
 msgid "Test area:"
-msgstr ""
+msgstr "مساحة اختبار:"
 
 #. i18n: file: kcmmiscwidget.ui:243
 #. i18n: ectx: property (toolTip), widget (QLineEdit, lineEdit)
@@ -433,7 +435,7 @@
 #. i18n: ectx: property (title), widget (QGroupBox, groupBox)
 #: rc.cpp:186
 msgid "Key Click"
-msgstr ""
+msgstr "نقرة زرّ"
 
 #. i18n: file: kcmmiscwidget.ui:185
 #. i18n: ectx: property (whatsThis), widget (QLabel, TextLabel1)
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkeys.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkeys.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkeys.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkeys.po	2012-03-23 06:42:02.000000000 +0000
@@ -14,14 +14,14 @@
 "Project-Id-Version: kcmkeys\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:16+0000\n"
+"PO-Revision-Date: 2012-03-12 22:24+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:41+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:56+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: globalshortcuts.cpp:67
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkgamma.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkgamma.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkgamma.po	2012-02-23 06:20:34.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkgamma.po	2012-03-23 06:42:07.000000000 +0000
@@ -19,8 +19,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:27+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:59+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kgamma.cpp:147
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkio.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkio.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkio.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkio.po	2012-03-23 06:41:59.000000000 +0000
@@ -16,7 +16,7 @@
 "Project-Id-Version: kcmkio\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2012-01-26 11:54+0000\n"
+"PO-Revision-Date: 2012-03-14 17:24+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
@@ -24,10 +24,9 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:37+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:18+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: bookmarks.cpp:110
 msgid ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkonqhtml.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkonqhtml.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkonqhtml.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkonqhtml.po	2012-03-23 06:41:59.000000000 +0000
@@ -15,16 +15,16 @@
 "Project-Id-Version: kcmkonqhtml\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2012-01-25 11:01+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-14 17:22+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:38+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:19+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: appearance.cpp:53
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkonq.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkonq.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkonq.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkonq.po	2012-03-23 06:41:59.000000000 +0000
@@ -17,14 +17,14 @@
 "Project-Id-Version: kcmkonq\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2012-01-25 11:02+0000\n"
+"PO-Revision-Date: 2012-03-12 22:32+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:38+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:18+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: behaviour.cpp:44
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_krfb.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_krfb.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_krfb.po	2012-02-23 06:20:09.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_krfb.po	2012-03-23 06:41:40.000000000 +0000
@@ -20,8 +20,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:08+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:59+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kcm_krfb.cpp:61
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkurifilt.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkurifilt.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkurifilt.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkurifilt.po	2012-03-23 06:41:59.000000000 +0000
@@ -14,16 +14,15 @@
 "Project-Id-Version: kcmkurifilt\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2012-01-25 10:58+0000\n"
+"PO-Revision-Date: 2012-03-12 22:32+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:40+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:19+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: main.cpp:46
 msgid ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkwallet.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkwallet.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkwallet.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkwallet.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,254 +0,0 @@
-# translation of kcmkwallet.po to
-# Copyright (C) 2004, 2006, 2007 Free Software Foundation, Inc.
-#
-# Ahmad M. Zawawi <azawawi@emirates.net.ae>, 2004.
-# Munzir Taha <munzir@kacst.edu.sa>, 2004.
-# Khaled Hosny <dr.khaled.hosny@gmail.com>, 2006.
-# Fahad Al-Saidi <fahad.alsaidi@gmail.com>, 2007.
-# Youssef Chahibi <chahibi@gmail.com>, 2007.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
-msgid ""
-msgstr ""
-"Project-Id-Version: kcmkwallet\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 13:31+0000\n"
-"PO-Revision-Date: 2012-01-25 08:06+0000\n"
-"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:07+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-
-#: konfigurator.cpp:50
-msgid "kcmkwallet"
-msgstr "kcmkwallet"
-
-#: konfigurator.cpp:51
-msgid "KDE Wallet Control Module"
-msgstr "وحدة التحكم في محفظة كدى"
-
-#: konfigurator.cpp:53
-msgid "(c) 2003 George Staikos"
-msgstr "الحقوق محفوظة 2003 لجورج ستايكوس"
-
-#: konfigurator.cpp:54
-msgid "George Staikos"
-msgstr "George Staikos"
-
-#: konfigurator.cpp:117
-msgid "New Wallet"
-msgstr "محفظة جديدة"
-
-#: konfigurator.cpp:118
-msgid "Please choose a name for the new wallet:"
-msgstr "رجاءا أختر اسم للمحفظة الجديدة:"
-
-#: konfigurator.cpp:212 konfigurator.cpp:260
-msgid "Always Allow"
-msgstr "اسمح دوماً"
-
-#: konfigurator.cpp:215 konfigurator.cpp:222 konfigurator.cpp:271
-msgid "Always Deny"
-msgstr "امنع دوماً"
-
-#: konfigurator.cpp:307
-msgid ""
-"This configuration module allows you to configure the KDE wallet system."
-msgstr "تسمح لك وحدة الإعداد هذه بإعداد نظام محفظة كدى."
-
-#: konfigurator.cpp:316
-msgid "&Delete"
-msgstr "اح&ذف"
-
-#: rc.cpp:82
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr ""
-"عبدالرحمن عبدالخالق غريب, خالد حسنى, فهد السعيدي, ,Launchpad "
-"Contributions:,Khaled Hosny,Munzir Taha,o88o"
-
-#: rc.cpp:83
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr ""
-"king_abdo@yahoo.com, dr.khaled.hosny@gmail.com, "
-"Fahad.alsaidi@gmail.com,,,khaledhosny@eglug.org,,"
-
-#. i18n: file: walletconfigwidget.ui:16
-#. i18n: ectx: attribute (title), widget (QWidget, tab)
-#: rc.cpp:3
-msgid "Wallet Preferences"
-msgstr "خصائص المحفظة"
-
-#. i18n: file: walletconfigwidget.ui:22
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, _enabled)
-#: rc.cpp:6
-msgid ""
-"<p>The wallet subsystem provides a convenient and secure way to manage all "
-"your passwords.  This option specifies whether or not you want to use it.</p>"
-msgstr ""
-"<p>يوفر نظام المحفظة الفرعي طريقة آمنة وملائمة لإدارة كلمات السر.  يمكنك أن "
-"تقرر بهذا الخيار اذا كنت تريد استخدام هذا النظام أم.</p>"
-
-#. i18n: file: walletconfigwidget.ui:25
-#. i18n: ectx: property (text), widget (QCheckBox, _enabled)
-#: rc.cpp:9
-msgid "&Enable the KDE wallet subsystem"
-msgstr "تف&عيل نظام محفظة كدى الفرعي"
-
-#. i18n: file: walletconfigwidget.ui:35
-#. i18n: ectx: property (whatsThis), widget (QGroupBox, groupBox2)
-#: rc.cpp:12
-msgid ""
-"It is best to close your wallets when you are not using them to prevent "
-"others from viewing or using them."
-msgstr ""
-"من الأفضل اغلاق الَمحَافظ عندما تتوقّف عن استخدامها حتى تمنع الآخرين من "
-"الاطّلاع عليها أو استخدامها."
-
-#. i18n: file: walletconfigwidget.ui:38
-#. i18n: ectx: property (title), widget (QGroupBox, groupBox2)
-#: rc.cpp:15
-msgid "Close Wallet"
-msgstr "أغلق المحفظة"
-
-#. i18n: file: walletconfigwidget.ui:46
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, _closeIdle)
-#. i18n: file: walletconfigwidget.ui:59
-#. i18n: ectx: property (whatsThis), widget (QSpinBox, _idleTime)
-#: rc.cpp:18 rc.cpp:24
-msgid ""
-"<p><b>Close wallet after a period of inactivity.</b><br>When a wallet is "
-"closed the password is needed to access it again.</p>"
-msgstr ""
-"<p><b>أغلق المحفظة بعد فترة من عدم النشاط</b><br>عند إغلاق المحفظة سوف تحتاج "
-"لكلمة السر للدخول لها مرة أخرى.</p>"
-
-#. i18n: file: walletconfigwidget.ui:49
-#. i18n: ectx: property (text), widget (QCheckBox, _closeIdle)
-#: rc.cpp:21
-msgid "Close when unused for:"
-msgstr "الاغلاق عند عدم الاستخدام لمدة:"
-
-#. i18n: file: walletconfigwidget.ui:62
-#. i18n: ectx: property (suffix), widget (QSpinBox, _idleTime)
-#: rc.cpp:27
-msgid " min"
-msgstr " دقيقة"
-
-#. i18n: file: walletconfigwidget.ui:99
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, _screensaverLock)
-#: rc.cpp:30
-msgid ""
-"<p><b>Close wallet as soon as the screensaver starts.</b><br>When a wallet "
-"is closed the password is needed to access it again.</p>"
-msgstr ""
-"<P><b>اغلاق المحفظة بمجرد بدأ حافظة الشاشة.</b><br>عند إغلاق المحفظة سوف "
-"تحتاج لكلمة السر لدخولها مره أخرى.</p>"
-
-#. i18n: file: walletconfigwidget.ui:102
-#. i18n: ectx: property (text), widget (QCheckBox, _screensaverLock)
-#: rc.cpp:33
-msgid "Close when screensaver starts"
-msgstr "أغلق عندما تبدأ حافظة الشاشة"
-
-#. i18n: file: walletconfigwidget.ui:109
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, _autoclose)
-#: rc.cpp:36
-msgid ""
-"<p><b>Close wallet as soon as applications that use it have "
-"stopped.</b><br>Note that your wallet will only be closed when all "
-"applications that use it have stopped.<br>When a wallet is closed the "
-"password is needed to access it again.</p>"
-msgstr ""
-"<p><b>أغلق المحفظة بمجرد توقف التطبيق المستخدم لها.</b><br>لاحظ أن المحفظة "
-"سوف تغلق فقط عند توقف كل التطبيقات المستخدمة لها. <br> عند إغلاق المحفظة سوف "
-"تحتاج لكلمة السر للدخول لها مرة أخرى. </p>"
-
-#. i18n: file: walletconfigwidget.ui:112
-#. i18n: ectx: property (text), widget (QCheckBox, _autoclose)
-#: rc.cpp:39
-msgid "Close when last application stops using it"
-msgstr "أغلق عند توقف آخر تطبيق يستخدمها"
-
-#. i18n: file: walletconfigwidget.ui:122
-#. i18n: ectx: property (title), widget (QGroupBox, groupBox4)
-#: rc.cpp:42
-msgid "Automatic Wallet Selection"
-msgstr "اختيار المحفظة تلقائيا"
-
-#. i18n: file: walletconfigwidget.ui:128
-#. i18n: ectx: property (text), widget (QLabel, textLabel1_2)
-#: rc.cpp:45
-msgid "Select wallet to use as default:"
-msgstr "حدد محفظة لتصبح المحفظة الافتراضية:"
-
-#. i18n: file: walletconfigwidget.ui:161
-#. i18n: ectx: property (text), widget (QPushButton, _newWallet)
-#. i18n: file: walletconfigwidget.ui:191
-#. i18n: ectx: property (text), widget (QPushButton, _newLocalWallet)
-#: rc.cpp:48 rc.cpp:54
-msgid "New..."
-msgstr "جديد..."
-
-#. i18n: file: walletconfigwidget.ui:168
-#. i18n: ectx: property (text), widget (QCheckBox, _localWalletSelected)
-#: rc.cpp:51
-msgid "Different wallet for local passwords:"
-msgstr "محفظة مختلفه لكلمات السر المحلية:"
-
-#. i18n: file: walletconfigwidget.ui:201
-#. i18n: ectx: property (title), widget (QGroupBox, groupBox3)
-#: rc.cpp:57
-msgid "Wallet Manager"
-msgstr "مدير المحفظة"
-
-#. i18n: file: walletconfigwidget.ui:207
-#. i18n: ectx: property (text), widget (QCheckBox, _launchManager)
-#: rc.cpp:60
-msgid "Show manager in system tray"
-msgstr "أظهر المدير في صينية النظام"
-
-#. i18n: file: walletconfigwidget.ui:235
-#. i18n: ectx: property (text), widget (QCheckBox, _autocloseManager)
-#: rc.cpp:63
-msgid "Hide system tray icon when last wallet closes"
-msgstr "اخف أيقونة صينية النظام عند إغلاق آخر محفظة"
-
-#. i18n: file: walletconfigwidget.ui:280
-#. i18n: ectx: attribute (title), widget (QWidget, tab)
-#: rc.cpp:66
-msgid "Access Control"
-msgstr "تحكم الوصول"
-
-#. i18n: file: walletconfigwidget.ui:286
-#. i18n: ectx: property (text), widget (QCheckBox, _openPrompt)
-#: rc.cpp:69
-msgid "&Prompt when an application accesses an open wallet"
-msgstr "إ&ظهار رسالة عند دخول تطبيق لمحفظة مفتوحة"
-
-#. i18n: file: walletconfigwidget.ui:300
-#. i18n: ectx: property (text), widget (Q3ListView, _accessList)
-#: rc.cpp:72
-msgid "Wallet"
-msgstr "المحفظة"
-
-#. i18n: file: walletconfigwidget.ui:311
-#. i18n: ectx: property (text), widget (Q3ListView, _accessList)
-#: rc.cpp:75
-msgid "Application"
-msgstr "التطبيق"
-
-#. i18n: file: walletconfigwidget.ui:322
-#. i18n: ectx: property (text), widget (Q3ListView, _accessList)
-#: rc.cpp:78
-msgid "Policy"
-msgstr "السياسة"
-
-#. i18n: file: walletconfigwidget.ui:358
-#. i18n: ectx: property (text), widget (QPushButton, _launch)
-#: rc.cpp:81
-msgid "&Launch Wallet Manager"
-msgstr "أ&طلق مدير المحفظة"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkwincompositing.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkwincompositing.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkwincompositing.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkwincompositing.po	2012-03-23 06:42:02.000000000 +0000
@@ -12,7 +12,7 @@
 "Project-Id-Version: kcmkwincompositing\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:12+0000\n"
+"PO-Revision-Date: 2012-03-12 22:26+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
@@ -20,8 +20,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:41+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:56+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: ktimerdialog.cpp:167
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkwindecoration.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkwindecoration.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkwindecoration.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkwindecoration.po	2012-03-23 06:42:02.000000000 +0000
@@ -15,16 +15,15 @@
 "Project-Id-Version: kcmkwindecoration\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:13+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-14 17:08+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:42+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:56+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: buttons.cpp:613
 msgid "KDE"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_kwindesktop.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_kwindesktop.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_kwindesktop.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_kwindesktop.po	2012-03-23 06:42:02.000000000 +0000
@@ -9,14 +9,14 @@
 "Project-Id-Version: kcm_kwindesktop\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:13+0000\n"
+"PO-Revision-Date: 2012-03-12 22:26+0000\n"
 "Last-Translator: imksa <malham1@hotmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:26+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:47+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: desktopnameswidget.cpp:72
 #, kde-format
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkwinrules.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkwinrules.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkwinrules.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkwinrules.po	2012-03-23 06:42:02.000000000 +0000
@@ -11,14 +11,14 @@
 "Project-Id-Version: kcmkwinrules\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2011-12-12 19:44+0000\n"
+"PO-Revision-Date: 2012-03-14 17:13+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:43+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:57+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #. i18n: file: ruleswidgetbase.ui:266
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkwinscreenedges.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkwinscreenedges.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkwinscreenedges.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkwinscreenedges.po	2012-03-23 06:42:03.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:44+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:57+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: main.cpp:185
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkwm.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkwm.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmkwm.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmkwm.po	2012-03-23 06:42:03.000000000 +0000
@@ -14,18 +14,17 @@
 "Project-Id-Version: kcmkwm\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:13+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-14 17:08+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:44+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:58+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: main.cpp:81
 msgid "&Focus"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmlaunch.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmlaunch.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmlaunch.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmlaunch.po	2012-03-23 06:42:03.000000000 +0000
@@ -22,8 +22,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:46+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:58+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: kcmlaunch.cpp:51
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmlocale.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmlocale.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmlocale.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmlocale.po	2012-03-23 06:41:57.000000000 +0000
@@ -10,22 +10,21 @@
 # zayed <zayed.alsaidi@gmail.com>, 2008.
 # Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
 # Muhammed Abd-ulaziz Abd-ullah <thenubianmuha_idrecy@yahoo.co.uk>, 2012.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kcmlocale\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:42+0000\n"
-"Last-Translator: Muhammed Abd-ulAziz Abd-ullah <Unknown>\n"
+"PO-Revision-Date: 2012-03-14 17:32+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:45+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:48+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: countryselectordialog.cpp:217
 msgid "Country Selector"
@@ -54,7 +53,7 @@
 
 #: kcmlocale.cpp:65
 msgid "Maintainer"
-msgstr ""
+msgstr "المشرف"
 
 #: kcmlocale.cpp:447
 #, kde-format
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_memory.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_memory.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_memory.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_memory.po	2012-03-23 06:42:02.000000000 +0000
@@ -17,8 +17,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:28+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:48+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: chartWidget.cpp:56 memory.cpp:278
 msgid "Not available."
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_nepomuk.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_nepomuk.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_nepomuk.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_nepomuk.po	2012-03-23 06:41:57.000000000 +0000
@@ -9,7 +9,7 @@
 "Project-Id-Version: nepomuk\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:42+0000\n"
+"PO-Revision-Date: 2012-03-12 22:37+0000\n"
 "Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
@@ -17,9 +17,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:37+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:44+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: indexfolderselectiondialog.cpp:63
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmnic.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmnic.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmnic.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmnic.po	2012-03-23 06:42:03.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:47+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:59+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: nic.cpp:99
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmnotify.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmnotify.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmnotify.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmnotify.po	2012-03-23 06:41:57.000000000 +0000
@@ -14,16 +14,15 @@
 "Project-Id-Version: kcmnotify\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2011-12-12 19:38+0000\n"
+"PO-Revision-Date: 2012-03-14 17:33+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:46+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:49+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: knotify.cpp:55
 msgid ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmopengl.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmopengl.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmopengl.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmopengl.po	2012-03-23 06:42:03.000000000 +0000
@@ -16,8 +16,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:47+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:59+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: opengl.cpp:74
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_pci.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_pci.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_pci.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_pci.po	2012-03-23 06:42:02.000000000 +0000
@@ -5,20 +5,21 @@
 #
 # محمد ابراهيم الحرقان <malham1@hotmail.com>, 2008.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kcm_pci\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2011-01-06 05:23+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
+"PO-Revision-Date: 2012-03-12 22:26+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:28+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:48+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: kcm_pci.cpp:51
 msgid "kcm_pci"
@@ -661,7 +662,7 @@
 #: kpci.cpp:659
 msgctxt "no data"
 msgid "None"
-msgstr ""
+msgstr "لا شيء"
 
 #: kpci.cpp:689
 msgid "Next"
@@ -690,37 +691,39 @@
 #: rc.cpp:1
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
-msgstr "زايد السعيدي, ,Launchpad Contributions:,Zayed Amer Al-Saidi"
+msgstr ""
+"زايد السعيدي, ,Launchpad Contributions:,Abdalrahim G. Fakhouri,Zayed Amer Al-"
+"Saidi"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "zayed.alsaidi@gmail.com,,,zayed.alsaidi@gmail.com"
+msgstr "zayed.alsaidi@gmail.com,,,,zayed.alsaidi@gmail.com"
 
 #: kpci_private.h:26
 msgctxt "state of PCI item"
 msgid "Enabled"
-msgstr ""
+msgstr "ممكّن"
 
 #: kpci_private.h:27
 msgctxt "state of PCI item"
 msgid "Disabled"
-msgstr ""
+msgstr "معطّل"
 
 #: kpci_private.h:28
 msgctxt "state of PCI item"
 msgid "Yes"
-msgstr ""
+msgstr "نعم"
 
 #: kpci_private.h:29
 msgctxt "state of PCI item"
 msgid "No"
-msgstr ""
+msgstr "لا"
 
 #: kpci_private.h:30
 msgctxt "state of PCI item"
 msgid "Unknown"
-msgstr ""
+msgstr "مجهول"
 
 #: kpci_private.h:438
 msgid "Unclassified device"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmperformance.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmperformance.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmperformance.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmperformance.po	2012-03-23 06:41:59.000000000 +0000
@@ -18,10 +18,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:41+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:20+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kcmperformance.cpp:48
 msgid ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_phonon.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_phonon.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_phonon.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_phonon.po	2012-03-23 06:41:57.000000000 +0000
@@ -6,20 +6,20 @@
 # zayed <zayed.alsaidi@gmail.com>, 2008.
 # Hajur Alasefer <frostbutterfly@gmail.com>, 2012.
 # Abderrahim Kitouni <a.kitouni@gmail.com>, 2012.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kcm_phonon\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:44+0000\n"
-"Last-Translator: Abderrahim Kitouni <a.kitouni@gmail.com>\n"
+"PO-Revision-Date: 2012-03-12 22:42+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:38+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:44+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: devicepreference.cpp:105
@@ -32,7 +32,7 @@
 
 #: devicepreference.cpp:122
 msgid "Video Recording"
-msgstr ""
+msgstr "تسجيل مرئي"
 
 #: devicepreference.cpp:125
 msgid "Invalid"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_phononxine.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_phononxine.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_phononxine.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_phononxine.po	2012-03-23 06:41:57.000000000 +0000
@@ -15,9 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:39+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:45+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #. i18n: file: xineoptions.ui:20
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_platform.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_platform.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_platform.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_platform.po	2012-03-23 06:41:57.000000000 +0000
@@ -13,9 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:39+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:45+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: platform.cpp:39
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_remotecontrol.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_remotecontrol.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_remotecontrol.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_remotecontrol.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,521 +0,0 @@
-# Copyright (C) YEAR This_file_is_part_of_KDE
-# This file is distributed under the same license as the PACKAGE package.
-#
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-msgid ""
-msgstr ""
-"Project-Id-Version: \n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 13:31+0000\n"
-"PO-Revision-Date: 2010-08-09 20:08+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:06+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-
-#: editprofileaction.cpp:30
-msgid "Profiles:"
-msgstr "التشكيلات:"
-
-#: editprofileaction.cpp:36
-msgid "Action templates:"
-msgstr "قوالب الإجراءات:"
-
-#: kcmremotecontrol.cpp:50
-msgid "KRemoteControl"
-msgstr "KRemoteControl"
-
-#: kcmremotecontrol.cpp:51
-msgid "The KDE Remote Control System"
-msgstr "نظام كدي للتحكم عن بعد"
-
-#: kcmremotecontrol.cpp:52
-msgid "2010 Michael Zanetti, 2010 Frank Scheffold"
-msgstr "2010 Michael Zanetti, 2010 Frank Scheffold"
-
-#: kcmremotecontrol.cpp:53
-msgid ""
-"Use this to configure KDE's remote control system in order to control any "
-"KDE application with your remote control."
-msgstr ""
-"استخدم هذا لإعداد نظام كدى للتحكم عن بعد لتتحكم بأي تطبيق كدي بواسطة جهاز "
-"التحكم عن بعد الخاص بك."
-
-#: kcmremotecontrol.cpp:55
-msgid ""
-"<h1>Remote Controls</h1><p>This module allows you to configure bindings "
-"between your remote controls and KDE applications. Simply select your remote "
-"control and click Add next to the Actions/Buttons list to create new action "
-"for button presses.</p>"
-msgstr ""
-"<h1>المتحكمات عن بعد</h1><p>تسمح لك هذه الوحدة بضبط الربط بين  المتحكمات عن "
-"بعد و تطبيقات كدي. ببساطة اختر المتحكم عن بعد و  انقر على أضف إلى قائمة "
-"الأزرار/الإجراءات لإنشاء إجراء جديد لضغطات الزر.</p>"
-
-#: kcmremotecontrol.cpp:247
-msgid ""
-"Are you sure you want to remove this remote and all of its modes and actions?"
-msgstr "هل أنت متأكد من حذف هذا المتحكم و كل أنماطه و إجراءاته ؟"
-
-#: kcmremotecontrol.cpp:247
-msgid "Remove remote"
-msgstr "أزل المتحكم"
-
-#: kcmremotecontrol.cpp:258
-msgid "Are you sure you want to remove this mode and all contained actions?"
-msgstr "هل أنت متأكد من حذف هذا النمط و كل إجراءاته ؟"
-
-#. i18n: file: configurationwidget.ui:147
-#. i18n: ectx: property (toolTip), widget (KPushButton, pbRemoveMode)
-#: kcmremotecontrol.cpp:258 rc.cpp:37 rc.cpp:169
-msgid "Remove mode"
-msgstr "أزل النمط"
-
-#: kcmremotecontrol.cpp:348
-#, kde-format
-msgid "Configured actions for %1:"
-msgstr "اضبط الإجراءات من أجل %1:"
-
-#: kcmremotecontrol.cpp:350
-#, kde-format
-msgid "Configured actions for %1 in mode %2:"
-msgstr "اضبط الإجراءات من أجل %1 في نمط %2:"
-
-#: kcmremotecontrol.cpp:420
-msgid ""
-"The remote control daemon failed to load. Your remote controls will not work."
-msgstr "فشل رقيب المتحكم عن بعد في التحميل، متحكمك عن بعد لن يعمل."
-
-#: kcmremotecontrol.cpp:420
-msgid "Failed to load daemon"
-msgstr "فشل في تحميل الرقيب"
-
-#: modedialog.cpp:47
-msgid "No button"
-msgstr "لا يوجد زر"
-
-#: modedialog.cpp:161
-msgid ""
-"Using the cycle function will remove all duplicate button assignments from "
-"your modes. Are you sure that you would like to proceed?"
-msgstr ""
-"سيزيل استخدام وظيفة الدائرة كل إسنادات الزر المكررة من أنماطك. هل أنت متأكد "
-"أن تريد المتابعة؟"
-
-#: modedialog.cpp:161
-msgid "Change mode switch behavior"
-msgstr "غير سلوك تبديل النمط"
-
-#: modedialog.cpp:173
-msgid "No Button"
-msgstr "لا يوجد زر"
-
-#: model.cpp:55
-msgctxt "Header in a table holding DBus functions"
-msgid "Application / Node"
-msgstr "التطبيق/العقدة"
-
-#: model.cpp:236 model.cpp:772
-msgid "Function"
-msgstr "الوظيفة"
-
-#: model.cpp:238
-msgid "Parameters"
-msgstr "المعاملات"
-
-#: model.cpp:270 model.cpp:549
-msgid "Description"
-msgstr "الوصف"
-
-#: model.cpp:272
-msgid "Value"
-msgstr "القيمة"
-
-#: model.cpp:327
-msgctxt "Value is true"
-msgid "True"
-msgstr "صحيح"
-
-#: model.cpp:328
-msgctxt "Value is false"
-msgid "False"
-msgstr "خاطئ"
-
-#: model.cpp:335 model.cpp:451
-msgid "A comma-separated list of Strings"
-msgstr "فاصلة تفصل بين قائمة سلاسل نصية"
-
-#: model.cpp:485
-msgid "Profile Name"
-msgstr "اسم التشكيلة"
-
-#: model.cpp:492
-#, kde-format
-msgid "Author: %1 (Version: %2)"
-msgstr "المؤلف: %1 (الإصدارة: %2)"
-
-#: model.cpp:547
-msgctxt "Profile name"
-msgid "Name"
-msgstr "الاسم"
-
-#: model.cpp:617
-msgid "Remotes and modes"
-msgstr "المتحكمات و الأنماط"
-
-#: model.cpp:617 model.cpp:772
-msgid "Button"
-msgstr "الزر"
-
-#: model.cpp:772
-msgid "Application"
-msgstr "التطبيق"
-
-#: rc.cpp:131
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr "زايد السعيدي, ,Launchpad Contributions:,Zayed Amer Al-Saidi"
-
-#: rc.cpp:132
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr "zayed.alsaidi@gmail.com,,,zayed.alsaidi@gmail.com"
-
-#. i18n: file: addaction.ui:26
-#. i18n: ectx: property (windowTitle), widget (QWidget, AddAction)
-#. i18n: file: editdbusaction.ui:14
-#. i18n: ectx: property (windowTitle), widget (QWidget, EditDBusAction)
-#. i18n: file: addaction.ui:26
-#. i18n: ectx: property (windowTitle), widget (QWidget, AddAction)
-#. i18n: file: editdbusaction.ui:14
-#. i18n: ectx: property (windowTitle), widget (QWidget, EditDBusAction)
-#: rc.cpp:3 rc.cpp:76 rc.cpp:135 rc.cpp:208
-msgid "Dialog"
-msgstr "مربع الحوار"
-
-#. i18n: file: addaction.ui:32
-#. i18n: ectx: property (text), widget (QLabel, label)
-#: rc.cpp:6 rc.cpp:138
-msgid "How do you wish to create the action?"
-msgstr "كيف ترغب في إنشاء الإجراء؟"
-
-#. i18n: file: addaction.ui:39
-#. i18n: ectx: property (text), widget (QRadioButton, rbTemplate)
-#: rc.cpp:9 rc.cpp:141
-msgid "Create an action using a template"
-msgstr "أنشئ إجراء باستخدام قالب"
-
-#. i18n: file: addaction.ui:56
-#. i18n: ectx: property (text), widget (QLabel, label_3)
-#: rc.cpp:12 rc.cpp:144
-msgid ""
-"Use this if you cannot find a template for the desired action. Here you can "
-"browse the whole D-Bus session bus and execute any function using common "
-"data types.<br>\n"
-"<i>Note that an application must be running in order to be shown here.</i>"
-msgstr ""
-"استخدم هذه إذا لم تستطع العثور على قالب للإجراء الذي ترغب به. هنا يمكنك "
-"تصفحكامل جلسة D-Bus و تنفيذ أي وضيفة باستخدام أنواع البيانات الشائعة .<br>\n"
-"<i>لاحظ أن التطبيق يجب أن يكون يعمل من أجل أن يعرض هنا.</i>"
-
-#. i18n: file: addaction.ui:81
-#. i18n: ectx: property (text), widget (QLabel, label_2)
-#: rc.cpp:16 rc.cpp:148
-msgid ""
-"This is the recommended way if you would like to control the most common "
-"applications. It is the easiest way for adding actions, but also limited to "
-"the available templates."
-msgstr ""
-"هذ الطريقة الموصى بها إذا رغبت أن تتحكم بأغلب التطبيقات ، إنها أسهل طريقة "
-"لإضافة الإجراءات ولكنها محدودة بالقوالب المتوفرة."
-
-#. i18n: file: addaction.ui:94
-#. i18n: ectx: property (text), widget (QRadioButton, rbDBus)
-#: rc.cpp:19 rc.cpp:151
-msgid "Create an action browsing D-Bus"
-msgstr "أنشئ إجراء بتصفح D-Bus"
-
-#. i18n: file: addaction.ui:101
-#. i18n: ectx: property (text), widget (QRadioButton, rbKeypressAction)
-#: rc.cpp:24
-msgid "Create a keypress action"
-msgstr ""
-
-#. i18n: file: addaction.ui:114
-#. i18n: ectx: property (text), widget (QLabel, label_4)
-#: rc.cpp:27
-msgid ""
-"This type of action offers to generate keypress events. You can execute "
-"keyboard shortcuts or type whole sentences with just one button press."
-msgstr ""
-
-#. i18n: file: configurationwidget.ui:15
-#. i18n: ectx: property (windowTitle), widget (QWidget, ConfigurationWidget)
-#: rc.cpp:22 rc.cpp:154
-msgid "Linux Infrared Remote Control"
-msgstr "جهاز لينكس للتحكم عن بعد بالأشعّة تحت الحمراء"
-
-#. i18n: file: configurationwidget.ui:21
-#. i18n: ectx: property (text), widget (QLabel, lNoRemotesWarning)
-#: rc.cpp:25 rc.cpp:157
-msgid ""
-"There are no remote controls available. Please make sure lircd is configured "
-"correctly."
-msgstr "لا يوجد متحكمات عن بعد ، الرجاء تأكد من أن lircd مضبوط بشكل صحيح."
-
-#. i18n: file: configurationwidget.ui:34
-#. i18n: ectx: property (text), widget (QLabel, lRemotes)
-#: rc.cpp:28 rc.cpp:160
-msgid "Available remotes:"
-msgstr "المتحكمات المتوفرة:"
-
-#. i18n: file: configurationwidget.ui:87
-#. i18n: ectx: property (toolTip), widget (KPushButton, pbAddMode)
-#: rc.cpp:31 rc.cpp:163
-msgid "Add mode"
-msgstr "أضف نمط"
-
-#. i18n: file: configurationwidget.ui:125
-#. i18n: ectx: property (toolTip), widget (KPushButton, pbAddAction)
-#: rc.cpp:34 rc.cpp:166
-msgid "Add action"
-msgstr "أضف إجراء"
-
-#. i18n: file: configurationwidget.ui:169
-#. i18n: ectx: property (toolTip), widget (KPushButton, pbRemoveAction)
-#: rc.cpp:40 rc.cpp:172
-msgid "Remove action"
-msgstr "أزل إجراء"
-
-#. i18n: file: configurationwidget.ui:191
-#. i18n: ectx: property (toolTip), widget (KPushButton, pbEditMode)
-#: rc.cpp:43 rc.cpp:175
-msgid "Edit mode"
-msgstr "حرر نمط"
-
-#. i18n: file: configurationwidget.ui:213
-#. i18n: ectx: property (toolTip), widget (KPushButton, pbEditAction)
-#: rc.cpp:46 rc.cpp:178
-msgid "Edit action"
-msgstr "حرر إجراء"
-
-#. i18n: file: configurationwidget.ui:235
-#. i18n: ectx: property (toolTip), widget (KPushButton, pbMoveModeUp)
-#: rc.cpp:49 rc.cpp:181
-msgid "Move mode up"
-msgstr "حرك نمط للأعلى"
-
-#. i18n: file: configurationwidget.ui:257
-#. i18n: ectx: property (toolTip), widget (KPushButton, pbCopyAction)
-#: rc.cpp:52 rc.cpp:184
-msgid "Duplicate action"
-msgstr "كرر إجراء"
-
-#. i18n: file: configurationwidget.ui:279
-#. i18n: ectx: property (toolTip), widget (KPushButton, pbMoveModeDown)
-#: rc.cpp:55 rc.cpp:187
-msgid "Move mode down"
-msgstr "حرك نمط للأسفل"
-
-#. i18n: file: configurationwidget.ui:298
-#. i18n: ectx: property (toolTip), widget (KPushButton, pbAutoPopulate)
-#: rc.cpp:58 rc.cpp:190
-msgid "Automatically create actions using a profile"
-msgstr "أنشئ الإجراءات بشكل آلي باستخدام تشكيلة"
-
-#. i18n: file: configurationwidget.ui:333
-#. i18n: ectx: property (toolTip), widget (KPushButton, pbMoveActionUp)
-#: rc.cpp:61 rc.cpp:193
-msgid "Move action up"
-msgstr "حرّك إجراء للأعلى"
-
-#. i18n: file: configurationwidget.ui:355
-#. i18n: ectx: property (toolTip), widget (KPushButton, pbMoveActionDown)
-#: rc.cpp:64 rc.cpp:196
-msgid "Move action down"
-msgstr "حرّك إجراء للأسفل"
-
-#. i18n: file: configurationwidget.ui:375
-#. i18n: ectx: property (text), widget (QCheckBox, cbTrayIcon)
-#: rc.cpp:67 rc.cpp:199
-msgid "Show tray icon"
-msgstr "أظهر أيقونة الصينية"
-
-#. i18n: file: editactioncontainer.ui:26
-#. i18n: ectx: property (windowTitle), widget (QWidget, ActionContainer)
-#: rc.cpp:70 rc.cpp:202
-msgid "Edit Action"
-msgstr "حرر الإجراء"
-
-#. i18n: file: editactioncontainer.ui:58
-#. i18n: ectx: property (text), widget (QLabel, label)
-#: rc.cpp:73 rc.cpp:205
-msgctxt "Button on the remote control"
-msgid "Button:"
-msgstr "الزر:"
-
-#. i18n: file: editdbusaction.ui:30
-#. i18n: ectx: attribute (title), widget (QWidget, tab)
-#: rc.cpp:79 rc.cpp:211
-msgid "Application and function"
-msgstr "التطبيق و الوظائف"
-
-#. i18n: file: editdbusaction.ui:63
-#. i18n: ectx: property (text), widget (QLabel, lDBusServices)
-#: rc.cpp:82 rc.cpp:214
-msgid "D-Bus Services:"
-msgstr "خدمات D-Bus:"
-
-#. i18n: file: editdbusaction.ui:70
-#. i18n: ectx: property (text), widget (QLabel, lFunctions)
-#: rc.cpp:85 rc.cpp:217
-msgid "Functions:"
-msgstr "الوظائف:"
-
-#. i18n: file: editdbusaction.ui:77
-#. i18n: ectx: property (text), widget (QLabel, label_4)
-#: rc.cpp:88 rc.cpp:220
-msgid "Parameters:"
-msgstr "المعاملات:"
-
-#. i18n: file: editdbusaction.ui:85
-#. i18n: ectx: attribute (title), widget (QWidget, tab_2)
-#: rc.cpp:91 rc.cpp:223
-msgid "Options"
-msgstr "الخيارات"
-
-#. i18n: file: editdbusaction.ui:91
-#. i18n: ectx: property (text), widget (QCheckBox, cbRepeat)
-#: rc.cpp:94 rc.cpp:226
-msgid "Repeat action if button is held down"
-msgstr "كرر الإجراء إذ استمر الضغط للأسفل"
-
-#. i18n: file: editdbusaction.ui:98
-#. i18n: ectx: property (text), widget (QCheckBox, cbAutostart)
-#: rc.cpp:97 rc.cpp:229
-msgid "Start the application if not running"
-msgstr "ابدأ التطبيق إذا لم يكن يعمل"
-
-#. i18n: file: editdbusaction.ui:114
-#. i18n: ectx: property (text), widget (QLabel, label)
-#: rc.cpp:100 rc.cpp:232
-msgid "If multiple instances of this application are running..."
-msgstr "إذا كان هناك عدة نسخ من التطبيق تعمل..."
-
-#. i18n: file: editdbusaction.ui:121
-#. i18n: ectx: property (text), widget (QRadioButton, rbTop)
-#: rc.cpp:103 rc.cpp:235
-msgid "send the action to the top-level instance"
-msgstr "أرسل الإجراء إلى النسخة التي في الأعلى"
-
-#. i18n: file: editdbusaction.ui:128
-#. i18n: ectx: property (text), widget (QRadioButton, rbBottom)
-#: rc.cpp:106 rc.cpp:238
-msgid "send the action to the lowest instance"
-msgstr "أرسل الإجراء إلى أخفض نسخة"
-
-#. i18n: file: editdbusaction.ui:135
-#. i18n: ectx: property (text), widget (QRadioButton, rbAll)
-#: rc.cpp:109 rc.cpp:241
-msgid "send the action to all instances"
-msgstr "أرسل الإجراء إلى كل النسخ"
-
-#. i18n: file: editdbusaction.ui:142
-#. i18n: ectx: property (text), widget (QRadioButton, rbNone)
-#: rc.cpp:112 rc.cpp:244
-msgid "do not send the action"
-msgstr "لا ترسل الإجراء"
-
-#. i18n: file: editkeypressaction.ui:27
-#. i18n: ectx: property (title), widget (QGroupBox, groupBox)
-#: rc.cpp:126
-msgid "Keypresses to be generated"
-msgstr ""
-
-#. i18n: file: editkeypressaction.ui:47
-#. i18n: ectx: property (text), widget (QPushButton, pbAdd)
-#: rc.cpp:129
-msgid "&Add"
-msgstr ""
-
-#. i18n: file: editkeypressaction.ui:54
-#. i18n: ectx: property (text), widget (QPushButton, pbRemove)
-#: rc.cpp:132
-msgid "&Remove"
-msgstr ""
-
-#. i18n: file: editkeypressaction.ui:61
-#. i18n: ectx: property (text), widget (QPushButton, pbUp)
-#: rc.cpp:135
-msgid "Move Up"
-msgstr ""
-
-#. i18n: file: editkeypressaction.ui:68
-#. i18n: ectx: property (text), widget (QPushButton, pbDown)
-#: rc.cpp:138
-msgid "Move Down"
-msgstr ""
-
-#. i18n: file: modedialog.ui:14
-#. i18n: ectx: property (windowTitle), widget (QWidget, ModeDialog)
-#: rc.cpp:115 rc.cpp:247
-msgid "New Mode"
-msgstr "نمط جديد"
-
-#. i18n: file: modedialog.ui:41
-#. i18n: ectx: property (text), widget (QCheckBox, cbSetDefault)
-#: rc.cpp:118 rc.cpp:250
-msgid "Set mode as default"
-msgstr "ضع النمط كالافتراضي"
-
-#. i18n: file: modedialog.ui:53
-#. i18n: ectx: property (text), widget (QLabel, lButton)
-#: rc.cpp:121 rc.cpp:253
-msgid "Button:"
-msgstr "الزر:"
-
-#. i18n: file: modedialog.ui:63
-#. i18n: ectx: property (title), widget (QGroupBox, gbModeCycle)
-#: rc.cpp:124 rc.cpp:256
-msgid "Enable mode cycling (disables mode grouping)"
-msgstr "مكن وضع التدوير (عطل نمط التجميع)"
-
-#. i18n: file: modedialog.ui:72
-#. i18n: ectx: property (text), widget (QLabel, lCycleForward)
-#: rc.cpp:127 rc.cpp:259
-msgid "Forward button"
-msgstr "زر إلى الأمام"
-
-#. i18n: file: modedialog.ui:79
-#. i18n: ectx: property (text), widget (QLabel, lCycleBackward)
-#: rc.cpp:130 rc.cpp:262
-msgid "Backward button"
-msgstr "زر إلى الخلف"
-
-#: selectprofile.cpp:32
-msgid ""
-"Select a profile to automatically generate actions for your remote control:"
-msgstr "اختر تشكيلة لتوليد الإجراءات بشكل آلي لمتحكمك عن بعد:"
-
-#: selectprofile.cpp:35
-msgid "Available profiles"
-msgstr "التشكيلات المتوفرة"
-
-#: selectprofile.cpp:49
-msgid "Auto-Populate"
-msgstr "الملء التلقائي"
-
-#: selectprofile.cpp:88
-msgid "Remote supports all defined buttons in selected profile"
-msgstr "أزل الدعم عن جميع الأزرار المعرفة في التشكيلة المختارة"
-
-#: selectprofile.cpp:92
-msgid "Remote does not support all defined buttons in selected profile"
-msgstr "المتحكم لا يدعم الأزرار المعرفة في التشكيلة المختارة"
-
-#: selectprofile.cpp:96
-msgid "Remote supports none of the defined buttons in selected profile"
-msgstr "لا يدعم المتحكم أيا من الأزرار المعرفة في التشكيلة المختارة"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmsamba.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmsamba.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmsamba.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmsamba.po	2012-03-23 06:42:03.000000000 +0000
@@ -8,21 +8,21 @@
 # AbdulAziz AlSharif <a.a-a.s@hotmail.com>, 2007.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kcmsamba\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2011-12-12 19:58+0000\n"
+"PO-Revision-Date: 2012-03-14 17:12+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:48+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:59+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kcmsambaimports.cpp:44 ksmbstatus.cpp:51
 msgid "Type"
@@ -320,7 +320,7 @@
 
 #: main.cpp:76
 msgid "System Information Control Module"
-msgstr ""
+msgstr "وحدة مركز التحكم لمعلومات النظام"
 
 #: main.cpp:79
 msgid "(c) 2002 KDE Information Control Module Samba Team"
@@ -354,12 +354,12 @@
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
 msgstr ""
-"Mohamed SAAD محمد سعد,زايد السعيدي, ,Launchpad Contributions:,Mohammad "
-"Gamal,Youssef Chahibi,Zayed Amer Al-Saidi,metehyi"
+"Mohamed SAAD محمد سعد,زايد السعيدي, ,Launchpad Contributions:,Abdalrahim G. "
+"Fakhouri,Mohammad Gamal,Youssef Chahibi,Zayed Amer Al-Saidi,metehyi"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
 msgstr ""
-"metehyi@free.fr,zayed.alsaidi@gmail.com,,,f2c2001@yahoo.com,,zayed.alsaidi@gm"
-"ail.com,"
+"metehyi@free.fr,zayed.alsaidi@gmail.com,,,,f2c2001@yahoo.com,,zayed.alsaidi@g"
+"mail.com,"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmscreensaver.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmscreensaver.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmscreensaver.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmscreensaver.po	2012-03-23 06:42:03.000000000 +0000
@@ -15,18 +15,17 @@
 "Project-Id-Version: kcmscreensaver\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:14+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-14 17:13+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:49+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:01+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: category_list.cpp:7
 msgctxt "Screen saver category"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmshell.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmshell.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmshell.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmshell.po	2012-03-23 06:41:57.000000000 +0000
@@ -15,11 +15,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:47+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:49+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: main.cpp:161
 msgid "KDE Control Module"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmsmartcard.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmsmartcard.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmsmartcard.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmsmartcard.po	2012-03-23 06:42:03.000000000 +0000
@@ -14,16 +14,15 @@
 "Project-Id-Version: kcmsmartcard\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2011-12-12 19:29+0000\n"
+"PO-Revision-Date: 2012-03-14 17:13+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:50+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:01+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: rc.cpp:55
 msgctxt "NAME OF TRANSLATORS"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmsmserver.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmsmserver.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmsmserver.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmsmserver.po	2012-03-23 06:42:03.000000000 +0000
@@ -16,14 +16,14 @@
 "Project-Id-Version: kcmsmserver\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:14+0000\n"
+"PO-Revision-Date: 2012-03-12 22:26+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:51+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:02+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: kcmsmserver.cpp:52
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_solid_actions.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_solid_actions.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_solid_actions.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_solid_actions.po	2012-03-23 06:42:02.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:30+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:49+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: ActionEditor.cpp:71
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_solid.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_solid.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_solid.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_solid.po	2012-03-23 06:42:02.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:29+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:49+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kcmsolid.cpp:45
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_standard_actions.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_standard_actions.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcm_standard_actions.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcm_standard_actions.po	2012-03-23 06:42:02.000000000 +0000
@@ -5,34 +5,37 @@
 # Amine Roukh <amineroukh@gmail.com>, 2008.
 # Amine ROUKH <amineroukh@gmail.com>, 2008.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kcm_standard_actions\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2011-07-14 19:28+0000\n"
-"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
+"PO-Revision-Date: 2012-03-12 22:26+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:31+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:49+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: rc.cpp:1
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
-msgstr " ,Launchpad Contributions:,Zayed Amer Al-Saidi"
+msgstr ""
+"Abdalrahim Fakhouri, ,Launchpad Contributions:,Abdalrahim G. Fakhouri,Zayed "
+"Amer Al-Saidi"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr ",,zayed.alsaidi@gmail.com"
+msgstr "abdilra7eem@yahoo.com,,,,zayed.alsaidi@gmail.com"
 
 #: standard_actions_module.cpp:67
 msgid "Standard Shortcuts"
-msgstr ""
+msgstr "الاختصارات القياسيّة"
 
 #: standard_actions_module.cpp:135
 msgid "Standard Actions successfully saved"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmstyle.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmstyle.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmstyle.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmstyle.po	2012-03-23 06:42:03.000000000 +0000
@@ -17,14 +17,14 @@
 "Project-Id-Version: kcmstyle\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:13+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-14 17:12+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:51+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:02+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: kcmstyle.cpp:165
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmusb.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmusb.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmusb.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmusb.po	2012-03-23 06:42:03.000000000 +0000
@@ -13,16 +13,15 @@
 "Project-Id-Version: kcmusb\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2011-12-12 19:57+0000\n"
+"PO-Revision-Date: 2012-03-14 17:07+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:52+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:02+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kcmusb.cpp:39
 msgid ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmview1394.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmview1394.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmview1394.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmview1394.po	2012-03-23 06:42:03.000000000 +0000
@@ -19,10 +19,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:53+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:03+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #. i18n: file: view1394widget.ui:20
 #. i18n: ectx: property (text), widget (QTreeWidget, m_listview)
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmworkspaceoptions.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmworkspaceoptions.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmworkspaceoptions.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmworkspaceoptions.po	2012-03-23 06:42:03.000000000 +0000
@@ -1,20 +1,21 @@
 # Copyright (C) YEAR This_file_is_part_of_KDE
 # This file is distributed under the same license as the PACKAGE package.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
 #
+# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: \n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:13+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-12 22:26+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:54+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:03+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: rc.cpp:22
@@ -69,7 +70,7 @@
 #. i18n: ectx: property (text), widget (QLabel, tooltipDelayLabel)
 #: rc.cpp:21 rc.cpp:44
 msgid "Show Informational Tips:"
-msgstr ""
+msgstr "أظهر التلميحات المعلوماتية:"
 
 #: workspaceoptions.cpp:48
 msgid "Global options for the Plasma Workspace"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmxinerama.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmxinerama.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcmxinerama.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcmxinerama.po	2012-03-23 06:42:03.000000000 +0000
@@ -13,14 +13,14 @@
 "Project-Id-Version: kcmxinerama\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2011-12-12 19:46+0000\n"
+"PO-Revision-Date: 2012-03-14 17:03+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:54+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:04+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: kcmxinerama.cpp:55
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcolorchooser.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcolorchooser.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcolorchooser.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcolorchooser.po	2012-03-23 06:42:06.000000000 +0000
@@ -3,25 +3,25 @@
 # This file is distributed under the same license as the PACKAGE package.
 #
 # Mohammed Berdai <stuntgp2000@gmail.com>, 2008.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kcolorchooser\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-09 14:21+0000\n"
-"PO-Revision-Date: 2009-03-05 11:11+0000\n"
+"PO-Revision-Date: 2012-03-12 22:23+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:17+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:53+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kcolorchooser.cpp:34
 msgid "KDE Color Chooser"
-msgstr "مختار اللون لكيدي"
+msgstr "مختار اللون لكدي"
 
 #: kcolorchooser.cpp:41
 msgid "KColorChooser"
@@ -41,14 +41,14 @@
 
 #: kcolorchooser.cpp:51
 msgid "Set initially selected color"
-msgstr ""
+msgstr "ضع بشكل مبدئي اللون المختار"
 
 #: rc.cpp:1
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
-msgstr "زايد السعيدي, ,Launchpad Contributions:"
+msgstr "زايد السعيدي, ,Launchpad Contributions:,Zayed Amer Al-Saidi"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "zayed.alsaidi@gmail.com,,"
+msgstr "zayed.alsaidi@gmail.com,,,zayed.alsaidi@gmail.com"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcron.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcron.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kcron.po	2012-02-23 06:20:06.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kcron.po	2012-03-23 06:41:37.000000000 +0000
@@ -13,7 +13,7 @@
 "Project-Id-Version: kcron\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 02:38+0000\n"
-"PO-Revision-Date: 2012-01-25 11:26+0000\n"
+"PO-Revision-Date: 2012-03-12 22:22+0000\n"
 "Last-Translator: Youssef Chahibi <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
@@ -21,8 +21,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:31+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:39+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: src/kcmCron.cpp:75
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdeasciiquarium.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdeasciiquarium.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdeasciiquarium.po	2012-02-23 06:20:06.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdeasciiquarium.po	2012-03-23 06:41:38.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:35+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:42+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: aasaver.cpp:1386 aasaver.cpp:1387
 msgid "KDE Asciiquarium"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdebugdialog.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdebugdialog.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdebugdialog.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdebugdialog.po	2012-03-23 06:41:57.000000000 +0000
@@ -9,21 +9,21 @@
 # AbdulAziz AlSharif <a.a-a.s@hotmail.com>, 2007.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kdebugdialog\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2011-12-12 19:29+0000\n"
+"PO-Revision-Date: 2012-03-14 17:32+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:48+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:50+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kdebugdialog.cpp:42 klistdebugdialog.cpp:36
 msgid "Debug Settings"
@@ -85,7 +85,7 @@
 
 #: kdebugdialog.cpp:192 klistdebugdialog.cpp:76
 msgid "Disable all debug output"
-msgstr ""
+msgstr "عطّل كلّ مخرجات تعقّب العلل"
 
 #: klistdebugdialog.cpp:67
 msgid "&Select All"
@@ -105,7 +105,7 @@
 
 #: main.cpp:100
 msgid "Copyright 1999-2009, David Faure <email>faure@kde.org</email>"
-msgstr ""
+msgstr "Copyright 1999-2009, David Faure <email>faure@kde.org</email>"
 
 #: main.cpp:101
 msgid "David Faure"
@@ -130,9 +130,10 @@
 #: rc.cpp:1
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
-msgstr "Mohamed SAAD محمد سعد, ,Launchpad Contributions:"
+msgstr ""
+"Mohamed SAAD محمد سعد, ,Launchpad Contributions:,Abdalrahim G. Fakhouri"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "metehyi@free.fr,,"
+msgstr "metehyi@free.fr,,,"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdecalendarsystems.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdecalendarsystems.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdecalendarsystems.po	2012-02-23 06:20:15.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdecalendarsystems.po	2012-03-23 06:41:46.000000000 +0000
@@ -1,6 +1,7 @@
 # translation of kdelibs4.po to Arabic
 # translation of kdelibs4.po to
 # Copyright (C) 2001-2003, 2004, 2006, 2007, 2008, 2009 Free Software Foundation, Inc.
+#
 # Isam Bayazidi <bayazidi@arabeyes.org>, 2001,2003.
 # Sayed Jaffer Al-Mosawi <mosawi@arabeyes.org>, 2002.
 # Hicham Amaoui <amaoui@wanadoo.fr>, 2002.
@@ -14,20 +15,20 @@
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008, 2009.
 # Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009, 2010.
-#
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kdelibs4\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 13:46+0000\n"
-"PO-Revision-Date: 2011-01-26 04:18+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-12 23:04+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 22:45+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:08+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kcalendarsystemethiopian.cpp:54
@@ -2251,42 +2252,42 @@
 #: kcalendarsystemjulian.cpp:379
 msgctxt "Julian weekday 7 - KLocale::ShortName"
 msgid "Sun"
-msgstr ""
+msgstr "أحد"
 
 #: kcalendarsystemjulian.cpp:386
 msgctxt "Julian weekday 1 - KLocale::LongName"
 msgid "Monday"
-msgstr ""
+msgstr "الإثنين"
 
 #: kcalendarsystemjulian.cpp:388
 msgctxt "Julian weekday 2 - KLocale::LongName"
 msgid "Tuesday"
-msgstr ""
+msgstr "الثلاثاء"
 
 #: kcalendarsystemjulian.cpp:390
 msgctxt "Julian weekday 3 - KLocale::LongName"
 msgid "Wednesday"
-msgstr ""
+msgstr "الأربعاء"
 
 #: kcalendarsystemjulian.cpp:392
 msgctxt "Julian weekday 4 - KLocale::LongName"
 msgid "Thursday"
-msgstr ""
+msgstr "الخميس"
 
 #: kcalendarsystemjulian.cpp:394
 msgctxt "Julian weekday 5 - KLocale::LongName"
 msgid "Friday"
-msgstr ""
+msgstr "الجمعة"
 
 #: kcalendarsystemjulian.cpp:396
 msgctxt "Julian weekday 6 - KLocale::LongName"
 msgid "Saturday"
-msgstr ""
+msgstr "السبت"
 
 #: kcalendarsystemjulian.cpp:398
 msgctxt "Julian weekday 7 - KLocale::LongName"
 msgid "Sunday"
-msgstr ""
+msgstr "الأحد"
 
 #: kcalendarsystemminguo.cpp:61
 msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, LongFormat"
@@ -2385,77 +2386,77 @@
 #: kcalendarsystemislamiccivil.cpp:211
 msgctxt "Hijri month 1 - KLocale::ShortName Possessive"
 msgid "of Muh"
-msgstr ""
+msgstr "من محرّم"
 
 #: kcalendarsystemislamiccivil.cpp:213
 msgctxt "Hijri month 2 - KLocale::ShortName Possessive"
 msgid "of Saf"
-msgstr ""
+msgstr "من صفر"
 
 #: kcalendarsystemislamiccivil.cpp:215
 msgctxt "Hijri month 3 - KLocale::ShortName Possessive"
 msgid "of R.A"
-msgstr ""
+msgstr "من ربيع الأوّل"
 
 #: kcalendarsystemislamiccivil.cpp:217
 msgctxt "Hijri month 4 - KLocale::ShortName Possessive"
 msgid "of R.T"
-msgstr ""
+msgstr "من ربيع الثّاني"
 
 #: kcalendarsystemislamiccivil.cpp:219
 msgctxt "Hijri month 5 - KLocale::ShortName Possessive"
 msgid "of J.A"
-msgstr ""
+msgstr "من جمادى الأوّل"
 
 #: kcalendarsystemislamiccivil.cpp:221
 msgctxt "Hijri month 6 - KLocale::ShortName Possessive"
 msgid "of J.T"
-msgstr ""
+msgstr "من جمادى الثّاني"
 
 #: kcalendarsystemislamiccivil.cpp:223
 msgctxt "Hijri month 7 - KLocale::ShortName Possessive"
 msgid "of Raj"
-msgstr ""
+msgstr "من رجب"
 
 #: kcalendarsystemislamiccivil.cpp:225
 msgctxt "Hijri month 8 - KLocale::ShortName Possessive"
 msgid "of Sha"
-msgstr ""
+msgstr "من شعبان"
 
 #: kcalendarsystemislamiccivil.cpp:227
 msgctxt "Hijri month 9 - KLocale::ShortName Possessive"
 msgid "of Ram"
-msgstr ""
+msgstr "من رمضان"
 
 #: kcalendarsystemislamiccivil.cpp:229
 msgctxt "Hijri month 10 - KLocale::ShortName Possessive"
 msgid "of Shw"
-msgstr ""
+msgstr "من شوّال"
 
 #: kcalendarsystemislamiccivil.cpp:231
 msgctxt "Hijri month 11 - KLocale::ShortName Possessive"
 msgid "of Qid"
-msgstr ""
+msgstr "من ذي القعدة"
 
 #: kcalendarsystemislamiccivil.cpp:233
 msgctxt "Hijri month 12 - KLocale::ShortName Possessive"
 msgid "of Hij"
-msgstr ""
+msgstr "من ذي الحجّة"
 
 #: kcalendarsystemislamiccivil.cpp:242
 msgctxt "Hijri month 1 - KLocale::ShortName"
 msgid "Muh"
-msgstr ""
+msgstr "محرّم"
 
 #: kcalendarsystemislamiccivil.cpp:244
 msgctxt "Hijri month 2 - KLocale::ShortName"
 msgid "Saf"
-msgstr ""
+msgstr "صفر"
 
 #: kcalendarsystemislamiccivil.cpp:246
 msgctxt "Hijri month 3 - KLocale::ShortName"
 msgid "R.A"
-msgstr ""
+msgstr "ربيع الأوّل"
 
 #: kcalendarsystemislamiccivil.cpp:248
 msgctxt "Hijri month 4 - KLocale::ShortName"
@@ -2465,7 +2466,7 @@
 #: kcalendarsystemislamiccivil.cpp:250
 msgctxt "Hijri month 5 - KLocale::ShortName"
 msgid "J.A"
-msgstr ""
+msgstr "جمادى الأوّل"
 
 #: kcalendarsystemislamiccivil.cpp:252
 msgctxt "Hijri month 6 - KLocale::ShortName"
@@ -2475,152 +2476,152 @@
 #: kcalendarsystemislamiccivil.cpp:254
 msgctxt "Hijri month 7 - KLocale::ShortName"
 msgid "Raj"
-msgstr ""
+msgstr "رجب"
 
 #: kcalendarsystemislamiccivil.cpp:256
 msgctxt "Hijri month 8 - KLocale::ShortName"
 msgid "Sha"
-msgstr ""
+msgstr "شعبان"
 
 #: kcalendarsystemislamiccivil.cpp:258
 msgctxt "Hijri month 9 - KLocale::ShortName"
 msgid "Ram"
-msgstr ""
+msgstr "رمضان"
 
 #: kcalendarsystemislamiccivil.cpp:260
 msgctxt "Hijri month 10 - KLocale::ShortName"
 msgid "Shw"
-msgstr ""
+msgstr "شوّال"
 
 #: kcalendarsystemislamiccivil.cpp:262
 msgctxt "Hijri month 11 - KLocale::ShortName"
 msgid "Qid"
-msgstr ""
+msgstr "ذو القعدة"
 
 #: kcalendarsystemislamiccivil.cpp:264
 msgctxt "Hijri month 12 - KLocale::ShortName"
 msgid "Hij"
-msgstr ""
+msgstr "هجري"
 
 #: kcalendarsystemislamiccivil.cpp:273
 msgctxt "Hijri month 1 - KLocale::LongName Possessive"
 msgid "of Muharram"
-msgstr ""
+msgstr "من محرّم"
 
 #: kcalendarsystemislamiccivil.cpp:275
 msgctxt "Hijri month 2 - KLocale::LongName Possessive"
 msgid "of Safar"
-msgstr ""
+msgstr "من صفر"
 
 #: kcalendarsystemislamiccivil.cpp:277
 msgctxt "Hijri month 3 - KLocale::LongName Possessive"
 msgid "of Rabi` al-Awal"
-msgstr ""
+msgstr "من ربيع الأوّل"
 
 #: kcalendarsystemislamiccivil.cpp:279
 msgctxt "Hijri month 4 - KLocale::LongName Possessive"
 msgid "of Rabi` al-Thaani"
-msgstr ""
+msgstr "من ربيع الثّاني"
 
 #: kcalendarsystemislamiccivil.cpp:281
 msgctxt "Hijri month 5 - KLocale::LongName Possessive"
 msgid "of Jumaada al-Awal"
-msgstr ""
+msgstr "من جمادى الأولى"
 
 #: kcalendarsystemislamiccivil.cpp:283
 msgctxt "Hijri month 6 - KLocale::LongName Possessive"
 msgid "of Jumaada al-Thaani"
-msgstr ""
+msgstr "من جمادى الثّانية"
 
 #: kcalendarsystemislamiccivil.cpp:285
 msgctxt "Hijri month 7 - KLocale::LongName Possessive"
 msgid "of Rajab"
-msgstr ""
+msgstr "من رجب"
 
 #: kcalendarsystemislamiccivil.cpp:287
 msgctxt "Hijri month 8 - KLocale::LongName Possessive"
 msgid "of Sha`ban"
-msgstr ""
+msgstr "من شعبان"
 
 #: kcalendarsystemislamiccivil.cpp:289
 msgctxt "Hijri month 9 - KLocale::LongName Possessive"
 msgid "of Ramadan"
-msgstr ""
+msgstr "من رمضان"
 
 #: kcalendarsystemislamiccivil.cpp:291
 msgctxt "Hijri month 10 - KLocale::LongName Possessive"
 msgid "of Shawwal"
-msgstr ""
+msgstr "من شوّال"
 
 #: kcalendarsystemislamiccivil.cpp:293
 msgctxt "Hijri month 11 - KLocale::LongName Possessive"
 msgid "of Thu al-Qi`dah"
-msgstr ""
+msgstr "من ذي القعدة"
 
 #: kcalendarsystemislamiccivil.cpp:295
 msgctxt "Hijri month 12 - KLocale::LongName Possessive"
 msgid "of Thu al-Hijjah"
-msgstr ""
+msgstr "من ذي الحجّة"
 
 #: kcalendarsystemislamiccivil.cpp:304
 msgctxt "Hijri month 1 - KLocale::LongName"
 msgid "Muharram"
-msgstr ""
+msgstr "محرّم"
 
 #: kcalendarsystemislamiccivil.cpp:306
 msgctxt "Hijri month 2 - KLocale::LongName"
 msgid "Safar"
-msgstr ""
+msgstr "صفر"
 
 #: kcalendarsystemislamiccivil.cpp:308
 msgctxt "Hijri month 3 - KLocale::LongName"
 msgid "Rabi` al-Awal"
-msgstr ""
+msgstr "ربيع الأوّل"
 
 #: kcalendarsystemislamiccivil.cpp:310
 msgctxt "Hijri month 4 - KLocale::LongName"
 msgid "Rabi` al-Thaani"
-msgstr ""
+msgstr "ربيع الثّاني"
 
 #: kcalendarsystemislamiccivil.cpp:312
 msgctxt "Hijri month 5 - KLocale::LongName"
 msgid "Jumaada al-Awal"
-msgstr ""
+msgstr "جمادى الأولى"
 
 #: kcalendarsystemislamiccivil.cpp:314
 msgctxt "Hijri month 6 - KLocale::LongName"
 msgid "Jumaada al-Thaani"
-msgstr ""
+msgstr "جمادى الثّانية"
 
 #: kcalendarsystemislamiccivil.cpp:316
 msgctxt "Hijri month 7 - KLocale::LongName"
 msgid "Rajab"
-msgstr ""
+msgstr "رجب"
 
 #: kcalendarsystemislamiccivil.cpp:318
 msgctxt "Hijri month 8 - KLocale::LongName"
 msgid "Sha`ban"
-msgstr ""
+msgstr "شعبان"
 
 #: kcalendarsystemislamiccivil.cpp:320
 msgctxt "Hijri month 9 - KLocale::LongName"
 msgid "Ramadan"
-msgstr ""
+msgstr "رمضان"
 
 #: kcalendarsystemislamiccivil.cpp:322
 msgctxt "Hijri month 10 - KLocale::LongName"
 msgid "Shawwal"
-msgstr ""
+msgstr "شوّال"
 
 #: kcalendarsystemislamiccivil.cpp:324
 msgctxt "Hijri month 11 - KLocale::LongName"
 msgid "Thu al-Qi`dah"
-msgstr ""
+msgstr "ذو القعدة"
 
 #: kcalendarsystemislamiccivil.cpp:326
 msgctxt "Hijri month 12 - KLocale::LongName"
 msgid "Thu al-Hijjah"
-msgstr ""
+msgstr "ذو الحجّة"
 
 #: kcalendarsystemislamiccivil.cpp:337
 msgctxt "Hijri weekday 1 - KLocale::NarrowName "
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdelibs4.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdelibs4.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdelibs4.po	2012-02-23 06:20:16.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdelibs4.po	2012-03-23 06:41:47.000000000 +0000
@@ -14,36 +14,38 @@
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008, 2009.
 # Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
-#
+# hanny <hannysabbagh@hotmail.com>, 2012.
+# Abderrahim Kitouni <a.kitouni@gmail.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kdelibs4\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 13:46+0000\n"
-"PO-Revision-Date: 2011-01-05 22:03+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"PO-Revision-Date: 2012-03-12 23:04+0000\n"
+"Last-Translator: Abderrahim Kitouni <a.kitouni@gmail.com>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 22:47+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:09+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: rc.cpp:1
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
 msgstr ""
-"زايد السعيدي, ,Launchpad Contributions:,Ahmed Mohammed,Dilmi Fethi,Youssef "
-"Chahibi,Zayed Amer Al-Saidi"
+"زايد السعيدي,محمد هاني صباغ, ,Launchpad Contributions:,Abderrahim "
+"Kitouni,Ahmed Mohammed,Dilmi Fethi,Youssef Chahibi,Zayed Amer Al-Saidi"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
 msgstr ""
-"zayed.alsaidi@gmail.com,,,,delphiexile@gmail.com,,zayed.alsaidi@gmail.com"
+"zayed.alsaidi@gmail.com,hannysabbagh@hotmail.com,,,a.kitouni@gmail.com,,delph"
+"iexile@gmail.com,,zayed.alsaidi@gmail.com"
 
 #. i18n: file: nepomuk/utils/daterangeselectionwidget.ui:33
 #. i18n: ectx: property (text), widget (QToolButton, m_anytimeButton)
@@ -117,7 +119,7 @@
 #: rc.cpp:21
 #: obj-sparc-linux-gnu/knotify/config/ui_knotifyconfigactionswidgetbase.h:156
 msgid "Select the command to run"
-msgstr "اختر أمر لتشغيله"
+msgstr "اختر أمرًا لتشغيله"
 
 #. i18n: file: knotify/config/knotifyconfigactionswidgetbase.ui:106
 #. i18n: ectx: property (text), widget (QCheckBox, KTTS_check)
@@ -475,7 +477,7 @@
 #. i18n: ectx: property (toolTip), widget (KLineEdit, mNameEdit)
 #: rc.cpp:835 obj-i686-linux-gnu/knewstuff/knewstuff3/ui_uploaddialog.h:651
 msgid "Name of the file as it will appear on the website"
-msgstr ""
+msgstr "اسم الملف كما سيظهر على الموقع"
 
 #. i18n: file: knewstuff/knewstuff3/uploaddialog.ui:313
 #. i18n: ectx: property (whatsThis), widget (KLineEdit, mNameEdit)
@@ -508,7 +510,7 @@
 #. i18n: ectx: property (text), widget (QCheckBox, priceCheckBox)
 #: rc.cpp:173 obj-sparc-linux-gnu/knewstuff/knewstuff3/ui_uploaddialog.h:266
 msgid "Set a price for this item"
-msgstr "ضع سعر لهذا العنصر"
+msgstr "ضع سعرًا لهذا العنصر"
 
 #. i18n: file: knewstuff/knewstuff3/uploaddialog.ui:436
 #. i18n: ectx: property (title), widget (QGroupBox, priceGroupBox)
@@ -2333,7 +2335,7 @@
 #: nepomuk/ui/kedittagsdialog.cpp:219
 msgctxt "@action:button"
 msgid "Delete"
-msgstr ""
+msgstr "احذف"
 
 #: nepomuk/ui/kedittagsdialog.cpp:220
 msgctxt "@action:button"
@@ -2410,7 +2412,7 @@
 
 #: nepomuk/rcgen/rcgen.cpp:76
 msgid "Templates to be used (deprecated)."
-msgstr ""
+msgstr "القوالب ليتم إستخدامها (مُهمل)"
 
 #: nepomuk/rcgen/rcgen.cpp:77
 msgid ""
@@ -2444,11 +2446,11 @@
 
 #: nepomuk/utils/daterangeselectionwidget.cpp:201
 msgid "This Week"
-msgstr ""
+msgstr "هذا الأسبوع"
 
 #: nepomuk/utils/daterangeselectionwidget.cpp:206
 msgid "This Month"
-msgstr ""
+msgstr "هذا الشهر:"
 
 #: nepomuk/utils/typefacet.cpp:64 nepomuk/utils/facet.cpp:132
 msgctxt "@option:check A filter on file type"
@@ -2458,7 +2460,7 @@
 #: nepomuk/utils/typefacet.cpp:68 nepomuk/utils/facet.cpp:136
 msgctxt "@option:check A filter on file type - audio files"
 msgid "Audio"
-msgstr ""
+msgstr "صوت"
 
 #: nepomuk/utils/typefacet.cpp:71 nepomuk/utils/facet.cpp:139
 msgctxt "@option:check A filter on file type - media video"
@@ -2486,13 +2488,13 @@
 msgctxt ""
 "@option:radio A filter on prioritizing/sorting a selection of resources"
 msgid "Most important"
-msgstr ""
+msgstr "الأكثر أهمية"
 
 #: nepomuk/utils/facet.cpp:182
 msgctxt ""
 "@option:radio A filter on prioritizing/sorting a selection of resources"
 msgid "Never opened"
-msgstr ""
+msgstr "لم يُفتح مطلقا"
 
 #: nepomuk/utils/facet.cpp:192
 msgctxt "@option:radio A filter on the rating of a resource"
@@ -2502,22 +2504,22 @@
 #: nepomuk/utils/facet.cpp:193
 msgctxt "@option:radio A filter on the rating of a resource"
 msgid "1 or more"
-msgstr ""
+msgstr "1 أو أكثر"
 
 #: nepomuk/utils/facet.cpp:194
 msgctxt "@option:radio A filter on the rating of a resource"
 msgid "2 or more"
-msgstr ""
+msgstr "2 أو أكثر"
 
 #: nepomuk/utils/facet.cpp:195
 msgctxt "@option:radio A filter on the rating of a resource"
 msgid "3 or more"
-msgstr ""
+msgstr "3 أو أكثر"
 
 #: nepomuk/utils/facet.cpp:196
 msgctxt "@option:radio A filter on the rating of a resource"
 msgid "4 or more"
-msgstr ""
+msgstr "4 أو أكثر"
 
 #: nepomuk/utils/facet.cpp:197
 msgctxt "@option:radio A filter on the rating of a resource"
@@ -2583,7 +2585,7 @@
 msgctxt ""
 "referring to a filter on the modification and usage date of files/resources"
 msgid "Anytime"
-msgstr ""
+msgstr "أي وقت"
 
 #: nepomuk/utils/datefacet.cpp:121
 msgctxt ""
@@ -2601,7 +2603,7 @@
 msgctxt ""
 "referring to a filter on the modification and usage date of files/resources"
 msgid "This Week"
-msgstr ""
+msgstr "هذا الأسبوع"
 
 #: nepomuk/utils/datefacet.cpp:127
 msgctxt ""
@@ -2613,7 +2615,7 @@
 msgctxt ""
 "referring to a filter on the modification and usage date of files/resources"
 msgid "This Month"
-msgstr ""
+msgstr "هذا الشهر"
 
 #: nepomuk/utils/datefacet.cpp:131
 msgctxt ""
@@ -2625,7 +2627,7 @@
 msgctxt ""
 "referring to a filter on the modification and usage date of files/resources"
 msgid "This Year"
-msgstr ""
+msgstr "هذه السنة"
 
 #: nepomuk/utils/datefacet.cpp:135
 msgctxt ""
@@ -2664,12 +2666,12 @@
 "@title UDS_DISPLAY_NAME for a KIO directory listing. %1 is the query the "
 "user entered."
 msgid "Query Results from '%1'"
-msgstr ""
+msgstr "نتائج الإستعلام من '%1'"
 
 #: nepomuk/query/query.cpp:695
 msgctxt "@title UDS_DISPLAY_NAME for a KIO directory listing."
 msgid "Query Results"
-msgstr ""
+msgstr "نتائج الاستعلام"
 
 #: nepomuk/core/resource.cpp:509
 msgid "Success"
@@ -2843,11 +2845,11 @@
 
 #: knewstuff/knewstuff2/ui/uploaddialog.cpp:162
 msgid "Fill Out"
-msgstr "أملئ"
+msgstr "املأ"
 
 #: knewstuff/knewstuff2/ui/uploaddialog.cpp:163
 msgid "Do Not Fill Out"
-msgstr "لا تملئ"
+msgstr "لا تملأ"
 
 #: knewstuff/knewstuff2/ui/kdxscomments.cpp:32
 msgid "User comments"
@@ -3144,18 +3146,18 @@
 
 #: knewstuff/knewstuff3/uploaddialog.cpp:275
 msgid "Fetching your previously updated content finished."
-msgstr ""
+msgstr "إنتهى إلتماس محتواك السابق المحدث."
 
 #: knewstuff/knewstuff3/uploaddialog.cpp:293
 msgid "Fetching content data from server finished."
-msgstr ""
+msgstr "إنتهى إلتماس بيانات المحتوى من الخادم."
 
 #: knewstuff/knewstuff3/uploaddialog.cpp:316
 #: knewstuff/knewstuff3/uploaddialog.cpp:770
 msgctxt ""
 "A link to the website where the get hot new stuff upload can be seen"
 msgid "Visit website"
-msgstr ""
+msgstr "زيارة الموقع"
 
 #: kdeui/dialogs/kassistantdialog.cpp:94
 msgctxt "Opposite to Back"
@@ -3175,7 +3177,7 @@
 #: knewstuff/knewstuff3/uploaddialog.cpp:571
 #: knewstuff/knewstuff3/uploaddialog.cpp:696
 msgid "Upload Failed"
-msgstr ""
+msgstr "فشل الرفع"
 
 #: knewstuff/knewstuff3/uploaddialog.cpp:525
 #, kde-format
@@ -3202,7 +3204,7 @@
 #: knewstuff/knewstuff3/uploaddialog.cpp:628
 #: knewstuff/knewstuff3/uploaddialog.cpp:636
 msgid "Select preview image"
-msgstr ""
+msgstr "إختر صورة معاينة"
 
 #: knewstuff/knewstuff3/uploaddialog.cpp:268
 msgid "There was a network error."
@@ -3220,15 +3222,15 @@
 #: knewstuff/knewstuff3/uploaddialog.cpp:660
 #, kde-format
 msgid "Upload failed: %1"
-msgstr ""
+msgstr "فشل الرفع: %1"
 
 #: knewstuff/knewstuff3/downloadwidget.cpp:241
 msgid "Icons view mode"
-msgstr ""
+msgstr "وضع عرض الأيقونات"
 
 #: knewstuff/knewstuff3/downloadwidget.cpp:243
 msgid "Details view mode"
-msgstr ""
+msgstr "وضع عرض التفاصيل"
 
 #: knewstuff/knewstuff3/downloaddialog_p.cpp:198
 msgid "All Providers"
@@ -3338,39 +3340,39 @@
 #: knewstuff/knewstuff3/attica/atticaprovider.cpp:339
 msgctxt "voting for an item (good/bad)"
 msgid "Your vote was recorded."
-msgstr ""
+msgstr "أرسل صوتك بنجاح."
 
 #: knewstuff/knewstuff3/attica/atticaprovider.cpp:426
 msgid "You are now a fan."
-msgstr "أنت الآن معجب."
+msgstr "تم تسجيل صوتك."
 
 #: knewstuff/knewstuff3/attica/atticaprovider.cpp:364
 #, kde-format
 msgid "Network error. (%1)"
-msgstr ""
+msgstr "خطأ في الشبكة. (%1)"
 
 #: knewstuff/knewstuff3/attica/atticaprovider.cpp:368
 msgid "Too many requests to server. Please try again in a few minutes."
-msgstr ""
+msgstr "العديد من الطلبات على الخادم. رجاءا حاول مجددا بعد بضع دقائق."
 
 #: knewstuff/knewstuff3/attica/atticaprovider.cpp:370
 #, kde-format
 msgid "Unknown Open Collaboration Service API error. (%1)"
-msgstr ""
+msgstr "خطأ غير معروف في واجهة API لخدمة التعاون المفتوحة. (%1)"
 
 #: knewstuff/knewstuff3/core/installation.cpp:157
 msgid "Invalid item."
-msgstr ""
+msgstr "عنصر غير صالح."
 
 #: knewstuff/knewstuff3/core/installation.cpp:164
 #, kde-format
 msgid "Download of item failed: no download URL for \"%1\"."
-msgstr ""
+msgstr "تحميل العنصر فشل: لا عنوان URL لـ\"%1\"."
 
 #: knewstuff/knewstuff3/core/installation.cpp:200
 #, kde-format
 msgid "Download of \"%1\" failed, error: %2"
-msgstr ""
+msgstr "فشل تحميل \"%1\"، الخطأ: %2"
 
 #: knewstuff/knewstuff3/core/installation.cpp:208
 msgid ""
@@ -3385,7 +3387,7 @@
 
 #: knewstuff/knewstuff3/core/installation.cpp:211
 msgid "Downloaded file was a HTML file. Opened in browser."
-msgstr ""
+msgstr "الملف المُحمل كان ملف HTML. فُتح في المتصفح."
 
 #: knewstuff/knewstuff3/core/installation.cpp:275
 #, kde-format
@@ -3537,7 +3539,7 @@
 #: kde3support/kdeui/k3sconfig.cpp:171
 msgctxt "@item:inlistbox Spell checker"
 msgid "<application>Hunspell</application>"
-msgstr ""
+msgstr "<application>هنسبل</application>"
 
 #: kde3support/kdeui/k3sconfig.cpp:174
 msgctxt "@label:listbox"
@@ -3619,7 +3621,7 @@
 #: kde3support/kdeui/k3sconfig.cpp:350
 msgctxt "@item Spelling dictionary"
 msgid "Slovak"
-msgstr "سلفاك"
+msgstr "سلوفاكي"
 
 #: kde3support/kdeui/k3sconfig.cpp:353
 msgctxt "@item Spelling dictionary"
@@ -3639,7 +3641,7 @@
 #: kde3support/kdeui/k3sconfig.cpp:362
 msgctxt "@item Spelling dictionary"
 msgid "Ukrainian"
-msgstr "أوكرايني"
+msgstr "أوكراني"
 
 #: kde3support/kdeui/k3sconfig.cpp:365
 msgctxt "@item Spelling dictionary"
@@ -3669,7 +3671,7 @@
 #: kde3support/kdeui/k3sconfig.cpp:462 kde3support/kdeui/k3sconfig.cpp:618
 msgctxt "@item Spelling dictionary"
 msgid "<application>ISpell</application> Default"
-msgstr "<application>آيسبل</application> الافتراضي"
+msgstr "<application>ISpell</application> الافتراضي"
 
 #: kde3support/kdeui/k3sconfig.cpp:510 kde3support/kdeui/k3sconfig.cpp:666
 #, kde-format
@@ -3680,7 +3682,7 @@
 #: kde3support/kdeui/k3sconfig.cpp:531 kde3support/kdeui/k3sconfig.cpp:693
 msgctxt "@item Spelling dictionary"
 msgid "<application>ASpell</application> Default"
-msgstr "<application>أسبل</application> الافتراضي"
+msgstr "<application>ASpell</application> الافتراضي"
 
 #: kde3support/kdeui/k3sconfig.cpp:596 kde3support/kdeui/k3sconfig.cpp:758
 #, kde-format
@@ -3727,11 +3729,11 @@
 
 #: kde3support/kdeui/k3aboutdialog.cpp:900
 msgid "Other Contributors:"
-msgstr "المساهمين الآخرين:"
+msgstr "المساهمون الآخرون:"
 
 #: kde3support/kdeui/k3aboutdialog.cpp:901
 msgid "(No logo available)"
-msgstr "( لا يوجد شعار )"
+msgstr "(لا يوجد شعار)"
 
 #: kde3support/kdeui/k3aboutdialog.cpp:1045
 #: kdeui/dialogs/kaboutapplicationdialog.cpp:87
@@ -4579,7 +4581,7 @@
 
 #: khtml/khtml_ext.cpp:784 khtml/khtml_ext.cpp:797
 msgid "Enter the URL:"
-msgstr "أدخل العنوان:"
+msgstr "أدخل الرابط:"
 
 #: khtml/khtml_ext.cpp:933
 #, kde-format
@@ -6996,7 +6998,7 @@
 #: kdecore/kernel/kcmdlineargs.cpp:1122
 #, kde-format
 msgid "Usage: %1 %2\n"
-msgstr "طريقة الاستعمال:  %2 %1\n"
+msgstr "طريقة الاستعمال: ‎%1 %2\n"
 
 #: kdecore/kernel/kcmdlineargs.cpp:1125
 msgid ""
@@ -7247,7 +7249,7 @@
 #: kdecore/localization/klocale_kde.cpp:1092
 msgctxt "digit set"
 msgid "Devanagari"
-msgstr ""
+msgstr "ديفاناغاري"
 
 #: kdecore/localization/klocale.cpp:1035
 msgctxt "digit set"
@@ -7257,47 +7259,47 @@
 #: kdecore/localization/klocale_kde.cpp:1098
 msgctxt "digit set"
 msgid "Gujarati"
-msgstr ""
+msgstr "غوجاراتي"
 
 #: kdecore/localization/klocale_kde.cpp:1101
 msgctxt "digit set"
 msgid "Gurmukhi"
-msgstr ""
+msgstr "غرموخي"
 
 #: kdecore/localization/klocale_kde.cpp:1104
 msgctxt "digit set"
 msgid "Kannada"
-msgstr ""
+msgstr "كنادا"
 
 #: kdecore/localization/klocale_kde.cpp:1107
 msgctxt "digit set"
 msgid "Khmer"
-msgstr ""
+msgstr "خمير"
 
 #: kdecore/localization/klocale_kde.cpp:1110
 msgctxt "digit set"
 msgid "Malayalam"
-msgstr ""
+msgstr "مليلام"
 
 #: kdecore/localization/klocale_kde.cpp:1113
 msgctxt "digit set"
 msgid "Oriya"
-msgstr ""
+msgstr "أوريا"
 
 #: kdecore/localization/klocale_kde.cpp:1116
 msgctxt "digit set"
 msgid "Tamil"
-msgstr ""
+msgstr "تاميلي"
 
 #: kdecore/localization/klocale_kde.cpp:1119
 msgctxt "digit set"
 msgid "Telugu"
-msgstr ""
+msgstr "تلوغو"
 
 #: kdecore/localization/klocale_kde.cpp:1122
 msgctxt "digit set"
 msgid "Thai"
-msgstr ""
+msgstr "تايلندي"
 
 #: kdecore/localization/klocale.cpp:1041
 msgctxt "digit set"
@@ -7455,7 +7457,7 @@
 #, kde-format
 msgctxt "size in 2^40 bytes"
 msgid "%1 TiB"
-msgstr "%1 ت.بايب"
+msgstr "%1 ت.بايت"
 
 #. i18n: Dumb message, avoid any markup or scripting.
 #: kdecore/localization/klocale_kde.cpp:1595
@@ -7514,8 +7516,8 @@
 msgctxt "@item:intext"
 msgid "%1 millisecond"
 msgid_plural "%1 milliseconds"
-msgstr[0] "%1"
-msgstr[1] "ميلي ثانية"
+msgstr[0] "%1 ميلي ثانية"
+msgstr[1] "%1 ميلي ثانية"
 msgstr[2] "%1 ميلي ثانية"
 msgstr[3] "%1 ميلي ثانية"
 msgstr[4] "%1 ميلي ثانية"
@@ -7599,12 +7601,12 @@
 #: kdecore/localization/klocale_kde.cpp:2332
 msgctxt "Before Noon KLocale::LongName"
 msgid "Ante Meridiem"
-msgstr ""
+msgstr "Ante Meridiem"
 
 #: kdecore/localization/klocale_kde.cpp:2333
 msgctxt "Before Noon KLocale::ShortName"
 msgid "AM"
-msgstr ""
+msgstr "أ.م"
 
 #: kdecore/localization/klocale_kde.cpp:2334
 msgctxt "Before Noon KLocale::NarrowName"
@@ -7619,7 +7621,7 @@
 #: kdecore/localization/klocale_kde.cpp:2338
 msgctxt "After Noon KLocale::ShortName"
 msgid "PM"
-msgstr ""
+msgstr "م"
 
 #: kdecore/localization/klocale_kde.cpp:2339
 msgctxt "After Noon KLocale::NarrowName"
@@ -9919,11 +9921,11 @@
 #: kdeui/dialogs/kaboutapplicationpersonlistdelegate_p.cpp:60
 msgctxt "Action to send an email to a contributor"
 msgid "Email contributor"
-msgstr ""
+msgstr "راسل المساهم"
 
 #: kdeui/dialogs/kaboutapplicationpersonlistdelegate_p.cpp:65
 msgid "Visit contributor's homepage"
-msgstr ""
+msgstr "زر صفحة المساهم الرئيسية"
 
 #: kdeui/dialogs/kaboutapplicationpersonlistdelegate_p.cpp:126
 #, kde-format
@@ -9932,6 +9934,8 @@
 "Email contributor\n"
 "%1"
 msgstr ""
+"راسل المساهم:\n"
+"%1"
 
 #: kdeui/dialogs/kaboutapplicationpersonlistdelegate_p.cpp:131
 #: kdeui/dialogs/kaboutapplicationpersonlistdelegate_p.cpp:168
@@ -9940,6 +9944,8 @@
 "Visit contributor's homepage\n"
 "%1"
 msgstr ""
+"زر صفحة المساهم الرئيسية\n"
+"%1"
 
 #: kdeui/dialogs/kaboutapplicationpersonlistdelegate_p.cpp:138
 #: kdeui/dialogs/kaboutapplicationpersonlistdelegate_p.cpp:172
@@ -9948,6 +9954,8 @@
 "Visit contributor's profile on %1\n"
 "%2"
 msgstr ""
+"زر الملف الشخصيّ للمساهم على %1\n"
+"%2"
 
 #: kdeui/dialogs/kaboutapplicationpersonlistdelegate_p.cpp:160
 #, kde-format
@@ -9962,6 +9970,8 @@
 "Visit contributor's blog\n"
 "%1"
 msgstr ""
+"زر مدونة المساهم\n"
+"%1"
 
 #: kdeui/dialogs/kaboutapplicationdialog.cpp:219
 #, kde-format
@@ -10178,7 +10188,7 @@
 msgid ""
 "Your email address. If incorrect, use the Configure Email button to change it"
 msgstr ""
-"بريدك الإلكتروني. أذا كان خاطئ ، استعمل زر اضبط البريد الإلكتروني لتغييره"
+"بريدك الإلكتروني. أذا كان خاطئًا ، استعمل زر اضبط البريد الإلكتروني لتغييره"
 
 #: kdeui/dialogs/kbugreport.cpp:130
 msgctxt "Email sender address"
@@ -10241,7 +10251,7 @@
 
 #: kdeui/dialogs/kbugreport.cpp:226
 msgid "Compiler:"
-msgstr "المصرف:"
+msgstr "المصرّف:"
 
 #: kdeui/dialogs/kbugreport.cpp:235
 msgid "Se&verity"
@@ -10554,17 +10564,17 @@
 #: kdeui/dialogs/kaboutapplicationpersonmodel_p.cpp:311
 msgctxt "A generic social network or homepage link of an unlisted type."
 msgid "Other"
-msgstr ""
+msgstr "غير ذلك"
 
 #: kdeui/dialogs/kaboutapplicationpersonmodel_p.cpp:313
 msgctxt "A type of link."
 msgid "Blog"
-msgstr ""
+msgstr "مدوّنة"
 
 #: kdeui/dialogs/kaboutapplicationpersonmodel_p.cpp:321
 msgctxt "A type of link."
 msgid "Homepage"
-msgstr ""
+msgstr "الصفحة الرئيسية"
 
 #: kdeui/windowmanagement/kwindowsystem_x11.cpp:858
 #: kdeui/windowmanagement/kwindowsystem_mac.cpp:564
@@ -13222,7 +13232,7 @@
 #, kde-format
 msgctxt "Used only for plugins"
 msgid "About %1"
-msgstr ""
+msgstr "حول %1"
 
 #: kutils/kcmultidialog.cpp:59
 msgid ""
@@ -13420,7 +13430,7 @@
 #: kdeui/colors/kcolordialog.cpp:1103
 msgctxt "The angular degree unit (for hue)"
 msgid "°"
-msgstr ""
+msgstr "°"
 
 #: kdeui/colors/kcolordialog.cpp:1070
 msgid "Saturation:"
@@ -13445,7 +13455,7 @@
 
 #: kdeui/colors/kcolordialog.cpp:1164
 msgid "Alpha:"
-msgstr ""
+msgstr "ألفا:"
 
 #: kdeui/colors/kcolordialog.cpp:1158
 msgid "&Add to Custom Colors"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdelibs_colors4.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdelibs_colors4.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdelibs_colors4.po	2012-02-23 06:20:15.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdelibs_colors4.po	2012-03-23 06:41:46.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 22:46+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:08+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: colors.cpp:1
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kde-menu.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kde-menu.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kde-menu.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kde-menu.po	2012-03-23 06:41:57.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:47+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:50+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kde-menu.cpp:93
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdepasswd.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdepasswd.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdepasswd.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdepasswd.po	2012-03-23 06:41:59.000000000 +0000
@@ -6,22 +6,21 @@
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # AbdulAziz AlSharif <a.a-a.s@hotmail.com>, 2007.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kdepasswd\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2011-12-12 19:32+0000\n"
+"PO-Revision-Date: 2012-03-14 17:23+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:42+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:21+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kdepasswd.cpp:41
 msgid "KDE passwd"
@@ -55,7 +54,7 @@
 #: passwddlg.cpp:34 passwddlg.cpp:101
 msgctxt "@title:window"
 msgid "Change Password"
-msgstr ""
+msgstr "غيّر كلمة السر"
 
 #: passwddlg.cpp:35
 msgid "Please enter your current password:"
@@ -130,9 +129,9 @@
 msgid "Your names"
 msgstr ""
 "ohamed SAAD محمد سعد, ,Launchpad Contributions:,Nuriddin Aminagha,Youssef "
-"Chahibi,metehyi"
+"Chahibi,Zayed Amer Al-Saidi,metehyi"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "metehyi@free.fr,,,,,"
+msgstr "metehyi@free.fr,,,,,zayed.alsaidi@gmail.com,"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdepimwizards.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdepimwizards.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdepimwizards.po	2012-02-23 06:20:10.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdepimwizards.po	2012-03-23 06:41:41.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:25+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:09+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: groupwaremain.cpp:35
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdeqt.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdeqt.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdeqt.po	2012-02-23 06:20:14.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdeqt.po	2012-03-23 06:41:45.000000000 +0000
@@ -8,2260 +8,2334 @@
 msgstr ""
 "Project-Id-Version: kdeqt\n"
 "Report-Msgid-Bugs-To: qt-bugs@trolltech.com\n"
-"POT-Creation-Date: 2012-02-21 18:25+0000\n"
+"POT-Creation-Date: 2012-03-19 22:01+0000\n"
 "PO-Revision-Date: 2011-01-06 06:29+0000\n"
 "Last-Translator: Youssef Chahibi <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 22:07+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:48+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
-#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:14
-#. i18n: ectx: property (windowTitle), widget (QWidget, QPrintSettingsOutput)
-#. i18n: file: gui/dialogs/qprintwidget.ui:13
-#. i18n: ectx: property (windowTitle), widget (QWidget, QPrintWidget)
-#. i18n: file: gui/dialogs/qpagesetupwidget.ui:13
-#. i18n: ectx: property (windowTitle), widget (QWidget, QPageSetupWidget)
 #. i18n: file: gui/dialogs/qprintpropertieswidget.ui:13
 #. i18n: ectx: property (windowTitle), widget (QWidget, QPrintPropertiesWidget)
-#: rc.cpp:3 rc.cpp:63 rc.cpp:90 rc.cpp:150
+#. i18n: file: gui/dialogs/qpagesetupwidget.ui:13
+#. i18n: ectx: property (windowTitle), widget (QWidget, QPageSetupWidget)
+#. i18n: file: gui/dialogs/qprintwidget.ui:13
+#. i18n: ectx: property (windowTitle), widget (QWidget, QPrintWidget)
+#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:14
+#. i18n: ectx: property (windowTitle), widget (QWidget, QPrintSettingsOutput)
+#: rc.cpp:3 rc.cpp:12 rc.cpp:72 rc.cpp:99
 msgid "Form"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:27
-#. i18n: ectx: attribute (title), widget (QWidget, copiesTab)
+#. i18n: file: gui/dialogs/qprintpropertieswidget.ui:34
+#. i18n: ectx: attribute (title), widget (QWidget, tabPage)
 #: rc.cpp:6
-msgid "Copies"
-msgstr ""
-
-#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:39
-#. i18n: ectx: property (title), widget (QGroupBox, gbPrintRange)
-#: rc.cpp:9 gui/dialogs/qprintdialog_qws.cpp:381
-msgid "Print range"
+msgid "Page"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:51
-#. i18n: ectx: property (text), widget (QRadioButton, printAll)
-#: rc.cpp:12 gui/dialogs/qprintdialog_qws.cpp:379
-msgid "Print all"
+#. i18n: file: gui/dialogs/qprintpropertieswidget.ui:44
+#. i18n: ectx: attribute (title), widget (QWidget, cupsPropertiesPage)
+#: rc.cpp:9
+msgid "Advanced"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:69
-#. i18n: ectx: property (text), widget (QRadioButton, printRange)
+#. i18n: file: gui/dialogs/qpagesetupwidget.ui:42
+#. i18n: ectx: property (title), widget (QGroupBox, groupBox_2)
 #: rc.cpp:15
-msgid "Pages from"
+msgid "Paper"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:89
-#. i18n: ectx: property (text), widget (QLabel, label_3)
+#. i18n: file: gui/dialogs/qpagesetupwidget.ui:48
+#. i18n: ectx: property (text), widget (QLabel, pageSizeLabel)
 #: rc.cpp:18
-msgid "to"
+msgid "Page size:"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:124
-#. i18n: ectx: property (text), widget (QRadioButton, printCurrentPage)
+#. i18n: file: gui/dialogs/qpagesetupwidget.ui:61
+#. i18n: ectx: property (text), widget (QLabel, widthLabel)
 #: rc.cpp:21
-msgid "Current Page"
+msgid "Width:"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:131
-#. i18n: ectx: property (text), widget (QRadioButton, printSelection)
+#. i18n: file: gui/dialogs/qpagesetupwidget.ui:80
+#. i18n: ectx: property (text), widget (QLabel, heightLabel)
 #: rc.cpp:24
-msgid "Selection"
+msgid "Height:"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:154
-#. i18n: ectx: property (title), widget (QGroupBox, groupBox)
+#. i18n: file: gui/dialogs/qpagesetupwidget.ui:99
+#. i18n: ectx: property (text), widget (QLabel, paperSourceLabel)
 #: rc.cpp:27
-msgid "Output Settings"
+msgid "Paper source:"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:160
-#. i18n: ectx: property (text), widget (QLabel, label)
+#. i18n: file: gui/dialogs/qpagesetupwidget.ui:128
+#. i18n: ectx: property (title), widget (QGroupBox, groupBox_3)
 #: rc.cpp:30
-msgid "Copies:"
+msgid "Orientation"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:193
-#. i18n: ectx: property (text), widget (QCheckBox, collate)
+#. i18n: file: gui/dialogs/qpagesetupwidget.ui:134
+#. i18n: ectx: property (text), widget (QRadioButton, portrait)
 #: rc.cpp:33
-msgid "Collate"
+msgid "Portrait"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:210
-#. i18n: ectx: property (text), widget (QCheckBox, reverse)
+#. i18n: file: gui/dialogs/qpagesetupwidget.ui:144
+#. i18n: ectx: property (text), widget (QRadioButton, landscape)
 #: rc.cpp:36
-msgid "Reverse"
+msgid "Landscape"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:234
-#. i18n: ectx: attribute (title), widget (QWidget, optionsTab)
-#: rc.cpp:39 gui/kernel/qsoftkeymanager.cpp:73
-msgid "Options"
-msgstr "الخيارات"
+#. i18n: file: gui/dialogs/qpagesetupwidget.ui:151
+#. i18n: ectx: property (text), widget (QRadioButton, reverseLandscape)
+#: rc.cpp:39
+msgid "Reverse landscape"
+msgstr ""
 
-#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:240
-#. i18n: ectx: property (title), widget (QGroupBox, colorMode)
+#. i18n: file: gui/dialogs/qpagesetupwidget.ui:158
+#. i18n: ectx: property (text), widget (QRadioButton, reversePortrait)
 #: rc.cpp:42
-msgid "Color Mode"
+msgid "Reverse portrait"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:259
-#. i18n: ectx: property (text), widget (QRadioButton, color)
+#. i18n: file: gui/dialogs/qpagesetupwidget.ui:184
+#. i18n: ectx: property (title), widget (QGroupBox, groupBox)
 #: rc.cpp:45
-msgid "Color"
-msgstr ""
-
-#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:269
-#. i18n: ectx: property (text), widget (QRadioButton, grayscale)
-#: rc.cpp:48
-msgid "Grayscale"
+msgid "Margins"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:279
-#. i18n: ectx: property (title), widget (QGroupBox, duplex)
-#: rc.cpp:51
-msgid "Duplex Printing"
+#. i18n: file: gui/dialogs/qpagesetupwidget.ui:192
+#. i18n: ectx: property (toolTip), widget (QDoubleSpinBox, topMargin)
+#. i18n: file: gui/dialogs/qpagesetupwidget.ui:195
+#. i18n: ectx: property (accessibleName), widget (QDoubleSpinBox, topMargin)
+#: rc.cpp:48 rc.cpp:51
+msgid "top margin"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:285
-#. i18n: ectx: property (text), widget (QRadioButton, noDuplex)
-#: rc.cpp:54
-msgid "None"
+#. i18n: file: gui/dialogs/qpagesetupwidget.ui:223
+#. i18n: ectx: property (toolTip), widget (QDoubleSpinBox, leftMargin)
+#. i18n: file: gui/dialogs/qpagesetupwidget.ui:226
+#. i18n: ectx: property (accessibleName), widget (QDoubleSpinBox, leftMargin)
+#: rc.cpp:54 rc.cpp:57
+msgid "left margin"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:295
-#. i18n: ectx: property (text), widget (QRadioButton, duplexLong)
-#: rc.cpp:57
-msgid "Long side"
+#. i18n: file: gui/dialogs/qpagesetupwidget.ui:255
+#. i18n: ectx: property (toolTip), widget (QDoubleSpinBox, rightMargin)
+#. i18n: file: gui/dialogs/qpagesetupwidget.ui:258
+#. i18n: ectx: property (accessibleName), widget (QDoubleSpinBox, rightMargin)
+#: rc.cpp:60 rc.cpp:63
+msgid "right margin"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:302
-#. i18n: ectx: property (text), widget (QRadioButton, duplexShort)
-#: rc.cpp:60
-msgid "Short side"
+#. i18n: file: gui/dialogs/qpagesetupwidget.ui:286
+#. i18n: ectx: property (toolTip), widget (QDoubleSpinBox, bottomMargin)
+#. i18n: file: gui/dialogs/qpagesetupwidget.ui:289
+#. i18n: ectx: property (accessibleName), widget (QDoubleSpinBox, bottomMargin)
+#: rc.cpp:66 rc.cpp:69
+msgid "bottom margin"
 msgstr ""
 
 #. i18n: file: gui/dialogs/qprintwidget.ui:22
 #. i18n: ectx: property (title), widget (QGroupBox, printerGroup)
-#: rc.cpp:66
+#: rc.cpp:75
 msgid "Printer"
 msgstr ""
 
 #. i18n: file: gui/dialogs/qprintwidget.ui:28
 #. i18n: ectx: property (text), widget (QLabel, label)
-#: rc.cpp:69
+#: rc.cpp:78
 msgid "&Name:"
 msgstr ""
 
 #. i18n: file: gui/dialogs/qprintwidget.ui:54
 #. i18n: ectx: property (text), widget (QPushButton, properties)
-#: rc.cpp:72
+#: rc.cpp:81
 msgid "P&roperties"
 msgstr ""
 
 #. i18n: file: gui/dialogs/qprintwidget.ui:61
 #. i18n: ectx: property (text), widget (QLabel, label_2)
-#: rc.cpp:75
+#: rc.cpp:84
 msgid "Location:"
 msgstr ""
 
 #. i18n: file: gui/dialogs/qprintwidget.ui:71
 #. i18n: ectx: property (text), widget (QCheckBox, preview)
-#: rc.cpp:78
+#: rc.cpp:87
 msgid "Preview"
 msgstr ""
 
 #. i18n: file: gui/dialogs/qprintwidget.ui:78
 #. i18n: ectx: property (text), widget (QLabel, label_3)
-#: rc.cpp:81
+#: rc.cpp:90
 msgid "Type:"
 msgstr ""
 
 #. i18n: file: gui/dialogs/qprintwidget.ui:88
 #. i18n: ectx: property (text), widget (QLabel, lOutput)
-#: rc.cpp:84
+#: rc.cpp:93
 msgid "Output &file:"
 msgstr ""
 
 #. i18n: file: gui/dialogs/qprintwidget.ui:103
 #. i18n: ectx: property (text), widget (QToolButton, fileBrowser)
-#: rc.cpp:87
-msgid "..."
-msgstr ""
-
-#. i18n: file: gui/dialogs/qpagesetupwidget.ui:42
-#. i18n: ectx: property (title), widget (QGroupBox, groupBox_2)
-#: rc.cpp:93
-msgid "Paper"
-msgstr ""
-
-#. i18n: file: gui/dialogs/qpagesetupwidget.ui:48
-#. i18n: ectx: property (text), widget (QLabel, pageSizeLabel)
 #: rc.cpp:96
-msgid "Page size:"
-msgstr ""
-
-#. i18n: file: gui/dialogs/qpagesetupwidget.ui:61
-#. i18n: ectx: property (text), widget (QLabel, widthLabel)
-#: rc.cpp:99
-msgid "Width:"
+msgid "..."
 msgstr ""
 
-#. i18n: file: gui/dialogs/qpagesetupwidget.ui:80
-#. i18n: ectx: property (text), widget (QLabel, heightLabel)
+#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:27
+#. i18n: ectx: attribute (title), widget (QWidget, copiesTab)
 #: rc.cpp:102
-msgid "Height:"
+msgid "Copies"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qpagesetupwidget.ui:99
-#. i18n: ectx: property (text), widget (QLabel, paperSourceLabel)
-#: rc.cpp:105
-msgid "Paper source:"
+#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:39
+#. i18n: ectx: property (title), widget (QGroupBox, gbPrintRange)
+#: rc.cpp:105 gui/dialogs/qprintdialog_qws.cpp:381
+msgid "Print range"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qpagesetupwidget.ui:128
-#. i18n: ectx: property (title), widget (QGroupBox, groupBox_3)
-#: rc.cpp:108
-msgid "Orientation"
+#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:51
+#. i18n: ectx: property (text), widget (QRadioButton, printAll)
+#: rc.cpp:108 gui/dialogs/qprintdialog_qws.cpp:379
+msgid "Print all"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qpagesetupwidget.ui:134
-#. i18n: ectx: property (text), widget (QRadioButton, portrait)
+#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:69
+#. i18n: ectx: property (text), widget (QRadioButton, printRange)
 #: rc.cpp:111
-msgid "Portrait"
+msgid "Pages from"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qpagesetupwidget.ui:144
-#. i18n: ectx: property (text), widget (QRadioButton, landscape)
+#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:89
+#. i18n: ectx: property (text), widget (QLabel, label_3)
 #: rc.cpp:114
-msgid "Landscape"
+msgid "to"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qpagesetupwidget.ui:151
-#. i18n: ectx: property (text), widget (QRadioButton, reverseLandscape)
+#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:124
+#. i18n: ectx: property (text), widget (QRadioButton, printCurrentPage)
 #: rc.cpp:117
-msgid "Reverse landscape"
+msgid "Current Page"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qpagesetupwidget.ui:158
-#. i18n: ectx: property (text), widget (QRadioButton, reversePortrait)
+#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:131
+#. i18n: ectx: property (text), widget (QRadioButton, printSelection)
 #: rc.cpp:120
-msgid "Reverse portrait"
+msgid "Selection"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qpagesetupwidget.ui:184
+#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:154
 #. i18n: ectx: property (title), widget (QGroupBox, groupBox)
 #: rc.cpp:123
-msgid "Margins"
+msgid "Output Settings"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qpagesetupwidget.ui:192
-#. i18n: ectx: property (toolTip), widget (QDoubleSpinBox, topMargin)
-#. i18n: file: gui/dialogs/qpagesetupwidget.ui:195
-#. i18n: ectx: property (accessibleName), widget (QDoubleSpinBox, topMargin)
-#: rc.cpp:126 rc.cpp:129
-msgid "top margin"
+#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:160
+#. i18n: ectx: property (text), widget (QLabel, label)
+#: rc.cpp:126
+msgid "Copies:"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qpagesetupwidget.ui:223
-#. i18n: ectx: property (toolTip), widget (QDoubleSpinBox, leftMargin)
-#. i18n: file: gui/dialogs/qpagesetupwidget.ui:226
-#. i18n: ectx: property (accessibleName), widget (QDoubleSpinBox, leftMargin)
-#: rc.cpp:132 rc.cpp:135
-msgid "left margin"
+#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:193
+#. i18n: ectx: property (text), widget (QCheckBox, collate)
+#: rc.cpp:129
+msgid "Collate"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qpagesetupwidget.ui:255
-#. i18n: ectx: property (toolTip), widget (QDoubleSpinBox, rightMargin)
-#. i18n: file: gui/dialogs/qpagesetupwidget.ui:258
-#. i18n: ectx: property (accessibleName), widget (QDoubleSpinBox, rightMargin)
-#: rc.cpp:138 rc.cpp:141
-msgid "right margin"
+#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:210
+#. i18n: ectx: property (text), widget (QCheckBox, reverse)
+#: rc.cpp:132
+msgid "Reverse"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qpagesetupwidget.ui:286
-#. i18n: ectx: property (toolTip), widget (QDoubleSpinBox, bottomMargin)
-#. i18n: file: gui/dialogs/qpagesetupwidget.ui:289
-#. i18n: ectx: property (accessibleName), widget (QDoubleSpinBox, bottomMargin)
-#: rc.cpp:144 rc.cpp:147
-msgid "bottom margin"
+#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:234
+#. i18n: ectx: attribute (title), widget (QWidget, optionsTab)
+#: rc.cpp:135 gui/kernel/qsoftkeymanager.cpp:73
+msgid "Options"
+msgstr "الخيارات"
+
+#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:240
+#. i18n: ectx: property (title), widget (QGroupBox, colorMode)
+#: rc.cpp:138
+msgid "Color Mode"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qprintpropertieswidget.ui:34
-#. i18n: ectx: attribute (title), widget (QWidget, tabPage)
-#: rc.cpp:153
-msgid "Page"
+#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:259
+#. i18n: ectx: property (text), widget (QRadioButton, color)
+#: rc.cpp:141
+msgid "Color"
 msgstr ""
 
-#. i18n: file: gui/dialogs/qprintpropertieswidget.ui:44
-#. i18n: ectx: attribute (title), widget (QWidget, cupsPropertiesPage)
-#: rc.cpp:156
-msgid "Advanced"
+#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:269
+#. i18n: ectx: property (text), widget (QRadioButton, grayscale)
+#: rc.cpp:144
+msgid "Grayscale"
 msgstr ""
 
-#: gui/painting/qprinterinfo_unix.cpp:135
-msgid "locally connected"
-msgstr "متصلة محليا"
+#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:279
+#. i18n: ectx: property (title), widget (QGroupBox, duplex)
+#: rc.cpp:147
+msgid "Duplex Printing"
+msgstr ""
 
-#: gui/painting/qprinterinfo_unix.cpp:158
-#: gui/painting/qprinterinfo_unix.cpp:383
-#, qt-format
-msgid "Aliases: %1"
-msgstr "الكنيات: %1"
+#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:285
+#. i18n: ectx: property (text), widget (QRadioButton, noDuplex)
+#: rc.cpp:150
+msgid "None"
+msgstr ""
 
-#: gui/painting/qprinterinfo_unix.cpp:608
-#: gui/painting/qprinterinfo_unix.cpp:807
-msgid "unknown"
-msgstr "مجهول"
+#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:295
+#. i18n: ectx: property (text), widget (QRadioButton, duplexLong)
+#: rc.cpp:153
+msgid "Long side"
+msgstr ""
 
-#: gui/kernel/qsoftkeymanager_s60.cpp:373
-msgid "Exit"
-msgstr "خروج"
+#. i18n: file: gui/dialogs/qprintsettingsoutput.ui:302
+#. i18n: ectx: property (text), widget (QRadioButton, duplexShort)
+#: rc.cpp:156
+msgid "Short side"
+msgstr ""
 
-#: gui/kernel/qwhatsthis.cpp:527 gui/dialogs/qdialog.cpp:651
-msgid "What's This?"
-msgstr "ما هذا ؟"
+#: qt3support/dialogs/q3wizard.cpp:177
+msgid "&Cancel"
+msgstr "إل&غاء"
 
-#: gui/kernel/qwidget.cpp:6049
-msgid "*"
-msgstr "*"
+#: qt3support/dialogs/q3wizard.cpp:178 gui/dialogs/qwizard.cpp:688
+msgid "< &Back"
+msgstr "< لل&خلف"
 
-#: gui/kernel/qapplication.cpp:2423
-msgctxt ""
-"Translate this string to the string 'LTR' in left-to-right languages or to "
-"'RTL' in right-to-left languages (such as Hebrew and Arabic) to get proper "
-"widget layout."
-msgid "QT_LAYOUT_DIRECTION"
-msgstr "RTL"
+#: qt3support/dialogs/q3wizard.cpp:179 gui/dialogs/qwizard.cpp:694
+msgid "&Next >"
+msgstr "ال&تالي >"
 
-#: gui/kernel/qapplication.cpp:2430
-msgctxt "MAC_APPLICATION_MENU"
-msgid "Services"
-msgstr ""
+#: qt3support/dialogs/q3wizard.cpp:180 gui/dialogs/qwizard.cpp:698
+msgid "&Finish"
+msgstr "إ&نتهاء"
 
-#: gui/kernel/qapplication.cpp:2431
-#, qt-format
-msgctxt "MAC_APPLICATION_MENU"
-msgid "Hide %1"
-msgstr ""
+#: qt3support/dialogs/q3wizard.cpp:181 gui/dialogs/qwizard.cpp:702
+msgid "&Help"
+msgstr "&مساعدة"
 
-#: gui/kernel/qapplication.cpp:2432
-msgctxt "MAC_APPLICATION_MENU"
-msgid "Hide Others"
-msgstr ""
+#: qt3support/dialogs/q3tabdialog.cpp:190
+#: qt3support/dialogs/q3tabdialog.cpp:1014
+#: gui/dialogs/qprintdialog_win.cpp:272 gui/dialogs/qmessagebox.cpp:1937
+#: gui/dialogs/qmessagebox.cpp:2383 gui/kernel/qsoftkeymanager.cpp:64
+msgid "OK"
+msgstr "موافق"
 
-#: gui/kernel/qapplication.cpp:2433
-msgctxt "MAC_APPLICATION_MENU"
-msgid "Show All"
-msgstr ""
+#: qt3support/dialogs/q3tabdialog.cpp:648
+msgid "Apply"
+msgstr "طبِق"
 
-#: gui/kernel/qapplication.cpp:2434
-msgctxt "MAC_APPLICATION_MENU"
-msgid "Preferences..."
-msgstr ""
+#: qt3support/dialogs/q3tabdialog.cpp:691 gui/dialogs/qwizard.cpp:702
+#: gui/widgets/qmdisubwindow.cpp:355
+msgid "Help"
+msgstr "مساعدة"
 
-#: gui/kernel/qapplication.cpp:2435
+#: qt3support/dialogs/q3tabdialog.cpp:736
+msgid "Defaults"
+msgstr "الافتراضيات"
+
+#: qt3support/dialogs/q3tabdialog.cpp:786
+#: qt3support/dialogs/q3progressdialog.cpp:224
+#: qt3support/dialogs/q3progressdialog.cpp:285 gui/dialogs/qwizard.cpp:700
+#: gui/dialogs/qprogressdialog.cpp:203 gui/kernel/qsoftkeymanager.cpp:76
+msgid "Cancel"
+msgstr "ألغ"
+
+#: qt3support/other/q3accel.cpp:481
 #, qt-format
-msgctxt "MAC_APPLICATION_MENU"
-msgid "Quit %1"
-msgstr ""
+msgid "%1, %2 not defined"
+msgstr "%1 ،  %2 غير معرّف"
 
-#: gui/kernel/qapplication.cpp:2436
+#: qt3support/other/q3accel.cpp:517
 #, qt-format
-msgctxt "MAC_APPLICATION_MENU"
-msgid "About %1"
+msgid "Ambiguous %1 not handled"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:396
-msgctxt "QShortcut"
-msgid "Space"
-msgstr ""
+#: qt3support/sql/q3datatable.cpp:285 gui/itemviews/qitemeditorfactory.cpp:557
+msgid "True"
+msgstr "صحيح"
 
-#: gui/kernel/qkeysequence.cpp:397
-msgctxt "QShortcut"
-msgid "Esc"
-msgstr ""
+#: qt3support/sql/q3datatable.cpp:286 gui/itemviews/qitemeditorfactory.cpp:556
+msgid "False"
+msgstr "خاطئ"
 
-#: gui/kernel/qkeysequence.cpp:398
-msgctxt "QShortcut"
-msgid "Tab"
-msgstr ""
+#: qt3support/sql/q3datatable.cpp:791
+msgid "Insert"
+msgstr "إدراج"
 
-#: gui/kernel/qkeysequence.cpp:399
-msgctxt "QShortcut"
-msgid "Backtab"
-msgstr ""
+#: qt3support/sql/q3datatable.cpp:792
+msgid "Update"
+msgstr "تحديث"
 
-#: gui/kernel/qkeysequence.cpp:400
-msgctxt "QShortcut"
-msgid "Backspace"
-msgstr ""
+#: qt3support/sql/q3datatable.cpp:793 gui/widgets/qlineedit.cpp:2158
+#: gui/text/qtextcontrol.cpp:2136
+#: scripttools/debugging/qscriptbreakpointswidget.cpp:304
+msgid "Delete"
+msgstr "احذف"
 
-#: gui/kernel/qkeysequence.cpp:401
-msgctxt "QShortcut"
-msgid "Return"
+#: qt3support/sql/q3sqlmanager_p.cpp:890
+msgctxt "QSql"
+msgid "Delete"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:402
-msgctxt "QShortcut"
-msgid "Enter"
+#: qt3support/sql/q3sqlmanager_p.cpp:891
+msgctxt "QSql"
+msgid "Delete this record?"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:403
-msgctxt "QShortcut"
-msgid "Ins"
+#: qt3support/sql/q3sqlmanager_p.cpp:892 qt3support/sql/q3sqlmanager_p.cpp:908
+#: qt3support/sql/q3sqlmanager_p.cpp:944
+msgctxt "QSql"
+msgid "Yes"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:404
-msgctxt "QShortcut"
-msgid "Del"
+#: qt3support/sql/q3sqlmanager_p.cpp:893 qt3support/sql/q3sqlmanager_p.cpp:909
+#: qt3support/sql/q3sqlmanager_p.cpp:945
+msgctxt "QSql"
+msgid "No"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:405
-msgctxt "QShortcut"
-msgid "Pause"
+#: qt3support/sql/q3sqlmanager_p.cpp:901
+msgctxt "QSql"
+msgid "Insert"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:406
-msgctxt "QShortcut"
-msgid "Print"
+#: qt3support/sql/q3sqlmanager_p.cpp:903
+msgctxt "QSql"
+msgid "Update"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:407
-msgctxt "QShortcut"
-msgid "SysReq"
+#: qt3support/sql/q3sqlmanager_p.cpp:907
+msgctxt "QSql"
+msgid "Save edits?"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:408
-msgctxt "QShortcut"
-msgid "Home"
+#: qt3support/sql/q3sqlmanager_p.cpp:910
+msgctxt "QSql"
+msgid "Cancel"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:409
-msgctxt "QShortcut"
-msgid "End"
+#: qt3support/sql/q3sqlmanager_p.cpp:942
+msgctxt "QSql"
+msgid "Confirm"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:410
-msgctxt "QShortcut"
-msgid "Left"
+#: qt3support/sql/q3sqlmanager_p.cpp:943
+msgctxt "QSql"
+msgid "Cancel your edits?"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:411
-msgctxt "QShortcut"
-msgid "Up"
-msgstr ""
+#: qt3support/network/q3networkprotocol.cpp:854
+msgid "Operation stopped by the user"
+msgstr "العملية توقفت من قبل المستخدم"
 
-#: gui/kernel/qkeysequence.cpp:412
-msgctxt "QShortcut"
-msgid "Right"
-msgstr ""
+#: qt3support/widgets/q3toolbar.cpp:692
+msgid "More..."
+msgstr "أكثر..."
 
-#: gui/kernel/qkeysequence.cpp:413
-msgctxt "QShortcut"
-msgid "Down"
-msgstr ""
+#: qt3support/widgets/q3mainwindow.cpp:2051
+#: plugins/accessible/widgets/rangecontrols.cpp:551
+msgid "Line up"
+msgstr "صُفّ على سطر"
 
-#: gui/kernel/qkeysequence.cpp:414
-msgctxt "QShortcut"
-msgid "PgUp"
-msgstr ""
+#: qt3support/widgets/q3mainwindow.cpp:2053
+msgid "Customize..."
+msgstr "تخصيص..."
 
-#: gui/kernel/qkeysequence.cpp:415
-msgctxt "QShortcut"
-msgid "PgDown"
-msgstr ""
+#: qt3support/text/q3textedit.cpp:5429 gui/widgets/qlineedit.cpp:2126
+#: gui/text/qtextcontrol.cpp:2109
+msgid "&Undo"
+msgstr "ت&راجع"
 
-#: gui/kernel/qkeysequence.cpp:416
-msgctxt "QShortcut"
-msgid "CapsLock"
-msgstr ""
+#: qt3support/text/q3textedit.cpp:5430 gui/widgets/qlineedit.cpp:2130
+#: gui/text/qtextcontrol.cpp:2111
+msgid "&Redo"
+msgstr "&كرر"
 
-#: gui/kernel/qkeysequence.cpp:417
-msgctxt "QShortcut"
-msgid "NumLock"
-msgstr ""
+#: qt3support/text/q3textedit.cpp:5435 gui/widgets/qlineedit.cpp:2139
+#: gui/text/qtextcontrol.cpp:2115
+msgid "Cu&t"
+msgstr "ق&ص"
 
-#: gui/kernel/qkeysequence.cpp:418
-msgctxt "QShortcut"
-msgid "ScrollLock"
-msgstr ""
+#: qt3support/text/q3textedit.cpp:5436 gui/widgets/qlineedit.cpp:2145
+#: gui/text/qtextcontrol.cpp:2120
+msgid "&Copy"
+msgstr "ان&سخ"
 
-#: gui/kernel/qkeysequence.cpp:419
-msgctxt "QShortcut"
-msgid "Menu"
-msgstr "قائمة"
+#: qt3support/text/q3textedit.cpp:5438 gui/widgets/qlineedit.cpp:2151
+#: gui/text/qtextcontrol.cpp:2133
+msgid "&Paste"
+msgstr "ال&صق"
 
-#: gui/kernel/qkeysequence.cpp:420
-msgctxt "QShortcut"
-msgid "Help"
-msgstr "مساعدة"
+#: qt3support/text/q3textedit.cpp:5441
+msgid "Clear"
+msgstr "محو"
 
-#: gui/kernel/qkeysequence.cpp:425
-msgctxt "QShortcut"
-msgid "Back"
-msgstr "للخلف"
+#: qt3support/text/q3textedit.cpp:5445 qt3support/text/q3textedit.cpp:5447
+#: gui/widgets/qlineedit.cpp:2166 gui/text/qtextcontrol.cpp:2143
+msgid "Select All"
+msgstr "اختر الكل"
 
-#: gui/kernel/qkeysequence.cpp:426
-msgctxt "QShortcut"
-msgid "Forward"
-msgstr "للأمام"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2114
+#, qt-format
+msgid "JavaScript Alert - %1"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:427
-msgctxt "QShortcut"
-msgid "Stop"
-msgstr "قف"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2131
+#, qt-format
+msgid "JavaScript Confirm - %1"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:428
-msgctxt "QShortcut"
-msgid "Refresh"
-msgstr "حدث"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2151
+#, qt-format
+msgid "JavaScript Prompt - %1"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:429
-msgctxt "QShortcut"
-msgid "Volume Down"
-msgstr "اخفِض الصوت"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2177
+#, qt-format
+msgid "JavaScript Problem - %1"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:430
-msgctxt "QShortcut"
-msgid "Volume Mute"
-msgstr "اكتم الصوت"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2177
+msgid ""
+"The script on this page appears to have a problem. Do you want to stop the "
+"script?"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:431
-msgctxt "QShortcut"
-msgid "Volume Up"
-msgstr "زد الصوت"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2826
+msgid "Move the cursor to the next character"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:432
-msgctxt "QShortcut"
-msgid "Bass Boost"
-msgstr "مكبر الباس"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2829
+msgid "Move the cursor to the previous character"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:433
-msgctxt "QShortcut"
-msgid "Bass Up"
-msgstr "باس أعلى"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2832
+msgid "Move the cursor to the next word"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:434
-msgctxt "QShortcut"
-msgid "Bass Down"
-msgstr "باس أقل"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2835
+msgid "Move the cursor to the previous word"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:435
-msgctxt "QShortcut"
-msgid "Treble Up"
-msgstr "ندى أعلى"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2838
+msgid "Move the cursor to the next line"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:436
-msgctxt "QShortcut"
-msgid "Treble Down"
-msgstr "ندى أقل"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2841
+msgid "Move the cursor to the previous line"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:437
-msgctxt "QShortcut"
-msgid "Media Play"
-msgstr "شغل الوسيط"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2844
+msgid "Move the cursor to the start of the line"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:438
-msgctxt "QShortcut"
-msgid "Media Stop"
-msgstr "أوقف الوسيط"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2847
+msgid "Move the cursor to the end of the line"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:439
-msgctxt "QShortcut"
-msgid "Media Previous"
-msgstr "الوسيط السابق"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2850
+msgid "Move the cursor to the start of the block"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:440
-msgctxt "QShortcut"
-msgid "Media Next"
-msgstr "الوسيط التالي"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2853
+msgid "Move the cursor to the end of the block"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:441
-msgctxt "QShortcut"
-msgid "Media Record"
-msgstr "تسجيل الوسيط"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2856
+msgid "Move the cursor to the start of the document"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:443
-msgctxt "QShortcut"
-msgid "Media Pause"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2859
+msgid "Move the cursor to the end of the document"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:445
-msgctxt "QShortcut"
-msgid "Toggle Media Play/Pause"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2862
+msgid "Select to the next character"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:446
-msgctxt "QShortcut"
-msgid "Home Page"
-msgstr "الصفحة الرئيسة"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2865
+msgid "Select to the previous character"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:447
-msgctxt "QShortcut"
-msgid "Favorites"
-msgstr "المفضّلات"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2868
+msgid "Select to the next word"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:448
-msgctxt "QShortcut"
-msgid "Search"
-msgstr "البحث"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2871
+msgid "Select to the previous word"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:449
-msgctxt "QShortcut"
-msgid "Standby"
-msgstr "وضع الاستعداد"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2874
+msgid "Select to the next line"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:450
-msgctxt "QShortcut"
-msgid "Open URL"
-msgstr "افتح URL"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2877
+msgid "Select to the previous line"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:451
-msgctxt "QShortcut"
-msgid "Launch Mail"
-msgstr "أطلق بريد"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2880
+msgid "Select to the start of the line"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:452
-msgctxt "QShortcut"
-msgid "Launch Media"
-msgstr "أطلق وسائط"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2883
+msgid "Select to the end of the line"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:453
-msgctxt "QShortcut"
-msgid "Launch (0)"
-msgstr "أطلق (0)"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2886
+msgid "Select to the start of the block"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:454
-msgctxt "QShortcut"
-msgid "Launch (1)"
-msgstr "أطلق (1)"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2889
+msgid "Select to the end of the block"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:455
-msgctxt "QShortcut"
-msgid "Launch (2)"
-msgstr "أطلق (2)"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2892
+msgid "Select to the start of the document"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:456
-msgctxt "QShortcut"
-msgid "Launch (3)"
-msgstr "أطلق (3)"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2895
+msgid "Select to the end of the document"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:457
-msgctxt "QShortcut"
-msgid "Launch (4)"
-msgstr "أطلق (4)"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2898
+msgid "Delete to the start of the word"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:458
-msgctxt "QShortcut"
-msgid "Launch (5)"
-msgstr "أطلق (5)"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2901
+msgid "Delete to the end of the word"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:459
-msgctxt "QShortcut"
-msgid "Launch (6)"
-msgstr "أطلق (6)"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2934
+msgid "Insert a new paragraph"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:460
-msgctxt "QShortcut"
-msgid "Launch (7)"
-msgstr "أطلق (7)"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2937
+msgid "Insert a new line"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:461
-msgctxt "QShortcut"
-msgid "Launch (8)"
-msgstr "أطلق (8)"
-
-#: gui/kernel/qkeysequence.cpp:462
-msgctxt "QShortcut"
-msgid "Launch (9)"
-msgstr "أطلق (9)"
-
-#: gui/kernel/qkeysequence.cpp:463
-msgctxt "QShortcut"
-msgid "Launch (A)"
-msgstr "أطلق (أ)"
-
-#: gui/kernel/qkeysequence.cpp:464
-msgctxt "QShortcut"
-msgid "Launch (B)"
-msgstr "أطلق (ب)"
-
-#: gui/kernel/qkeysequence.cpp:465
-msgctxt "QShortcut"
-msgid "Launch (C)"
-msgstr "أطلق (ج)"
-
-#: gui/kernel/qkeysequence.cpp:466
-msgctxt "QShortcut"
-msgid "Launch (D)"
-msgstr "أطلق (د)"
-
-#: gui/kernel/qkeysequence.cpp:467
-msgctxt "QShortcut"
-msgid "Launch (E)"
-msgstr "أطلق (هـ)"
-
-#: gui/kernel/qkeysequence.cpp:468
-msgctxt "QShortcut"
-msgid "Launch (F)"
-msgstr "أطلق (و)"
-
-#: gui/kernel/qkeysequence.cpp:469
-msgctxt "QShortcut"
-msgid "Monitor Brightness Up"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2941
+msgid "Paste and Match Style"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:470
-msgctxt "QShortcut"
-msgid "Monitor Brightness Down"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2944
+msgid "Remove formatting"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:471
-msgctxt "QShortcut"
-msgid "Keyboard Light On/Off"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2948
+msgid "Strikethrough"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:472
-msgctxt "QShortcut"
-msgid "Keyboard Brightness Up"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2952
+msgid "Subscript"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:473
-msgctxt "QShortcut"
-msgid "Keyboard Brightness Down"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2956
+msgid "Superscript"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:474
-msgctxt "QShortcut"
-msgid "Power Off"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2960
+msgid "Insert Bulleted List"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:475
-msgctxt "QShortcut"
-msgid "Wake Up"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2964
+msgid "Insert Numbered List"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:476
-msgctxt "QShortcut"
-msgid "Eject"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2968
+msgid "Indent"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:477
-msgctxt "QShortcut"
-msgid "Screensaver"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2971
+msgid "Outdent"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:478
-msgctxt "QShortcut"
-msgid "WWW"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2974
+msgid "Center"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:479
-msgctxt "QShortcut"
-msgid "Sleep"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2977
+msgid "Justify"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:480
-msgctxt "QShortcut"
-msgid "LightBulb"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2980
+msgid "Align Left"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:481
-msgctxt "QShortcut"
-msgid "Shop"
+#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2983
+msgid "Align Right"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:482
-msgctxt "QShortcut"
-msgid "History"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/InspectorClientQt.cpp:372
+#, qt-format
+msgctxt "QWebPage"
+msgid "Web Inspector - %2"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:483
-msgctxt "QShortcut"
-msgid "Add Favorite"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:152
+msgctxt ""
+"Submit (input element) alt text for <input> elements with no alt, title, or "
+"value"
+msgid "Submit"
+msgstr "سلّم"
 
-#: gui/kernel/qkeysequence.cpp:484
-msgctxt "QShortcut"
-msgid "Hot Links"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:157
+msgctxt "default label for Reset buttons in forms on web pages"
+msgid "Reset"
+msgstr "أعد الضبط"
 
-#: gui/kernel/qkeysequence.cpp:485
-msgctxt "QShortcut"
-msgid "Adjust Brightness"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:162
+msgctxt ""
+"text that appears at the start of nearly-obsolete web pages in the form of a "
+"'searchable index'"
+msgid "This is a searchable index. Enter search keywords: "
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:486
-msgctxt "QShortcut"
-msgid "Finance"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:167
+msgctxt "default label for Submit buttons in forms on web pages"
+msgid "Submit"
+msgstr "سلّم"
 
-#: gui/kernel/qkeysequence.cpp:487
-msgctxt "QShortcut"
-msgid "Community"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:172
+msgctxt "title for file button used in HTML forms"
+msgid "Choose File"
+msgstr "اختر ملف"
 
-#: gui/kernel/qkeysequence.cpp:488
-msgctxt "QShortcut"
-msgid "Audio Rewind"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:177
+msgctxt ""
+"text to display in file button used in HTML forms when no file is selected"
+msgid "No file selected"
+msgstr "لم يختر ملف"
 
-#: gui/kernel/qkeysequence.cpp:489
-msgctxt "QShortcut"
-msgid "Back Forward"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:182
+msgctxt "text to display in <details> tag when it has no <summary> child"
+msgid "Details"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:490
-msgctxt "QShortcut"
-msgid "Application Left"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:187
+msgctxt "Open in New Window context menu item"
+msgid "Open in New Window"
+msgstr "افتح في نافذة جديدة"
 
-#: gui/kernel/qkeysequence.cpp:491
-msgctxt "QShortcut"
-msgid "Application Right"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:192
+msgctxt "Download Linked File context menu item"
+msgid "Save Link..."
+msgstr "احفظ الوصلة..."
 
-#: gui/kernel/qkeysequence.cpp:492
-msgctxt "QShortcut"
-msgid "Book"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:197
+msgctxt "Copy Link context menu item"
+msgid "Copy Link"
+msgstr "انسخ الوصلة"
 
-#: gui/kernel/qkeysequence.cpp:493
-msgctxt "QShortcut"
-msgid "CD"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:202
+msgctxt "Open Image in New Window context menu item"
+msgid "Open Image"
+msgstr "افتح الصورة"
 
-#: gui/kernel/qkeysequence.cpp:494
-msgctxt "QShortcut"
-msgid "Calculator"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:207
+msgctxt "Download Image context menu item"
+msgid "Save Image"
+msgstr "احفظ الصورة"
 
-#: gui/kernel/qkeysequence.cpp:495
-msgctxt "QShortcut"
-msgid "Clear"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:212
+msgctxt "Copy Link context menu item"
+msgid "Copy Image"
+msgstr "انسخ الصورة"
+
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:217
+msgctxt "Copy Image Address menu item"
+msgid "Copy Image Address"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:496
-msgctxt "QShortcut"
-msgid "Clear Grab"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:222
+msgctxt "Open Video in New Window"
+msgid "Open Video"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:497
-msgctxt "QShortcut"
-msgid "Close"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:227
+msgctxt "Open Audio in New Window"
+msgid "Open Audio"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:498
-msgctxt "QShortcut"
-msgid "Copy"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:232
+msgctxt "Copy Video Link Location"
+msgid "Copy Video"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:499
-msgctxt "QShortcut"
-msgid "Cut"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:237
+msgctxt "Copy Audio Link Location"
+msgid "Copy Audio"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:500
-msgctxt "QShortcut"
-msgid "Display"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:242
+msgctxt "Toggle Media Controls"
+msgid "Toggle Controls"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:501
-msgctxt "QShortcut"
-msgid "DOS"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:247
+msgctxt "Toggle Media Loop Playback"
+msgid "Toggle Loop"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:502
-msgctxt "QShortcut"
-msgid "Documents"
-msgstr ""
-
-#: gui/kernel/qkeysequence.cpp:503
-msgctxt "QShortcut"
-msgid "Spreadsheet"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:252
+msgctxt "Switch Video to Fullscreen"
+msgid "Enter Fullscreen"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:504
-msgctxt "QShortcut"
-msgid "Browser"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:257
+msgctxt "Play"
+msgid "Play"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:505
-msgctxt "QShortcut"
-msgid "Game"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:262
+msgctxt "Pause"
+msgid "Pause"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:506
-msgctxt "QShortcut"
-msgid "Go"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:267
+msgctxt "Mute"
+msgid "Mute"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:507
-msgctxt "QShortcut"
-msgid "iTouch"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:272
+msgctxt "Open Frame in New Window context menu item"
+msgid "Open Frame"
+msgstr "افتح الإطار"
 
-#: gui/kernel/qkeysequence.cpp:508
-msgctxt "QShortcut"
-msgid "Logoff"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:277
+msgctxt "Copy context menu item"
+msgid "Copy"
+msgstr "انسخ"
 
-#: gui/kernel/qkeysequence.cpp:509
-msgctxt "QShortcut"
-msgid "Market"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:282
+msgctxt "Back context menu item"
+msgid "Go Back"
+msgstr "إرجع للخلف"
 
-#: gui/kernel/qkeysequence.cpp:510
-msgctxt "QShortcut"
-msgid "Meeting"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:287
+msgctxt "Forward context menu item"
+msgid "Go Forward"
+msgstr "إذهب للأمام"
 
-#: gui/kernel/qkeysequence.cpp:511
-msgctxt "QShortcut"
-msgid "Keyboard Menu"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:292
+msgctxt "Stop context menu item"
+msgid "Stop"
+msgstr "قف"
 
-#: gui/kernel/qkeysequence.cpp:512
-msgctxt "QShortcut"
-msgid "Menu PB"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:297
+msgctxt "Reload context menu item"
+msgid "Reload"
+msgstr "أعد التحميل"
 
-#: gui/kernel/qkeysequence.cpp:513
-msgctxt "QShortcut"
-msgid "My Sites"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:302
+msgctxt "Cut context menu item"
+msgid "Cut"
+msgstr "قص"
 
-#: gui/kernel/qkeysequence.cpp:514
-msgctxt "QShortcut"
-msgid "News"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:307
+msgctxt "Paste context menu item"
+msgid "Paste"
+msgstr "الصق"
 
-#: gui/kernel/qkeysequence.cpp:515
-msgctxt "QShortcut"
-msgid "Home Office"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:312
+msgctxt "Select All context menu item"
+msgid "Select All"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:516
-msgctxt "QShortcut"
-msgid "Option"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:317
+msgctxt "No Guesses Found context menu item"
+msgid "No Guesses Found"
+msgstr "لم يجد تخمينات"
 
-#: gui/kernel/qkeysequence.cpp:517
-msgctxt "QShortcut"
-msgid "Paste"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:322
+msgctxt "Ignore Spelling context menu item"
+msgid "Ignore"
+msgstr "تجاهل"
 
-#: gui/kernel/qkeysequence.cpp:518
-msgctxt "QShortcut"
-msgid "Phone"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:327
+msgctxt "Learn Spelling context menu item"
+msgid "Add To Dictionary"
+msgstr "أضف إلى القاموس"
 
-#: gui/kernel/qkeysequence.cpp:519
-msgctxt "QShortcut"
-msgid "Reply"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:332
+msgctxt "Search The Web context menu item"
+msgid "Search The Web"
+msgstr "ابحث في الويب"
 
-#: gui/kernel/qkeysequence.cpp:520
-msgctxt "QShortcut"
-msgid "Reload"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:337
+msgctxt "Look Up in Dictionary context menu item"
+msgid "Look Up In Dictionary"
+msgstr "ابحث في القاموس"
 
-#: gui/kernel/qkeysequence.cpp:521
-msgctxt "QShortcut"
-msgid "Rotate Windows"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:342
+msgctxt "Open Link context menu item"
+msgid "Open Link"
+msgstr "افتح الوصلة"
 
-#: gui/kernel/qkeysequence.cpp:522
-msgctxt "QShortcut"
-msgid "Rotation PB"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:347
+msgctxt "Ignore Grammar context menu item"
+msgid "Ignore"
+msgstr "تجاهل"
 
-#: gui/kernel/qkeysequence.cpp:523
-msgctxt "QShortcut"
-msgid "Rotation KB"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:352
+msgctxt "Spelling and Grammar context sub-menu item"
+msgid "Spelling"
+msgstr "الإملاء"
 
-#: gui/kernel/qkeysequence.cpp:524
-msgctxt "QShortcut"
-msgid "Save"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:357
+msgctxt "menu item title"
+msgid "Show Spelling and Grammar"
+msgstr "أظهر الإملاء و القواعد"
 
-#: gui/kernel/qkeysequence.cpp:525
-msgctxt "QShortcut"
-msgid "Send"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:358
+msgctxt "menu item title"
+msgid "Hide Spelling and Grammar"
+msgstr "أخف الإملاء و القواعد"
 
-#: gui/kernel/qkeysequence.cpp:526
-msgctxt "QShortcut"
-msgid "Spellchecker"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:363
+msgctxt "Check spelling context menu item"
+msgid "Check Spelling"
+msgstr "دقق إملائيا"
 
-#: gui/kernel/qkeysequence.cpp:527
-msgctxt "QShortcut"
-msgid "Split Screen"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:368
+msgctxt "Check spelling while typing context menu item"
+msgid "Check Spelling While Typing"
+msgstr "دقق الإملاء أثناء الكتابة"
 
-#: gui/kernel/qkeysequence.cpp:528
-msgctxt "QShortcut"
-msgid "Support"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:373
+msgctxt "Check grammar with spelling context menu item"
+msgid "Check Grammar With Spelling"
+msgstr "دقق القواعد مع الإملاء"
 
-#: gui/kernel/qkeysequence.cpp:529
-msgctxt "QShortcut"
-msgid "Task Panel"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:378
+msgctxt "Font context sub-menu item"
+msgid "Fonts"
+msgstr "الخطوط"
 
-#: gui/kernel/qkeysequence.cpp:530
-msgctxt "QShortcut"
-msgid "Terminal"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:383
+msgctxt "Bold context menu item"
+msgid "Bold"
+msgstr "عريض"
 
-#: gui/kernel/qkeysequence.cpp:531
-msgctxt "QShortcut"
-msgid "Tools"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:388
+msgctxt "Italic context menu item"
+msgid "Italic"
+msgstr "مائل"
 
-#: gui/kernel/qkeysequence.cpp:532
-msgctxt "QShortcut"
-msgid "Travel"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:393
+msgctxt "Underline context menu item"
+msgid "Underline"
+msgstr "مسطر"
 
-#: gui/kernel/qkeysequence.cpp:533
-msgctxt "QShortcut"
-msgid "Video"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:398
+msgctxt "Outline context menu item"
+msgid "Outline"
+msgstr "مجسم"
 
-#: gui/kernel/qkeysequence.cpp:534
-msgctxt "QShortcut"
-msgid "Word Processor"
-msgstr ""
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:403
+msgctxt "Writing direction context sub-menu item"
+msgid "Direction"
+msgstr "الإتجاه"
 
-#: gui/kernel/qkeysequence.cpp:535
-msgctxt "QShortcut"
-msgid "XFer"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:408
+msgctxt "Text direction context sub-menu item"
+msgid "Text Direction"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:536
-msgctxt "QShortcut"
-msgid "Zoom In"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:413
+msgctxt "Default writing direction context menu item"
+msgid "Default"
+msgstr "الافتراضي"
+
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:418
+msgctxt "Left to Right context menu item"
+msgid "Left to Right"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:537
-msgctxt "QShortcut"
-msgid "Zoom Out"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:423
+msgctxt "Right to Left context menu item"
+msgid "Right to Left"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:538
-msgctxt "QShortcut"
-msgid "Away"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:428
+msgctxt "Inspect Element context menu item"
+msgid "Inspect"
+msgstr "تحرى"
+
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:433
+msgctxt ""
+"Label for only item in menu that appears when clicking on the search field "
+"image, when no searches have been performed"
+msgid "No recent searches"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:539
-msgctxt "QShortcut"
-msgid "Messenger"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:438
+msgctxt ""
+"label for first item in the menu that appears when clicking on the search "
+"field image, used as embedded menu title"
+msgid "Recent searches"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:540
-msgctxt "QShortcut"
-msgid "WebCam"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:443
+msgctxt "menu item in Recent Searches menu that empties menu's contents"
+msgid "Clear recent searches"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:541
-msgctxt "QShortcut"
-msgid "Mail Forward"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:538
+msgctxt "Label text to be used when a plug-in is missing"
+msgid "Missing Plug-in"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:542
-msgctxt "QShortcut"
-msgid "Pictures"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:555
+msgctxt "Unknown filesize FTP directory listing item"
+msgid "Unknown"
+msgstr "مجهول"
+
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:560
+#, qt-format
+msgctxt "Title string for images"
+msgid "%1 (%2x%3 pixels)"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:543
-msgctxt "QShortcut"
-msgid "Music"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:565
+msgctxt "Media controller status message when the media is loading"
+msgid "Loading..."
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:544
-msgctxt "QShortcut"
-msgid "Battery"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:570
+msgctxt "Media controller status message when watching a live broadcast"
+msgid "Live Broadcast"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:545
-msgctxt "QShortcut"
-msgid "Bluetooth"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:578
+msgctxt "Media controller element"
+msgid "Audio Element"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:546
-msgctxt "QShortcut"
-msgid "Wireless"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:580
+msgctxt "Media controller element"
+msgid "Video Element"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:547
-msgctxt "QShortcut"
-msgid "Ultra Wide Band"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:582
+msgctxt "Media controller element"
+msgid "Mute Button"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:548
-msgctxt "QShortcut"
-msgid "Audio Forward"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:584
+msgctxt "Media controller element"
+msgid "Unmute Button"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:549
-msgctxt "QShortcut"
-msgid "Audio Repeat"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:586
+msgctxt "Media controller element"
+msgid "Play Button"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:550
-msgctxt "QShortcut"
-msgid "Audio Random Play"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:588
+msgctxt "Media controller element"
+msgid "Pause Button"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:551
-msgctxt "QShortcut"
-msgid "Subtitle"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:590
+msgctxt "Media controller element"
+msgid "Slider"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:552
-msgctxt "QShortcut"
-msgid "Audio Cycle Track"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:592
+msgctxt "Media controller element"
+msgid "Slider Thumb"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:553
-msgctxt "QShortcut"
-msgid "Time"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:594
+msgctxt "Media controller element"
+msgid "Rewind Button"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:554 gui/kernel/qkeysequence.cpp:576
-msgctxt "QShortcut"
-msgid "Select"
-msgstr "اختر"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:596
+msgctxt "Media controller element"
+msgid "Return to Real-time Button"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:555
-msgctxt "QShortcut"
-msgid "View"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:598
+msgctxt "Media controller element"
+msgid "Elapsed Time"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:556
-msgctxt "QShortcut"
-msgid "Top Menu"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:600
+msgctxt "Media controller element"
+msgid "Remaining Time"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:557
-msgctxt "QShortcut"
-msgid "Suspend"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:602
+msgctxt "Media controller element"
+msgid "Status Display"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:558
-msgctxt "QShortcut"
-msgid "Hibernate"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:604
+msgctxt "Media controller element"
+msgid "Fullscreen Button"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:562
-msgctxt "QShortcut"
-msgid "Print Screen"
-msgstr "اطبع الشاشة"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:606
+msgctxt "Media controller element"
+msgid "Seek Forward Button"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:563
-msgctxt "QShortcut"
-msgid "Page Up"
-msgstr "صفحة أعلى"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:608
+msgctxt "Media controller element"
+msgid "Seek Back Button"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:564
-msgctxt "QShortcut"
-msgid "Page Down"
-msgstr "صفحة للأسفل"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:616
+msgctxt "Media controller element"
+msgid "Audio element playback controls and status display"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:565
-msgctxt "QShortcut"
-msgid "Caps Lock"
-msgstr "قفل الأحرف الكبيرة"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:618
+msgctxt "Media controller element"
+msgid "Video element playback controls and status display"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:566
-msgctxt "QShortcut"
-msgid "Num Lock"
-msgstr "قفل الأرقام"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:620
+msgctxt "Media controller element"
+msgid "Mute audio tracks"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:567
-msgctxt "QShortcut"
-msgid "Number Lock"
-msgstr "قفل الأرقام"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:622
+msgctxt "Media controller element"
+msgid "Unmute audio tracks"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:568
-msgctxt "QShortcut"
-msgid "Scroll Lock"
-msgstr "قفل اللف"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:624
+msgctxt "Media controller element"
+msgid "Begin playback"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:569
-msgctxt "QShortcut"
-msgid "Insert"
-msgstr "إدراج"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:626
+msgctxt "Media controller element"
+msgid "Pause playback"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:570
-msgctxt "QShortcut"
-msgid "Delete"
-msgstr "حذف"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:628
+msgctxt "Media controller element"
+msgid "Movie time scrubber"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:571
-msgctxt "QShortcut"
-msgid "Escape"
-msgstr "إفلات"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:630
+msgctxt "Media controller element"
+msgid "Movie time scrubber thumb"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:572
-msgctxt "QShortcut"
-msgid "System Request"
-msgstr "طلب النظام"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:632
+msgctxt "Media controller element"
+msgid "Rewind movie"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:577
-msgctxt "QShortcut"
-msgid "Yes"
-msgstr "نعم"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:634
+msgctxt "Media controller element"
+msgid "Return streaming movie to real-time"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:578
-msgctxt "QShortcut"
-msgid "No"
-msgstr "لا"
-
-#: gui/kernel/qkeysequence.cpp:582
-msgctxt "QShortcut"
-msgid "Context1"
-msgstr "سياق1"
-
-#: gui/kernel/qkeysequence.cpp:583
-msgctxt "QShortcut"
-msgid "Context2"
-msgstr "سياق2"
-
-#: gui/kernel/qkeysequence.cpp:584
-msgctxt "QShortcut"
-msgid "Context3"
-msgstr "سياق3"
-
-#: gui/kernel/qkeysequence.cpp:585
-msgctxt "QShortcut"
-msgid "Context4"
-msgstr "سياق4"
-
-#: gui/kernel/qkeysequence.cpp:587
-msgctxt "QShortcut"
-msgid "Call"
-msgstr "نداء"
-
-#: gui/kernel/qkeysequence.cpp:589
-msgctxt "QShortcut"
-msgid "Hangup"
-msgstr "إغلاق الخط"
-
-#: gui/kernel/qkeysequence.cpp:591
-msgctxt "QShortcut"
-msgid "Toggle Call/Hangup"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:636
+msgctxt "Media controller element"
+msgid "Current movie time"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:592
-msgctxt "QShortcut"
-msgid "Flip"
-msgstr "قلب"
-
-#: gui/kernel/qkeysequence.cpp:594
-msgctxt "QShortcut"
-msgid "Voice Dial"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:638
+msgctxt "Media controller element"
+msgid "Remaining movie time"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:596
-msgctxt "QShortcut"
-msgid "Last Number Redial"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:640
+msgctxt "Media controller element"
+msgid "Current movie status"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:598
-msgctxt "QShortcut"
-msgid "Camera Shutter"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:642
+msgctxt "Media controller element"
+msgid "Play movie in full-screen mode"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:600
-msgctxt "QShortcut"
-msgid "Camera Focus"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:644
+msgctxt "Media controller element"
+msgid "Seek quickly back"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:604
-msgctxt "QShortcut"
-msgid "Kanji"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:646
+msgctxt "Media controller element"
+msgid "Seek quickly forward"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:605
-msgctxt "QShortcut"
-msgid "Muhenkan"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:655
+msgctxt "Media time description"
+msgid "Indefinite time"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:606
-msgctxt "QShortcut"
-msgid "Henkan"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:664
+#, qt-format
+msgctxt "Media time description"
+msgid "%1 days %2 hours %3 minutes %4 seconds"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:607
-msgctxt "QShortcut"
-msgid "Romaji"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:667
+#, qt-format
+msgctxt "Media time description"
+msgid "%1 hours %2 minutes %3 seconds"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:608
-msgctxt "QShortcut"
-msgid "Hiragana"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:670
+#, qt-format
+msgctxt "Media time description"
+msgid "%1 minutes %2 seconds"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:609
-msgctxt "QShortcut"
-msgid "Katakana"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:672
+#, qt-format
+msgctxt "Media time description"
+msgid "%1 seconds"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:610
-msgctxt "QShortcut"
-msgid "Hiragana Katakana"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/QtMaemoWebPopup.cpp:129
+msgid "weba_ti_texlist_single"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:611
-msgctxt "QShortcut"
-msgid "Zenkaku"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/QtMaemoWebPopup.cpp:176
+msgid "weba_ti_textlist_multi"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:612
-msgctxt "QShortcut"
-msgid "Hankaku"
+#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/QtMaemoWebPopup.cpp:202
+msgid "wdgt_bd_done"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:613
-msgctxt "QShortcut"
-msgid "Zenkaku Hankaku"
+#: 3rdparty/webkit/Source/WebKit/qt/tests/qwebframe/tst_qwebframe.cpp:2321
+msgid "Fake error!"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:614
-msgctxt "QShortcut"
-msgid "Touroku"
+#: 3rdparty/webkit/Source/WebKit/qt/tests/qwebframe/tst_qwebframe.cpp:2326
+#: 3rdparty/phonon/mmf/utils.cpp:134
+msgid "Invalid URL"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:615
-msgctxt "QShortcut"
-msgid "Massyo"
+#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:59
+msgctxt "QWebPage"
+msgid "Scroll here"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:616
-msgctxt "QShortcut"
-msgid "Kana Lock"
+#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:62
+msgctxt "QWebPage"
+msgid "Left edge"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:617
-msgctxt "QShortcut"
-msgid "Kana Shift"
+#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:62
+msgctxt "QWebPage"
+msgid "Top"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:618
-msgctxt "QShortcut"
-msgid "Eisu Shift"
+#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:63
+msgctxt "QWebPage"
+msgid "Right edge"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:619
-msgctxt "QShortcut"
-msgid "Eisu toggle"
+#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:63
+msgctxt "QWebPage"
+msgid "Bottom"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:620
-msgctxt "QShortcut"
-msgid "Code input"
+#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:66
+msgctxt "QWebPage"
+msgid "Page left"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:621
-msgctxt "QShortcut"
-msgid "Multiple Candidate"
+#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:66
+msgctxt "QWebPage"
+msgid "Page up"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:622
-msgctxt "QShortcut"
-msgid "Previous Candidate"
+#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:67
+msgctxt "QWebPage"
+msgid "Page right"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:626
-msgctxt "QShortcut"
-msgid "Hangul"
+#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:67
+msgctxt "QWebPage"
+msgid "Page down"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:627
-msgctxt "QShortcut"
-msgid "Hangul Start"
+#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:70
+msgctxt "QWebPage"
+msgid "Scroll left"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:628
-msgctxt "QShortcut"
-msgid "Hangul End"
+#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:70
+msgctxt "QWebPage"
+msgid "Scroll up"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:629
-msgctxt "QShortcut"
-msgid "Hangul Hanja"
+#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:71
+msgctxt "QWebPage"
+msgid "Scroll right"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:630
-msgctxt "QShortcut"
-msgid "Hangul Jamo"
+#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:71
+msgctxt "QWebPage"
+msgid "Scroll down"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:631
-msgctxt "QShortcut"
-msgid "Hangul Romaja"
+#: 3rdparty/webkit/Source/WebCore/platform/network/qt/QNetworkReplyHandler.cpp:540
+msgctxt "QWebPage"
+msgid "Redirection limit reached"
 msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:632
-msgctxt "QShortcut"
-msgid "Hangul Jeonja"
-msgstr ""
+#: 3rdparty/phonon/phonon/phononnamespace.cpp:55
+msgctxt "Phonon::"
+msgid "Notifications"
+msgstr "التنبيهات"
 
-#: gui/kernel/qkeysequence.cpp:633
-msgctxt "QShortcut"
-msgid "Hangul Banja"
-msgstr ""
+#: 3rdparty/phonon/phonon/phononnamespace.cpp:57
+msgctxt "Phonon::"
+msgid "Music"
+msgstr "الموسيقى"
 
-#: gui/kernel/qkeysequence.cpp:634
-msgctxt "QShortcut"
-msgid "Hangul PreHanja"
-msgstr ""
+#: 3rdparty/phonon/phonon/phononnamespace.cpp:59
+msgctxt "Phonon::"
+msgid "Video"
+msgstr "الفيديو"
 
-#: gui/kernel/qkeysequence.cpp:635
-msgctxt "QShortcut"
-msgid "Hangul PostHanja"
-msgstr ""
+#: 3rdparty/phonon/phonon/phononnamespace.cpp:61
+msgctxt "Phonon::"
+msgid "Communication"
+msgstr "الاتصالات"
 
-#: gui/kernel/qkeysequence.cpp:636
-msgctxt "QShortcut"
-msgid "Hangul Special"
-msgstr ""
+#: 3rdparty/phonon/phonon/phononnamespace.cpp:63
+msgctxt "Phonon::"
+msgid "Games"
+msgstr "الألعاب"
 
-#: gui/kernel/qkeysequence.cpp:1237 gui/kernel/qkeysequence.cpp:1372
-msgid "Ctrl"
-msgstr "Ctrl"
+#: 3rdparty/phonon/phonon/phononnamespace.cpp:65
+msgctxt "Phonon::"
+msgid "Accessibility"
+msgstr "تسهيل الوصول"
 
-#: gui/kernel/qkeysequence.cpp:1238 gui/kernel/qkeysequence.cpp:1376
-msgid "Shift"
-msgstr "Shift"
+#: 3rdparty/phonon/phonon/volumeslider.cpp:42
+#: 3rdparty/phonon/phonon/volumeslider.cpp:60
+#: 3rdparty/phonon/phonon/volumeslider.cpp:189
+#: 3rdparty/phonon/phonon/volumeslider.cpp:204
+#, qt-format
+msgid "Volume: %1%"
+msgstr "الصوت: %1%"
 
-#: gui/kernel/qkeysequence.cpp:1239 gui/kernel/qkeysequence.cpp:1374
-msgid "Alt"
-msgstr "Alt"
+#: 3rdparty/phonon/phonon/volumeslider.cpp:45
+#: 3rdparty/phonon/phonon/volumeslider.cpp:63
+#: 3rdparty/phonon/phonon/volumeslider.cpp:117
+#, qt-format
+msgid ""
+"Use this slider to adjust the volume. The leftmost position is 0%. The "
+"rightmost is %1%"
+msgstr ""
 
-#: gui/kernel/qkeysequence.cpp:1240 gui/kernel/qkeysequence.cpp:1370
-msgid "Meta"
-msgstr "Meta"
+#: 3rdparty/phonon/phonon/volumeslider.cpp:184
+msgid "Muted"
+msgstr "صامت"
 
-#: gui/kernel/qkeysequence.cpp:1330
-msgid "+"
-msgstr "+"
+#: 3rdparty/phonon/phonon/audiooutput.cpp:444
+#: 3rdparty/phonon/phonon/audiooutput.cpp:478
+#, qt-format
+msgid ""
+"<html>The audio playback device <b>%1</b> does not work.<br/>Falling back to "
+"<b>%2</b>.</html>"
+msgstr ""
+"<html>جهاز تشغيل الصوت <b>%1</b>لا يعمل.<br/> رجع إلى <b>%2</b>.</html>"
 
-#: gui/kernel/qkeysequence.cpp:1391
+#: 3rdparty/phonon/phonon/audiooutput.cpp:457
 #, qt-format
-msgid "F%1"
-msgstr "F%1"
+msgid ""
+"<html>Switching to the audio playback device <b>%1</b><br/>which just became "
+"available and has higher preference.</html>"
+msgstr ""
+"<html>بدل إلى جهاز الصوت <b>%1</b><br/>الذي أصبح متاحا و يملك تفضيلا "
+"أعلى.</html>"
 
-#: gui/kernel/qsoftkeymanager.cpp:64 gui/dialogs/qmessagebox.cpp:1937
-#: gui/dialogs/qmessagebox.cpp:2383 gui/dialogs/qprintdialog_win.cpp:272
-#: qt3support/dialogs/q3tabdialog.cpp:190
-#: qt3support/dialogs/q3tabdialog.cpp:1014
-msgid "OK"
-msgstr "موافق"
+#: 3rdparty/phonon/phonon/audiooutput.cpp:460
+#: 3rdparty/phonon/phonon/audiooutput.cpp:474
+#, qt-format
+msgid "Revert back to device '%1'"
+msgstr "رجع إلى جهاز '%1'"
 
-#: gui/kernel/qsoftkeymanager.cpp:67
-#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:67
-msgid "Select"
+#: 3rdparty/phonon/phonon/audiooutput.cpp:471
+#, qt-format
+msgid ""
+"<html>Switching to the audio playback device <b>%1</b><br/>which has higher "
+"preference or is specifically configured for this stream.</html>"
 msgstr ""
 
-#: gui/kernel/qsoftkeymanager.cpp:70 gui/dialogs/qwizard.cpp:698
-#: gui/dialogs/qdialog.cpp:524
-msgid "Done"
-msgstr "تم"
+#: 3rdparty/phonon/phonon/pulsesupport.cpp:162
+#: 3rdparty/phonon/phonon/pulsesupport.cpp:173
+msgid "PulseAudio Sound Server"
+msgstr ""
 
-#: gui/kernel/qsoftkeymanager.cpp:76 gui/dialogs/qprogressdialog.cpp:203
-#: gui/dialogs/qwizard.cpp:700 qt3support/dialogs/q3progressdialog.cpp:224
-#: qt3support/dialogs/q3progressdialog.cpp:285
-#: qt3support/dialogs/q3tabdialog.cpp:786
-msgid "Cancel"
-msgstr "ألغ"
+#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:82
+msgid "Not ready to play"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:108 gui/text/qfontdatabase.cpp:1526
-msgctxt "QFontDatabase"
-msgid "Normal"
-msgstr "عادي"
+#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:252
+#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:263
+#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:609
+#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:630
+msgid "Error opening file"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:111 gui/text/qfontdatabase.cpp:123
-#: gui/text/qfontdatabase.cpp:1514
-msgctxt "QFontDatabase"
-msgid "Bold"
-msgstr "عريض"
+#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:283
+msgid "Error opening URL"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:114 gui/text/qfontdatabase.cpp:1516
-msgctxt "QFontDatabase"
-msgid "Demi Bold"
-msgstr "نصف عريض"
+#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:295
+msgid "Error opening resource"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:117 gui/text/qfontdatabase.cpp:135
-#: gui/text/qfontdatabase.cpp:1512
-msgctxt "QFontDatabase"
-msgid "Black"
-msgstr "أسود"
+#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:297
+msgid "Error opening source: resource not opened"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:125
-msgctxt "QFontDatabase"
-msgid "Demi"
-msgstr "نصف"
+#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:389
+msgid "Setting volume failed"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:131 gui/text/qfontdatabase.cpp:1518
-msgctxt "QFontDatabase"
-msgid "Light"
-msgstr "فاتح"
+#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:450
+msgid "Loading clip failed"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:301 gui/text/qfontdatabase.cpp:1521
-msgctxt "QFontDatabase"
-msgid "Italic"
-msgstr "مائل"
+#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:479
+msgid "Playback complete"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:304 gui/text/qfontdatabase.cpp:1523
-msgctxt "QFontDatabase"
-msgid "Oblique"
-msgstr "مائل قليلا"
+#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:636
+msgid "Download error"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2252
-msgctxt "QFontDatabase"
-msgid "Any"
-msgstr "أي"
+#: 3rdparty/phonon/mmf/mediaobject.cpp:321
+#: 3rdparty/phonon/mmf/mediaobject.cpp:339
+msgid "Error opening source: type not supported"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2255
-msgctxt "QFontDatabase"
-msgid "Latin"
-msgstr "لاتيني"
+#: 3rdparty/phonon/mmf/mediaobject.cpp:332
+msgid "Error opening source: resource is compressed"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2258
-msgctxt "QFontDatabase"
-msgid "Greek"
-msgstr "يوناني"
+#: 3rdparty/phonon/mmf/mediaobject.cpp:336
+msgid "Error opening source: resource not valid"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2261
-msgctxt "QFontDatabase"
-msgid "Cyrillic"
-msgstr "سيريالي"
+#: 3rdparty/phonon/mmf/mediaobject.cpp:362
+msgid "Error opening source: media type could not be determined"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2264
-msgctxt "QFontDatabase"
-msgid "Armenian"
-msgstr "أرمني"
+#: 3rdparty/phonon/mmf/mediaobject.cpp:520
+msgid "Failed to set requested IAP"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2267
-msgctxt "QFontDatabase"
-msgid "Hebrew"
-msgstr "عبري"
+#: 3rdparty/phonon/mmf/videoplayer_surface.cpp:139
+#: 3rdparty/phonon/mmf/videoplayer_surface.cpp:165
+#: 3rdparty/phonon/mmf/videoplayer_dsa.cpp:241
+#: 3rdparty/phonon/mmf/videoplayer_dsa.cpp:256
+#: 3rdparty/phonon/mmf/videoplayer_dsa.cpp:264
+#: 3rdparty/phonon/mmf/videoplayer_dsa.cpp:286
+#: 3rdparty/phonon/mmf/videoplayer_dsa.cpp:308
+msgid "Video display error"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2270
-msgctxt "QFontDatabase"
-msgid "Arabic"
-msgstr "عربي"
+#: 3rdparty/phonon/mmf/environmentalreverb.cpp:146
+msgid "Decay HF ratio (%)"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2273
-msgctxt "QFontDatabase"
-msgid "Syriac"
-msgstr "سرياني"
+#: 3rdparty/phonon/mmf/environmentalreverb.cpp:152
+msgid "Decay time (ms)"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2276
-msgctxt "QFontDatabase"
-msgid "Thaana"
-msgstr "تاأنا"
+#: 3rdparty/phonon/mmf/environmentalreverb.cpp:159
+msgid "Density (%)"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2279
-msgctxt "QFontDatabase"
-msgid "Devanagari"
-msgstr "دفنيجري"
+#: 3rdparty/phonon/mmf/environmentalreverb.cpp:165
+msgid "Diffusion (%)"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2282
-msgctxt "QFontDatabase"
-msgid "Bengali"
-msgstr "بنغالي"
+#: 3rdparty/phonon/mmf/environmentalreverb.cpp:170
+msgid "Reflections delay (ms)"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2285
-msgctxt "QFontDatabase"
-msgid "Gurmukhi"
-msgstr "غورموخي"
+#: 3rdparty/phonon/mmf/environmentalreverb.cpp:177
+msgid "Reflections level (mB)"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2288
-msgctxt "QFontDatabase"
-msgid "Gujarati"
-msgstr "كوجراتي"
+#: 3rdparty/phonon/mmf/environmentalreverb.cpp:184
+msgid "Reverb delay (ms)"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2291
-msgctxt "QFontDatabase"
-msgid "Oriya"
-msgstr "أوريا"
+#: 3rdparty/phonon/mmf/environmentalreverb.cpp:192
+msgid "Reverb level (mB)"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2294
-msgctxt "QFontDatabase"
-msgid "Tamil"
-msgstr "تاميلي"
+#: 3rdparty/phonon/mmf/environmentalreverb.cpp:199
+msgid "Room HF level"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2297
-msgctxt "QFontDatabase"
-msgid "Telugu"
-msgstr "تلوغو"
+#: 3rdparty/phonon/mmf/environmentalreverb.cpp:205
+msgid "Room level (mB)"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2300
-msgctxt "QFontDatabase"
-msgid "Kannada"
-msgstr "كنادا"
+#: 3rdparty/phonon/mmf/utils.cpp:89 network/ssl/qsslerror.cpp:214
+msgid "No error"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2303
-msgctxt "QFontDatabase"
-msgid "Malayalam"
-msgstr "ملايلام"
+#: 3rdparty/phonon/mmf/utils.cpp:91
+msgid "Not found"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2306
-msgctxt "QFontDatabase"
-msgid "Sinhala"
-msgstr "صنهالا"
+#: 3rdparty/phonon/mmf/utils.cpp:93
+msgid "Out of memory"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2309
-msgctxt "QFontDatabase"
-msgid "Thai"
-msgstr "تايلندي"
+#: 3rdparty/phonon/mmf/utils.cpp:95
+msgid "Not supported"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2312
-msgctxt "QFontDatabase"
-msgid "Lao"
-msgstr "لاو"
+#: 3rdparty/phonon/mmf/utils.cpp:97
+msgid "Overflow"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2315
-msgctxt "QFontDatabase"
-msgid "Tibetan"
-msgstr "تبيتي"
+#: 3rdparty/phonon/mmf/utils.cpp:99
+msgid "Underflow"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2318
-msgctxt "QFontDatabase"
-msgid "Myanmar"
-msgstr "ميانمار"
+#: 3rdparty/phonon/mmf/utils.cpp:101
+msgid "Already exists"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2321
-msgctxt "QFontDatabase"
-msgid "Georgian"
-msgstr "جورجي"
+#: 3rdparty/phonon/mmf/utils.cpp:103
+msgid "Path not found"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2324
-msgctxt "QFontDatabase"
-msgid "Khmer"
-msgstr "الخمارية"
+#: 3rdparty/phonon/mmf/utils.cpp:105
+msgid "In use"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2327
-msgctxt "QFontDatabase"
-msgid "Simplified Chinese"
-msgstr "صيني مبسّط"
+#: 3rdparty/phonon/mmf/utils.cpp:107
+msgid "Not ready"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2330
-msgctxt "QFontDatabase"
-msgid "Traditional Chinese"
-msgstr "صيني تقليدي"
+#: 3rdparty/phonon/mmf/utils.cpp:109
+msgid "Access denied"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2333
-msgctxt "QFontDatabase"
-msgid "Japanese"
-msgstr "ياباني"
+#: 3rdparty/phonon/mmf/utils.cpp:111
+msgid "Could not connect"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2336
-msgctxt "QFontDatabase"
-msgid "Korean"
-msgstr "كوري"
+#: 3rdparty/phonon/mmf/utils.cpp:113
+msgid "Disconnected"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2339
-msgctxt "QFontDatabase"
-msgid "Vietnamese"
-msgstr "فيتنامي"
+#: 3rdparty/phonon/mmf/utils.cpp:115
+#: network/socket/qnativesocketengine.cpp:234
+#: network/socket/qsymbiansocketengine.cpp:1387
+msgid "Permission denied"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2342
-msgctxt "QFontDatabase"
-msgid "Symbol"
-msgstr "رمز"
+#: 3rdparty/phonon/mmf/utils.cpp:119
+msgid "Insufficient bandwidth"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2345
-msgctxt "QFontDatabase"
-msgid "Ogham"
-msgstr "أوغام"
+#: 3rdparty/phonon/mmf/utils.cpp:122
+msgid "Network unavailable"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2348
-msgctxt "QFontDatabase"
-msgid "Runic"
-msgstr "روني"
+#: 3rdparty/phonon/mmf/utils.cpp:126
+msgid "Network communication error"
+msgstr ""
 
-#: gui/text/qfontdatabase.cpp:2351
-msgctxt "QFontDatabase"
-msgid "N'Ko"
+#: 3rdparty/phonon/mmf/utils.cpp:128
+msgid "Streaming not supported"
 msgstr ""
 
-#: gui/text/qtextcontrol.cpp:2109 gui/widgets/qlineedit.cpp:2126
-#: qt3support/text/q3textedit.cpp:5429
-msgid "&Undo"
-msgstr "ت&راجع"
+#: 3rdparty/phonon/mmf/utils.cpp:130
+msgid "Server alert"
+msgstr ""
 
-#: gui/text/qtextcontrol.cpp:2111 gui/widgets/qlineedit.cpp:2130
-#: qt3support/text/q3textedit.cpp:5430
-msgid "&Redo"
-msgstr "&كرر"
+#: 3rdparty/phonon/mmf/utils.cpp:132
+msgid "Invalid protocol"
+msgstr ""
 
-#: gui/text/qtextcontrol.cpp:2115 gui/widgets/qlineedit.cpp:2139
-#: qt3support/text/q3textedit.cpp:5435
-msgid "Cu&t"
-msgstr "ق&ص"
+#: 3rdparty/phonon/mmf/utils.cpp:136
+msgid "Multicast error"
+msgstr ""
 
-#: gui/text/qtextcontrol.cpp:2120 gui/widgets/qlineedit.cpp:2145
-#: qt3support/text/q3textedit.cpp:5436
-msgid "&Copy"
-msgstr "ان&سخ"
+#: 3rdparty/phonon/mmf/utils.cpp:139
+msgid "Proxy server error"
+msgstr ""
 
-#: gui/text/qtextcontrol.cpp:2127
-msgid "Copy &Link Location"
-msgstr "انسخ &وصلة الموقع"
+#: 3rdparty/phonon/mmf/utils.cpp:141
+msgid "Proxy server not supported"
+msgstr ""
 
-#: gui/text/qtextcontrol.cpp:2133 gui/widgets/qlineedit.cpp:2151
-#: qt3support/text/q3textedit.cpp:5438
-msgid "&Paste"
-msgstr "ال&صق"
+#: 3rdparty/phonon/mmf/utils.cpp:143
+msgid "Audio output error"
+msgstr ""
 
-#: gui/text/qtextcontrol.cpp:2136 gui/widgets/qlineedit.cpp:2158
-#: qt3support/sql/q3datatable.cpp:793
-#: scripttools/debugging/qscriptbreakpointswidget.cpp:304
-msgid "Delete"
-msgstr "احذف"
+#: 3rdparty/phonon/mmf/utils.cpp:145
+msgid "Video output error"
+msgstr ""
 
-#: gui/text/qtextcontrol.cpp:2143 gui/widgets/qlineedit.cpp:2166
-#: qt3support/text/q3textedit.cpp:5445 qt3support/text/q3textedit.cpp:5447
-msgid "Select All"
-msgstr "اختر الكل"
+#: 3rdparty/phonon/mmf/utils.cpp:147
+msgid "Decoder error"
+msgstr ""
 
-#: gui/text/qtextcontrol.cpp:3068
-msgctxt "QUnicodeControlCharacterMenu"
-msgid "LRM Left-to-right mark"
-msgstr "LRM علامة اليسار إلى اليمين"
+#: 3rdparty/phonon/mmf/utils.cpp:149
+msgid "Audio or video components could not be played"
+msgstr ""
 
-#: gui/text/qtextcontrol.cpp:3069
-msgctxt "QUnicodeControlCharacterMenu"
-msgid "RLM Right-to-left mark"
-msgstr "RLM علامة اليمين إلى يسار"
+#: 3rdparty/phonon/mmf/utils.cpp:151
+msgid "DRM error"
+msgstr ""
 
-#: gui/text/qtextcontrol.cpp:3070
-msgctxt "QUnicodeControlCharacterMenu"
-msgid "ZWJ Zero width joiner"
-msgstr "ZWJ رابط ذو عرض صفري"
+#: 3rdparty/phonon/mmf/utils.cpp:166
+#, qt-format
+msgid "Unknown error (%1)"
+msgstr ""
 
-#: gui/text/qtextcontrol.cpp:3071
-msgctxt "QUnicodeControlCharacterMenu"
-msgid "ZWNJ Zero width non-joiner"
-msgstr "ZWNJ محرف لا يربط ذو عرض صفري"
+#: 3rdparty/phonon/mmf/audiooutput.cpp:106
+msgctxt "Phonon::MMF"
+msgid "Audio Output"
+msgstr ""
 
-#: gui/text/qtextcontrol.cpp:3072
-msgctxt "QUnicodeControlCharacterMenu"
-msgid "ZWSP Zero width space"
-msgstr "ZWSP فراغ ذو عرض صفري"
+#: 3rdparty/phonon/mmf/audiooutput.cpp:107
+msgctxt "Phonon::MMF"
+msgid "The audio output device"
+msgstr ""
 
-#: gui/text/qtextcontrol.cpp:3073
-msgctxt "QUnicodeControlCharacterMenu"
-msgid "LRE Start of left-to-right embedding"
-msgstr "LRE ابدأ تضمين اليسار إلى اليمين"
+#: 3rdparty/phonon/mmf/stereowidening.cpp:79
+msgid "Level (%)"
+msgstr ""
 
-#: gui/text/qtextcontrol.cpp:3074
-msgctxt "QUnicodeControlCharacterMenu"
-msgid "RLE Start of right-to-left embedding"
-msgstr "RLE ابدأ تضمين اليمين إلى اليسار"
+#: 3rdparty/phonon/mmf/abstractvideoplayer.cpp:111
+msgid "Pause failed"
+msgstr ""
 
-#: gui/text/qtextcontrol.cpp:3075
-msgctxt "QUnicodeControlCharacterMenu"
-msgid "LRO Start of left-to-right override"
-msgstr "LRO ابدأ تجاوز اليسار إلى اليمين"
+#: 3rdparty/phonon/mmf/abstractvideoplayer.cpp:127
+msgid "Seek failed"
+msgstr ""
 
-#: gui/text/qtextcontrol.cpp:3076
-msgctxt "QUnicodeControlCharacterMenu"
-msgid "RLO Start of right-to-left override"
-msgstr "RLO ابدأ تجاوز اليمين إلى يسار"
+#: 3rdparty/phonon/mmf/abstractvideoplayer.cpp:194
+#: 3rdparty/phonon/mmf/audioplayer.cpp:187
+msgid "Getting position failed"
+msgstr ""
 
-#: gui/text/qtextcontrol.cpp:3077
-msgctxt "QUnicodeControlCharacterMenu"
-msgid "PDF Pop directional formatting"
-msgstr "تنسيق الإتجاهي PDF Pop"
+#: 3rdparty/phonon/mmf/abstractvideoplayer.cpp:264
+msgid "Opening clip failed"
+msgstr ""
 
-#: gui/text/qtextcontrol.cpp:3083
-msgid "Insert Unicode control character"
-msgstr "أدرج محرف يونيكود تحكمي"
+#: 3rdparty/phonon/mmf/effectfactory.cpp:181
+msgid "Enabled"
+msgstr ""
 
-#: gui/widgets/qscrollbar.cpp:453
-msgid "Scroll here"
-msgstr "لف هنا"
+#: 3rdparty/phonon/mmf/audioequalizer.cpp:92
+#, qt-format
+msgid "%1 Hz"
+msgstr ""
 
-#: gui/widgets/qscrollbar.cpp:455
-msgid "Left edge"
-msgstr "الحافة اليسرى"
+#: 3rdparty/phonon/gstreamer/mediaobject.cpp:93
+msgid ""
+"Cannot start playback. \n"
+"\n"
+"Check your GStreamer installation and make sure you \n"
+"have libgstreamer-plugins-base installed."
+msgstr ""
 
-#: gui/widgets/qscrollbar.cpp:455
-msgid "Top"
-msgstr "أعلى"
+#: 3rdparty/phonon/gstreamer/mediaobject.cpp:222
+msgid "Missing codec helper script assistant."
+msgstr ""
 
-#: gui/widgets/qscrollbar.cpp:456
-msgid "Right edge"
-msgstr "الحافة اليمنى"
+#: 3rdparty/phonon/gstreamer/mediaobject.cpp:224
+#, qt-format
+msgid "Plugin codec installation failed for codec: %0"
+msgstr ""
 
-#: gui/widgets/qscrollbar.cpp:456
-msgid "Bottom"
-msgstr "أسفل"
+#: 3rdparty/phonon/gstreamer/mediaobject.cpp:235
+#, qt-format
+msgid ""
+"A required codec is missing. You need to install the following codec(s) to "
+"play this content: %0"
+msgstr ""
 
-#: gui/widgets/qscrollbar.cpp:458
-#: plugins/accessible/widgets/rangecontrols.cpp:706
-msgid "Page left"
-msgstr "صفحة يسار"
+#: 3rdparty/phonon/gstreamer/mediaobject.cpp:965
+#: 3rdparty/phonon/gstreamer/mediaobject.cpp:971
+#: 3rdparty/phonon/gstreamer/mediaobject.cpp:984
+#: 3rdparty/phonon/gstreamer/mediaobject.cpp:1008
+#: 3rdparty/phonon/gstreamer/mediaobject.cpp:1014
+#: 3rdparty/phonon/gstreamer/mediaobject.cpp:1032
+#: 3rdparty/phonon/gstreamer/mediaobject.cpp:1466
+#: 3rdparty/phonon/gstreamer/mediaobject.cpp:1490
+msgid "Could not open media source."
+msgstr "لا يمكن فتح مصدر الوسيط"
 
-#: gui/widgets/qscrollbar.cpp:458
-#: plugins/accessible/widgets/rangecontrols.cpp:553
-#: plugins/accessible/widgets/rangecontrols.cpp:706
-msgid "Page up"
-msgstr "صفحة أعلى"
+#: 3rdparty/phonon/gstreamer/mediaobject.cpp:976
+msgid "Invalid source type."
+msgstr "نوع المصدر غير صالح."
 
-#: gui/widgets/qscrollbar.cpp:459
-#: plugins/accessible/widgets/rangecontrols.cpp:711
-msgid "Page right"
-msgstr "صفحة يمين"
+#: 3rdparty/phonon/gstreamer/mediaobject.cpp:1464
+msgid "Could not locate media source."
+msgstr "لا يمكن تحديد مصدر الوسيط."
 
-#: gui/widgets/qscrollbar.cpp:459
-#: plugins/accessible/widgets/rangecontrols.cpp:557
-#: plugins/accessible/widgets/rangecontrols.cpp:711
-msgid "Page down"
-msgstr "صفحة أسفل"
+#: 3rdparty/phonon/gstreamer/mediaobject.cpp:1474
+msgid "Could not open audio device. The device is already in use."
+msgstr "لا يمكن فتح جهاز الصوت. الجهاز مستخدم بالفعل."
 
-#: gui/widgets/qscrollbar.cpp:461
-msgid "Scroll left"
-msgstr "تمرير لليسار"
+#: 3rdparty/phonon/gstreamer/mediaobject.cpp:1487
+msgid "Could not decode media source."
+msgstr "لا يمكن فك تشفير مصدر الوسيط"
 
-#: gui/widgets/qscrollbar.cpp:461
-msgid "Scroll up"
-msgstr "تمرير للأعلى"
+#: 3rdparty/phonon/gstreamer/backend.cpp:188
+msgid ""
+"Warning: You do not seem to have the package gstreamer0.10-plugins-good "
+"installed.\n"
+"          Some video features have been disabled."
+msgstr ""
+"تحذير: يبدو أنك لم تثبت حزمة gstreamer0.10-plugins-good .\n"
+"          بعض مزايا الفيديو عطلت."
 
-#: gui/widgets/qscrollbar.cpp:462
-msgid "Scroll right"
-msgstr "تمرير لليمين"
+#: 3rdparty/phonon/gstreamer/backend.cpp:193
+msgid ""
+"Warning: You do not seem to have the base GStreamer plugins installed.\n"
+"          All audio and video support has been disabled"
+msgstr ""
+"تحذير: يبدو أنك لم تثبت ملحقات GStreamer  الأساسية.\n"
+"          تم تعطيل دعم الصوت و الفيديو."
 
-#: gui/widgets/qscrollbar.cpp:462
-msgid "Scroll down"
-msgstr "تمرير للأسفل"
+#: xml/sax/qxml.cpp:58
+msgctxt "QXml"
+msgid "no error occurred"
+msgstr "لم يحدث أي خطأ"
 
-#: gui/widgets/qmdiarea.cpp:290
-msgid "(Untitled)"
-msgstr "(غير معنون)"
+#: xml/sax/qxml.cpp:59
+msgctxt "QXml"
+msgid "error triggered by consumer"
+msgstr "خطأ مسبب من المستخدم"
 
-#: gui/widgets/qdialogbuttonbox.cpp:658
-msgctxt "QDialogButtonBox"
-msgid "&OK"
-msgstr "&موافق"
+#: xml/sax/qxml.cpp:60
+msgctxt "QXml"
+msgid "unexpected end of file"
+msgstr "نهاية غير متوقعة للملف"
 
-#: gui/widgets/qdialogbuttonbox.cpp:658
-msgctxt "QDialogButtonBox"
-msgid "OK"
+#: xml/sax/qxml.cpp:61
+msgctxt "QXml"
+msgid "more than one document type definition"
+msgstr "أكثر من تعريف لنوع المستند"
+
+#: xml/sax/qxml.cpp:62
+msgctxt "QXml"
+msgid "error occurred while parsing element"
+msgstr "حدث خطأ أثناء تحليل المفردة"
+
+#: xml/sax/qxml.cpp:63
+msgctxt "QXml"
+msgid "tag mismatch"
+msgstr "عدم تطابق في العلامة TAG"
+
+#: xml/sax/qxml.cpp:64
+msgctxt "QXml"
+msgid "error occurred while parsing content"
+msgstr "حدث خطأ أثناء تحليل المحتوى"
+
+#: xml/sax/qxml.cpp:65
+msgctxt "QXml"
+msgid "unexpected character"
+msgstr "حرف غير متوقع"
+
+#: xml/sax/qxml.cpp:66
+msgctxt "QXml"
+msgid "invalid name for processing instruction"
+msgstr "أسم غير صالح لتعليمة معالجة"
+
+#: xml/sax/qxml.cpp:67
+msgctxt "QXml"
+msgid "version expected while reading the XML declaration"
+msgstr "توقع وجود رقم للإصدارة أثناء قراءة تعريف XML"
+
+#: xml/sax/qxml.cpp:68
+msgctxt "QXml"
+msgid "wrong value for standalone declaration"
+msgstr "قيمة خاطئة لتعليمة منفردة"
+
+#: xml/sax/qxml.cpp:69
+msgctxt "QXml"
+msgid ""
+"encoding declaration or standalone declaration expected while reading the "
+"XML declaration"
 msgstr ""
+"كنت أتوقع تعليمة تشفير encoding أو تعليمة منفردة خلال قراءة تعريف ال XML"
 
-#: gui/widgets/qdialogbuttonbox.cpp:661
-msgctxt "QDialogButtonBox"
-msgid "&Save"
+#: xml/sax/qxml.cpp:70
+msgctxt "QXml"
+msgid "standalone declaration expected while reading the XML declaration"
+msgstr "كان من المتوقع وجود تعليمة منفردة في تعريف ال XML"
+
+#: xml/sax/qxml.cpp:71
+msgctxt "QXml"
+msgid "error occurred while parsing document type definition"
+msgstr "حدث خطأ أثناء تحليل تعريف نوع المستند"
+
+#: xml/sax/qxml.cpp:72
+msgctxt "QXml"
+msgid "letter is expected"
+msgstr "توقع حرف"
+
+#: xml/sax/qxml.cpp:73
+msgctxt "QXml"
+msgid "error occurred while parsing comment"
+msgstr "حدث خطأ أثناء تحليل التعليق"
+
+#: xml/sax/qxml.cpp:74
+msgctxt "QXml"
+msgid "error occurred while parsing reference"
+msgstr "حدث خطأ أثناء تحليل المراجع"
+
+#: xml/sax/qxml.cpp:75
+msgctxt "QXml"
+msgid "internal general entity reference not allowed in DTD"
+msgstr "إشارة إلى وحدة داخلية عامة غير مقبول في DTD"
+
+#: xml/sax/qxml.cpp:76
+msgctxt "QXml"
+msgid ""
+"external parsed general entity reference not allowed in attribute value"
+msgstr "إشارة إلى وحدة عامة خارجية محللة غير مقبول في قيمة الصفة"
+
+#: xml/sax/qxml.cpp:77
+msgctxt "QXml"
+msgid "external parsed general entity reference not allowed in DTD"
+msgstr "إشارة إلى وحدة عامة خارجية محللة غير مقبول في DTD"
+
+#: xml/sax/qxml.cpp:78
+msgctxt "QXml"
+msgid "unparsed entity reference in wrong context"
+msgstr "إشارة الى وحدة غير محللة في سياق خاطئ"
+
+#: xml/sax/qxml.cpp:79
+msgctxt "QXml"
+msgid "recursive entities"
+msgstr "كائنات مستدعاة ذاتيا"
+
+#: xml/sax/qxml.cpp:80
+msgctxt "QXml"
+msgid "error in the text declaration of an external entity"
+msgstr "خطأ في نص بيان وحدة خارجية"
+
+#: gui/itemviews/qfileiconprovider.cpp:475
+msgctxt "QFileDialog"
+msgid "Drive"
+msgstr "مشغّل"
+
+#: gui/itemviews/qfileiconprovider.cpp:478
+#: gui/itemviews/qfileiconprovider.cpp:479
+msgctxt "QFileDialog"
+msgid "File"
+msgstr "ملف"
+
+#: gui/itemviews/qfileiconprovider.cpp:484
+msgctxt "Match Windows Explorer"
+msgid "File Folder"
 msgstr ""
 
-#: gui/widgets/qdialogbuttonbox.cpp:661
-msgctxt "QDialogButtonBox"
-msgid "Save"
-msgstr "احفظ"
+#: gui/itemviews/qfileiconprovider.cpp:486
+msgctxt "All other platforms"
+msgid "Folder"
+msgstr ""
 
-#: gui/widgets/qdialogbuttonbox.cpp:664
-msgctxt "QDialogButtonBox"
-msgid "Open"
-msgstr "افتح"
+#: gui/itemviews/qfileiconprovider.cpp:495
+msgctxt "Mac OS X Finder"
+msgid "Alias"
+msgstr ""
 
-#: gui/widgets/qdialogbuttonbox.cpp:667
-msgctxt "QDialogButtonBox"
-msgid "&Cancel"
+#: gui/itemviews/qfileiconprovider.cpp:497
+msgctxt "All other platforms"
+msgid "Shortcut"
 msgstr ""
 
-#: gui/widgets/qdialogbuttonbox.cpp:667
-msgctxt "QDialogButtonBox"
-msgid "Cancel"
-msgstr "ألغ"
+#: gui/itemviews/qfileiconprovider.cpp:504
+msgctxt "QFileDialog"
+msgid "Unknown"
+msgstr "مجهول"
 
-#: gui/widgets/qdialogbuttonbox.cpp:670
-msgctxt "QDialogButtonBox"
-msgid "&Close"
+#: gui/itemviews/qdirmodel.cpp:438 gui/dialogs/qfilesystemmodel.cpp:924
+msgid "Name"
+msgstr "الاسم"
+
+#: gui/itemviews/qdirmodel.cpp:439 gui/dialogs/qfilesystemmodel.cpp:926
+msgid "Size"
+msgstr "القياس"
+
+#: gui/itemviews/qdirmodel.cpp:442 gui/dialogs/qfilesystemmodel.cpp:930
+msgctxt "Match OS X Finder"
+msgid "Kind"
+msgstr "النوع"
+
+#: gui/itemviews/qdirmodel.cpp:444 gui/dialogs/qfilesystemmodel.cpp:932
+msgctxt "All other platforms"
+msgid "Type"
+msgstr "النوع"
+
+#: gui/itemviews/qdirmodel.cpp:450 gui/dialogs/qfilesystemmodel.cpp:939
+msgid "Date Modified"
+msgstr "تاريخ التعديل"
+
+#: gui/itemviews/qdirmodel.cpp:852
+msgctxt "QFileDialog"
+msgid "My Computer"
+msgstr "حاسوبي"
+
+#: gui/itemviews/qdirmodel.cpp:1334 gui/dialogs/qfilesystemmodel.cpp:763
+#, qt-format
+msgid "%1 TB"
+msgstr "%1 ت.بايت"
+
+#: gui/itemviews/qdirmodel.cpp:1336 gui/dialogs/qfilesystemmodel.cpp:765
+#, qt-format
+msgid "%1 GB"
+msgstr "%1 ج.بايت"
+
+#: gui/itemviews/qdirmodel.cpp:1338 gui/dialogs/qfilesystemmodel.cpp:767
+#, qt-format
+msgid "%1 MB"
+msgstr "%1 م.بايت"
+
+#: gui/itemviews/qdirmodel.cpp:1340 gui/dialogs/qfilesystemmodel.cpp:769
+#, qt-format
+msgid "%1 KB"
+msgstr "%1 ك.بايت"
+
+#: gui/itemviews/qdirmodel.cpp:1341
+#, qt-format
+msgid "%1 byte(s)"
 msgstr ""
 
-#: gui/widgets/qdialogbuttonbox.cpp:670
-msgctxt "QDialogButtonBox"
-msgid "Close"
-msgstr "أغلق"
+#: gui/painting/qprinterinfo_unix.cpp:135
+msgid "locally connected"
+msgstr "متصلة محليا"
 
-#: gui/widgets/qdialogbuttonbox.cpp:673
-msgctxt "QDialogButtonBox"
-msgid "Apply"
-msgstr "طبق"
+#: gui/painting/qprinterinfo_unix.cpp:158
+#: gui/painting/qprinterinfo_unix.cpp:383
+#, qt-format
+msgid "Aliases: %1"
+msgstr "الكنيات: %1"
 
-#: gui/widgets/qdialogbuttonbox.cpp:676
-msgctxt "QDialogButtonBox"
-msgid "Reset"
-msgstr "أعد الضبط"
+#: gui/painting/qprinterinfo_unix.cpp:608
+#: gui/painting/qprinterinfo_unix.cpp:807
+msgid "unknown"
+msgstr "مجهول"
 
-#: gui/widgets/qdialogbuttonbox.cpp:679
-msgctxt "QDialogButtonBox"
-msgid "Help"
-msgstr "مساعدة"
+#: gui/dialogs/qdialog.cpp:524 gui/dialogs/qwizard.cpp:698
+#: gui/kernel/qsoftkeymanager.cpp:70
+msgid "Done"
+msgstr "تم"
 
-#: gui/widgets/qdialogbuttonbox.cpp:683
-msgctxt "QDialogButtonBox"
-msgid "Don't Save"
-msgstr "لا تحفظ"
+#: gui/dialogs/qdialog.cpp:651 gui/kernel/qwhatsthis.cpp:527
+msgid "What's This?"
+msgstr "ما هذا ؟"
+
+#: gui/dialogs/qprintdialog_qws.cpp:148
+msgid "File exists"
+msgstr ""
+
+#: gui/dialogs/qprintdialog_qws.cpp:149
+msgid "<qt>Do you want to overwrite it?</qt>"
+msgstr ""
 
-#: gui/widgets/qdialogbuttonbox.cpp:685
-msgctxt "QDialogButtonBox"
-msgid "Close without Saving"
-msgstr "أغلق بدون حفظ"
+#: gui/dialogs/qprintdialog_qws.cpp:333
+msgid "A0 (841 x 1189 mm)"
+msgstr ""
 
-#: gui/widgets/qdialogbuttonbox.cpp:687
-msgctxt "QDialogButtonBox"
-msgid "Discard"
-msgstr "أهمل"
+#: gui/dialogs/qprintdialog_qws.cpp:334
+msgid "A1 (594 x 841 mm)"
+msgstr ""
 
-#: gui/widgets/qdialogbuttonbox.cpp:690
-msgctxt "QDialogButtonBox"
-msgid "&Yes"
-msgstr "&نعم"
+#: gui/dialogs/qprintdialog_qws.cpp:335
+msgid "A2 (420 x 594 mm)"
+msgstr ""
 
-#: gui/widgets/qdialogbuttonbox.cpp:693
-msgctxt "QDialogButtonBox"
-msgid "Yes to &All"
-msgstr "نعم إلى ال&كل"
+#: gui/dialogs/qprintdialog_qws.cpp:336
+msgid "A3 (297 x 420 mm)"
+msgstr ""
 
-#: gui/widgets/qdialogbuttonbox.cpp:696
-msgctxt "QDialogButtonBox"
-msgid "&No"
-msgstr "&لا"
+#: gui/dialogs/qprintdialog_qws.cpp:337
+msgid "A4 (210 x 297 mm, 8.26 x 11.7 inches)"
+msgstr ""
 
-#: gui/widgets/qdialogbuttonbox.cpp:699
-msgctxt "QDialogButtonBox"
-msgid "N&o to All"
-msgstr "ل&ا للكل"
+#: gui/dialogs/qprintdialog_qws.cpp:338
+msgid "A5 (148 x 210 mm)"
+msgstr ""
 
-#: gui/widgets/qdialogbuttonbox.cpp:702
-msgctxt "QDialogButtonBox"
-msgid "Save All"
-msgstr "احفظ الكلّ"
+#: gui/dialogs/qprintdialog_qws.cpp:339
+msgid "A6 (105 x 148 mm)"
+msgstr ""
 
-#: gui/widgets/qdialogbuttonbox.cpp:705
-msgctxt "QDialogButtonBox"
-msgid "Abort"
-msgstr "أجهض"
+#: gui/dialogs/qprintdialog_qws.cpp:340
+msgid "A7 (74 x 105 mm)"
+msgstr ""
 
-#: gui/widgets/qdialogbuttonbox.cpp:708
-msgctxt "QDialogButtonBox"
-msgid "Retry"
-msgstr "أعِد المحاولة"
+#: gui/dialogs/qprintdialog_qws.cpp:341
+msgid "A8 (52 x 74 mm)"
+msgstr ""
 
-#: gui/widgets/qdialogbuttonbox.cpp:711
-msgctxt "QDialogButtonBox"
-msgid "Ignore"
-msgstr "تجاهل"
+#: gui/dialogs/qprintdialog_qws.cpp:342
+msgid "A9 (37 x 52 mm)"
+msgstr ""
 
-#: gui/widgets/qdialogbuttonbox.cpp:714
-msgctxt "QDialogButtonBox"
-msgid "Restore Defaults"
-msgstr "استعد الإفتراضيات"
+#: gui/dialogs/qprintdialog_qws.cpp:343
+msgid "B0 (1000 x 1414 mm)"
+msgstr ""
 
-#: gui/widgets/qtabbar.cpp:2322
-msgid "Close Tab"
+#: gui/dialogs/qprintdialog_qws.cpp:344
+msgid "B1 (707 x 1000 mm)"
 msgstr ""
 
-#: gui/widgets/qabstractspinbox.cpp:1257
-msgid "&Select All"
-msgstr "اختر ال&كلّ"
+#: gui/dialogs/qprintdialog_qws.cpp:345
+msgid "B2 (500 x 707 mm)"
+msgstr ""
 
-#: gui/widgets/qabstractspinbox.cpp:1263
-msgid "&Step up"
-msgstr "خطوة أ&على"
+#: gui/dialogs/qprintdialog_qws.cpp:346
+msgid "B3 (353 x 500 mm)"
+msgstr ""
 
-#: gui/widgets/qabstractspinbox.cpp:1265
-msgid "Step &down"
-msgstr "خطوة أ&سفل"
+#: gui/dialogs/qprintdialog_qws.cpp:347
+msgid "B4 (250 x 353 mm)"
+msgstr ""
 
-#: gui/widgets/qmenubar.cpp:1927
-msgctxt "QMenuBar"
-msgid "Corner Toolbar"
+#: gui/dialogs/qprintdialog_qws.cpp:348
+msgid "B5 (176 x 250 mm, 6.93 x 9.84 inches)"
 msgstr ""
 
-#: gui/widgets/qmdisubwindow.cpp:279
-#, qt-format
-msgid "- [%1]"
-msgstr "- [%1]"
+#: gui/dialogs/qprintdialog_qws.cpp:349
+msgid "B6 (125 x 176 mm)"
+msgstr ""
 
-#: gui/widgets/qmdisubwindow.cpp:280 gui/widgets/qworkspace.cpp:1886
-#: gui/widgets/qworkspace.cpp:1946
-#, qt-format
-msgid "%1 - [%2]"
-msgstr "%1 - [%2]"
+#: gui/dialogs/qprintdialog_qws.cpp:350
+msgid "B7 (88 x 125 mm)"
+msgstr ""
 
-#: gui/widgets/qmdisubwindow.cpp:334 gui/widgets/qworkspace.cpp:115
-#: plugins/accessible/compat/q3complexwidgets.cpp:250
-msgid "Minimize"
-msgstr "تصغير"
+#: gui/dialogs/qprintdialog_qws.cpp:351
+msgid "B8 (62 x 88 mm)"
+msgstr ""
 
-#: gui/widgets/qmdisubwindow.cpp:337
-#: plugins/accessible/compat/q3complexwidgets.cpp:254
-msgid "Maximize"
-msgstr "تكبير"
+#: gui/dialogs/qprintdialog_qws.cpp:352
+msgid "B9 (44 x 62 mm)"
+msgstr ""
 
-#: gui/widgets/qmdisubwindow.cpp:340
-msgid "Unshade"
-msgstr "إلغاء التظليل"
+#: gui/dialogs/qprintdialog_qws.cpp:353
+msgid "B10 (31 x 44 mm)"
+msgstr ""
 
-#: gui/widgets/qmdisubwindow.cpp:343
-msgid "Shade"
-msgstr "تظليل"
+#: gui/dialogs/qprintdialog_qws.cpp:354
+msgid "C5E (163 x 229 mm)"
+msgstr ""
 
-#: gui/widgets/qmdisubwindow.cpp:347 gui/widgets/qworkspace.cpp:117
-msgid "Restore Down"
-msgstr "إعادة الحالة سفليا"
+#: gui/dialogs/qprintdialog_qws.cpp:355
+msgid "DLE (110 x 220 mm)"
+msgstr ""
 
-#: gui/widgets/qmdisubwindow.cpp:349
-msgid "Restore"
-msgstr "إسترجاع"
+#: gui/dialogs/qprintdialog_qws.cpp:356
+msgid "Executive (7.5 x 10 inches, 191 x 254 mm)"
+msgstr ""
 
-#: gui/widgets/qmdisubwindow.cpp:352 gui/widgets/qworkspace.cpp:113
-#: scripttools/debugging/qscriptdebuggercodefinderwidget.cpp:141
-#: scripttools/debugging/qscriptbreakpointswidget.cpp:81
-#: plugins/accessible/compat/q3complexwidgets.cpp:256
-#: plugins/accessible/widgets/qaccessiblewidgets.cpp:1249
-#: plugins/accessible/widgets/qaccessiblemenu.cpp:157
-#: plugins/accessible/widgets/qaccessiblemenu.cpp:382
-#: plugins/accessible/widgets/complexwidgets.cpp:1847
-msgid "Close"
-msgstr "أغلق"
+#: gui/dialogs/qprintdialog_qws.cpp:357
+msgid "Folio (210 x 330 mm)"
+msgstr ""
 
-#: gui/widgets/qmdisubwindow.cpp:355 gui/dialogs/qwizard.cpp:702
-#: qt3support/dialogs/q3tabdialog.cpp:691
-msgid "Help"
-msgstr "مساعدة"
+#: gui/dialogs/qprintdialog_qws.cpp:358
+msgid "Ledger (432 x 279 mm)"
+msgstr ""
 
-#: gui/widgets/qmdisubwindow.cpp:358
-msgid "Menu"
-msgstr "قائمة"
+#: gui/dialogs/qprintdialog_qws.cpp:359
+msgid "Legal (8.5 x 14 inches, 216 x 356 mm)"
+msgstr ""
 
-#: gui/widgets/qmdisubwindow.cpp:1054 gui/widgets/qworkspace.cpp:1089
-msgid "&Restore"
-msgstr "اس&ترجاع"
+#: gui/dialogs/qprintdialog_qws.cpp:360
+msgid "Letter (8.5 x 11 inches, 216 x 279 mm)"
+msgstr ""
 
-#: gui/widgets/qmdisubwindow.cpp:1057 gui/widgets/qworkspace.cpp:1090
-msgid "&Move"
-msgstr "&نقل"
+#: gui/dialogs/qprintdialog_qws.cpp:361
+msgid "Tabloid (279 x 432 mm)"
+msgstr ""
 
-#: gui/widgets/qmdisubwindow.cpp:1058 gui/widgets/qworkspace.cpp:1091
-#: gui/dialogs/qfontdialog.cpp:770
-msgid "&Size"
-msgstr "ال&حجم"
+#: gui/dialogs/qprintdialog_qws.cpp:362
+msgid "US Common #10 Envelope (105 x 241 mm)"
+msgstr ""
 
-#: gui/widgets/qmdisubwindow.cpp:1059 gui/widgets/qworkspace.cpp:1093
-msgid "Mi&nimize"
-msgstr "ت&صغير"
+#: gui/dialogs/qprintdialog_qws.cpp:380
+msgid "Print selection"
+msgstr ""
 
-#: gui/widgets/qmdisubwindow.cpp:1061 gui/widgets/qworkspace.cpp:1095
-msgid "Ma&ximize"
-msgstr "ت&كبير"
+#: gui/dialogs/qprintdialog_qws.cpp:382
+msgid "Print current page"
+msgstr ""
 
-#: gui/widgets/qmdisubwindow.cpp:1063 gui/widgets/qworkspace.cpp:1103
-msgid "Stay on &Top"
-msgstr "البقاء في ال&وجه."
+#: gui/dialogs/qwizard.cpp:688
+msgid "Go Back"
+msgstr "ارجع للخلف"
 
-#: gui/widgets/qmdisubwindow.cpp:1066 gui/widgets/qworkspace.cpp:1097
-msgid "&Close"
-msgstr "إ&غلاق"
+#: gui/dialogs/qwizard.cpp:691 scripttools/debugging/qscriptdebugger.cpp:1694
+msgid "Continue"
+msgstr "استمر"
 
-#: gui/widgets/qdatetimeedit.cpp:2289
-msgid "AM"
-msgstr "ص"
+#: gui/dialogs/qwizard.cpp:694
+msgid "&Next"
+msgstr "ال&تالي"
 
-#: gui/widgets/qdatetimeedit.cpp:2289
-msgid "am"
-msgstr "ص"
+#: gui/dialogs/qwizard.cpp:696
+msgid "Commit"
+msgstr "أرسِل"
 
-#: gui/widgets/qdatetimeedit.cpp:2291
-msgid "PM"
-msgstr "م"
+#: gui/dialogs/qprintdialog_unix.cpp:396 gui/dialogs/qprintdialog_unix.cpp:464
+msgid "&Options >>"
+msgstr ""
 
-#: gui/widgets/qdatetimeedit.cpp:2291
-msgid "pm"
-msgstr "م"
+#: gui/dialogs/qprintdialog_unix.cpp:401
+msgid "&Print"
+msgstr ""
 
-#: gui/widgets/qworkspace.cpp:1106 gui/widgets/qworkspace.cpp:2164
-msgid "Sh&ade"
-msgstr "تظ&ليل"
+#: gui/dialogs/qprintdialog_unix.cpp:468
+msgid "&Options <<"
+msgstr ""
+
+#: gui/dialogs/qprintdialog_unix.cpp:728
+msgid "Print to File (PDF)"
+msgstr ""
 
-#: gui/widgets/qworkspace.cpp:2160
-msgid "&Unshade"
-msgstr "إلغاء الت&ظليل"
+#: gui/dialogs/qprintdialog_unix.cpp:729
+msgid "Print to File (Postscript)"
+msgstr ""
 
-#: gui/widgets/qmenu_symbian.cpp:457
-msgid "Actions"
+#: gui/dialogs/qprintdialog_unix.cpp:776
+msgid "Local file"
 msgstr ""
 
-#: gui/accessible/qaccessibleobject.cpp:374
-msgid "Activate"
-msgstr "نشط"
+#: gui/dialogs/qprintdialog_unix.cpp:777
+#, qt-format
+msgid "Write %1 file"
+msgstr ""
 
-#: gui/accessible/qaccessibleobject.cpp:376
-msgid "Activates the program's main window"
-msgstr "ينشّط النافذة الرئيسة للبرنامج"
+#: gui/dialogs/qprintdialog_unix.cpp:848
+msgid "Print To File ..."
+msgstr ""
 
-#: gui/util/qundostack.cpp:877 gui/util/qundogroup.cpp:388
+#: gui/dialogs/qprintdialog_unix.cpp:926
 #, qt-format
-msgid "Undo %1"
+msgid ""
+"%1 is a directory.\n"
+"Please choose a different file name."
 msgstr ""
 
-#: gui/util/qundostack.cpp:877 gui/util/qundogroup.cpp:388
-msgctxt "Default text for undo action"
-msgid "Undo"
+#: gui/dialogs/qprintdialog_unix.cpp:930
+#, qt-format
+msgid ""
+"File %1 is not writable.\n"
+"Please choose a different file name."
 msgstr ""
 
-#: gui/util/qundostack.cpp:907 gui/util/qundogroup.cpp:419
+#: gui/dialogs/qprintdialog_unix.cpp:934
 #, qt-format
-msgid "Redo %1"
+msgid ""
+"%1 already exists.\n"
+"Do you want to overwrite it?"
 msgstr ""
 
-#: gui/util/qundostack.cpp:907 gui/util/qundogroup.cpp:419
-msgctxt "Default text for redo action"
-msgid "Redo"
+#: gui/dialogs/qprintdialog_unix.cpp:1238
+msgctxt "QPPDOptionsModel"
+msgid "Name"
 msgstr ""
 
-#: gui/util/qundoview.cpp:101
-msgid "<empty>"
-msgstr "<فارغ>"
+#: gui/dialogs/qprintdialog_unix.cpp:1240
+msgctxt "QPPDOptionsModel"
+msgid "Value"
+msgstr ""
 
-#: gui/util/qdesktopservices_mac.cpp:171
-msgid "Home"
-msgstr "المنزل"
+#: gui/dialogs/qinputdialog.cpp:223
+msgid "Enter a value:"
+msgstr ""
 
-#: gui/itemviews/qitemeditorfactory.cpp:556 qt3support/sql/q3datatable.cpp:286
-msgid "False"
-msgstr "خاطئ"
+#: gui/dialogs/qprintpreviewdialog.cpp:249
+#, qt-format
+msgid "%1%"
+msgstr ""
 
-#: gui/itemviews/qitemeditorfactory.cpp:557 qt3support/sql/q3datatable.cpp:285
-msgid "True"
-msgstr "صحيح"
+#: gui/dialogs/qprintpreviewdialog.cpp:333
+msgctxt "QPrintPreviewDialog"
+msgid "Print Preview"
+msgstr "معاينة الطباعة"
 
-#: gui/itemviews/qdirmodel.cpp:438 gui/dialogs/qfilesystemmodel.cpp:924
-msgid "Name"
-msgstr "الاسم"
+#: gui/dialogs/qprintpreviewdialog.cpp:363
+msgctxt "QPrintPreviewDialog"
+msgid "Next page"
+msgstr "الصفحة التالية"
 
-#: gui/itemviews/qdirmodel.cpp:439 gui/dialogs/qfilesystemmodel.cpp:926
-msgid "Size"
-msgstr "القياس"
+#: gui/dialogs/qprintpreviewdialog.cpp:364
+msgctxt "QPrintPreviewDialog"
+msgid "Previous page"
+msgstr "الصفحة السابقة"
 
-#: gui/itemviews/qdirmodel.cpp:442 gui/dialogs/qfilesystemmodel.cpp:930
-msgctxt "Match OS X Finder"
-msgid "Kind"
-msgstr "النوع"
+#: gui/dialogs/qprintpreviewdialog.cpp:365
+msgctxt "QPrintPreviewDialog"
+msgid "First page"
+msgstr "الصفحة الأولى"
 
-#: gui/itemviews/qdirmodel.cpp:444 gui/dialogs/qfilesystemmodel.cpp:932
-msgctxt "All other platforms"
-msgid "Type"
-msgstr "النوع"
+#: gui/dialogs/qprintpreviewdialog.cpp:366
+msgctxt "QPrintPreviewDialog"
+msgid "Last page"
+msgstr "الصفحة الأخيرة"
 
-#: gui/itemviews/qdirmodel.cpp:450 gui/dialogs/qfilesystemmodel.cpp:939
-msgid "Date Modified"
-msgstr "تاريخ التعديل"
+#: gui/dialogs/qprintpreviewdialog.cpp:375
+msgctxt "QPrintPreviewDialog"
+msgid "Fit width"
+msgstr "ناسب العرض"
 
-#: gui/itemviews/qdirmodel.cpp:852
-msgctxt "QFileDialog"
-msgid "My Computer"
-msgstr "حاسوبي"
+#: gui/dialogs/qprintpreviewdialog.cpp:376
+msgctxt "QPrintPreviewDialog"
+msgid "Fit page"
+msgstr "ناسب الصفحة"
 
-#: gui/itemviews/qdirmodel.cpp:1334 gui/dialogs/qfilesystemmodel.cpp:763
-#, qt-format
-msgid "%1 TB"
-msgstr "%1 ت.بايت"
+#: gui/dialogs/qprintpreviewdialog.cpp:387
+msgctxt "QPrintPreviewDialog"
+msgid "Zoom in"
+msgstr "كبر"
 
-#: gui/itemviews/qdirmodel.cpp:1336 gui/dialogs/qfilesystemmodel.cpp:765
-#, qt-format
-msgid "%1 GB"
-msgstr "%1 ج.بايت"
+#: gui/dialogs/qprintpreviewdialog.cpp:388
+msgctxt "QPrintPreviewDialog"
+msgid "Zoom out"
+msgstr "صغر"
 
-#: gui/itemviews/qdirmodel.cpp:1338 gui/dialogs/qfilesystemmodel.cpp:767
-#, qt-format
-msgid "%1 MB"
-msgstr "%1 م.بايت"
+#: gui/dialogs/qprintpreviewdialog.cpp:394
+msgctxt "QPrintPreviewDialog"
+msgid "Portrait"
+msgstr "طولي"
 
-#: gui/itemviews/qdirmodel.cpp:1340 gui/dialogs/qfilesystemmodel.cpp:769
-#, qt-format
-msgid "%1 KB"
-msgstr "%1 ك.بايت"
+#: gui/dialogs/qprintpreviewdialog.cpp:395
+msgctxt "QPrintPreviewDialog"
+msgid "Landscape"
+msgstr "عرضي"
 
-#: gui/itemviews/qdirmodel.cpp:1341
-#, qt-format
-msgid "%1 byte(s)"
-msgstr ""
+#: gui/dialogs/qprintpreviewdialog.cpp:405
+msgctxt "QPrintPreviewDialog"
+msgid "Show single page"
+msgstr "أظهر صفحة مفردة"
 
-#: gui/itemviews/qfileiconprovider.cpp:475
-msgctxt "QFileDialog"
-msgid "Drive"
-msgstr "مشغّل"
+#: gui/dialogs/qprintpreviewdialog.cpp:406
+msgctxt "QPrintPreviewDialog"
+msgid "Show facing pages"
+msgstr "أظهر الصفحات المتقابلة"
 
-#: gui/itemviews/qfileiconprovider.cpp:478
-#: gui/itemviews/qfileiconprovider.cpp:479
-msgctxt "QFileDialog"
-msgid "File"
-msgstr "ملف"
+#: gui/dialogs/qprintpreviewdialog.cpp:407
+msgctxt "QPrintPreviewDialog"
+msgid "Show overview of all pages"
+msgstr "أظهر معاينة لكل الصفحات"
 
-#: gui/itemviews/qfileiconprovider.cpp:484
-msgctxt "Match Windows Explorer"
-msgid "File Folder"
+#: gui/dialogs/qprintpreviewdialog.cpp:422
+msgctxt "QPrintPreviewDialog"
+msgid "Print"
+msgstr "اطبع"
+
+#: gui/dialogs/qprintpreviewdialog.cpp:423
+msgctxt "QPrintPreviewDialog"
+msgid "Page setup"
+msgstr "إعداد الصفحة"
+
+#: gui/dialogs/qprintpreviewdialog.cpp:429
+msgctxt "QPrintPreviewDialog"
+msgid "Close"
+msgstr "أغلق"
+
+#: gui/dialogs/qprintpreviewdialog.cpp:577
+msgctxt "QPrintPreviewDialog"
+msgid "Export to PDF"
 msgstr ""
 
-#: gui/itemviews/qfileiconprovider.cpp:486
-msgctxt "All other platforms"
-msgid "Folder"
+#: gui/dialogs/qprintpreviewdialog.cpp:580
+msgctxt "QPrintPreviewDialog"
+msgid "Export to PostScript"
 msgstr ""
 
-#: gui/itemviews/qfileiconprovider.cpp:495
-msgctxt "Mac OS X Finder"
-msgid "Alias"
+#: gui/dialogs/qsidebar.cpp:442
+msgid "Remove"
+msgstr "احذف"
+
+#: gui/dialogs/qprintdialog_win.cpp:270
+msgid "Print"
 msgstr ""
 
-#: gui/itemviews/qfileiconprovider.cpp:497
-msgctxt "All other platforms"
-msgid "Shortcut"
+#: gui/dialogs/qprintdialog_win.cpp:271
+msgid "The 'From' value cannot be greater than the 'To' value."
 msgstr ""
 
-#: gui/itemviews/qfileiconprovider.cpp:504
-msgctxt "QFileDialog"
-msgid "Unknown"
-msgstr "مجهول"
+#: gui/dialogs/qfontdialog.cpp:183
+msgid "Select Font"
+msgstr "اختر الخط"
 
-#: gui/inputmethod/qinputcontextfactory.cpp:301
-msgid "XIM"
-msgstr "XIM"
+#: gui/dialogs/qfontdialog.cpp:768
+msgid "&Font"
+msgstr "ال&خط"
 
-#: gui/inputmethod/qinputcontextfactory.cpp:305
-msgid "FEP"
-msgstr ""
+#: gui/dialogs/qfontdialog.cpp:769
+msgid "Font st&yle"
+msgstr "أ&سلوب الخط"
 
-#: gui/inputmethod/qinputcontextfactory.cpp:328
-msgid "XIM input method"
-msgstr "طريقة إدخال XIM"
+#: gui/dialogs/qfontdialog.cpp:770 gui/widgets/qmdisubwindow.cpp:1058
+#: gui/widgets/qworkspace.cpp:1091
+msgid "&Size"
+msgstr "ال&حجم"
+
+#: gui/dialogs/qfontdialog.cpp:774
+msgid "Effects"
+msgstr "التأثيرات"
+
+#: gui/dialogs/qfontdialog.cpp:776
+msgid "Stri&keout"
+msgstr "ش&طب"
+
+#: gui/dialogs/qfontdialog.cpp:777
+msgid "&Underline"
+msgstr "م&سطر"
+
+#: gui/dialogs/qfontdialog.cpp:778
+msgid "Sample"
+msgstr "عيًنة"
+
+#: gui/dialogs/qfontdialog.cpp:779
+msgid "Wr&iting System"
+msgstr "نظام ال&كتابة"
 
-#: gui/inputmethod/qinputcontextfactory.cpp:332
-msgid "Windows input method"
-msgstr "طريقة إدخال الويندوز"
+#: gui/dialogs/qfilesystemmodel.cpp:770
+#, qt-format
+msgid "%1 bytes"
+msgstr "%1 بايتات"
 
-#: gui/inputmethod/qinputcontextfactory.cpp:336
-msgid "Mac OS X input method"
-msgstr "طريقة إدخال ماك أوس أكس"
+#: gui/dialogs/qfilesystemmodel.cpp:859
+msgid "Invalid filename"
+msgstr "اسم ملف غير صالح"
 
-#: gui/inputmethod/qinputcontextfactory.cpp:340
-msgid "S60 FEP input method"
+#: gui/dialogs/qfilesystemmodel.cpp:860
+#, qt-format
+msgid ""
+"<b>The name \"%1\" can not be used.</b><p>Try using another name, with fewer "
+"characters or no punctuations marks."
 msgstr ""
+"<b>لا يمكن استخدام الاسم \"%1\" .</b><p>حاول استخدام اسم آخر  بمحارف  أقل أو "
+"بدون علامات تشكيل."
 
 #: gui/dialogs/qpagesetupdialog_unix.cpp:72
 msgid "A0"
@@ -2403,62 +2477,10 @@
 msgid "Points (pt)"
 msgstr "نقطة (نقطة)"
 
-#: gui/dialogs/qfontdialog.cpp:183
-msgid "Select Font"
-msgstr "اختر الخط"
-
-#: gui/dialogs/qfontdialog.cpp:768
-msgid "&Font"
-msgstr "ال&خط"
-
-#: gui/dialogs/qfontdialog.cpp:769
-msgid "Font st&yle"
-msgstr "أ&سلوب الخط"
-
-#: gui/dialogs/qfontdialog.cpp:774
-msgid "Effects"
-msgstr "التأثيرات"
-
-#: gui/dialogs/qfontdialog.cpp:776
-msgid "Stri&keout"
-msgstr "ش&طب"
-
-#: gui/dialogs/qfontdialog.cpp:777
-msgid "&Underline"
-msgstr "م&سطر"
-
-#: gui/dialogs/qfontdialog.cpp:778
-msgid "Sample"
-msgstr "عيًنة"
-
-#: gui/dialogs/qfontdialog.cpp:779
-msgid "Wr&iting System"
-msgstr "نظام ال&كتابة"
-
-#: gui/dialogs/qsidebar.cpp:442
-msgid "Remove"
-msgstr "احذف"
-
-#: gui/dialogs/qfilesystemmodel.cpp:770
-#, qt-format
-msgid "%1 bytes"
-msgstr "%1 بايتات"
-
-#: gui/dialogs/qfilesystemmodel.cpp:859
-msgid "Invalid filename"
-msgstr "اسم ملف غير صالح"
-
-#: gui/dialogs/qfilesystemmodel.cpp:860
-#, qt-format
-msgid ""
-"<b>The name \"%1\" can not be used.</b><p>Try using another name, with fewer "
-"characters or no punctuations marks."
-msgstr ""
-"<b>لا يمكن استخدام الاسم \"%1\" .</b><p>حاول استخدام اسم آخر  بمحارف  أقل أو "
-"بدون علامات تشكيل."
-
-#: gui/dialogs/qinputdialog.cpp:223
-msgid "Enter a value:"
+#: gui/dialogs/qabstractprintdialog.cpp:116
+#: gui/dialogs/qabstractprintdialog.cpp:129
+msgctxt "QPrintDialog"
+msgid "Print"
 msgstr ""
 
 #: gui/dialogs/qmessagebox.cpp:139
@@ -2514,2312 +2536,2444 @@
 msgid "About Qt"
 msgstr "حَوْل Qt"
 
-#: gui/dialogs/qprintdialog_qws.cpp:148
-msgid "File exists"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:149
-msgid "<qt>Do you want to overwrite it?</qt>"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:333
-msgid "A0 (841 x 1189 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:334
-msgid "A1 (594 x 841 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:335
-msgid "A2 (420 x 594 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:336
-msgid "A3 (297 x 420 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:337
-msgid "A4 (210 x 297 mm, 8.26 x 11.7 inches)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:338
-msgid "A5 (148 x 210 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:339
-msgid "A6 (105 x 148 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:340
-msgid "A7 (74 x 105 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:341
-msgid "A8 (52 x 74 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:342
-msgid "A9 (37 x 52 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:343
-msgid "B0 (1000 x 1414 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:344
-msgid "B1 (707 x 1000 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:345
-msgid "B2 (500 x 707 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:346
-msgid "B3 (353 x 500 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:347
-msgid "B4 (250 x 353 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:348
-msgid "B5 (176 x 250 mm, 6.93 x 9.84 inches)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:349
-msgid "B6 (125 x 176 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:350
-msgid "B7 (88 x 125 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:351
-msgid "B8 (62 x 88 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:352
-msgid "B9 (44 x 62 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:353
-msgid "B10 (31 x 44 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:354
-msgid "C5E (163 x 229 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:355
-msgid "DLE (110 x 220 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:356
-msgid "Executive (7.5 x 10 inches, 191 x 254 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:357
-msgid "Folio (210 x 330 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:358
-msgid "Ledger (432 x 279 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:359
-msgid "Legal (8.5 x 14 inches, 216 x 356 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:360
-msgid "Letter (8.5 x 11 inches, 216 x 279 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:361
-msgid "Tabloid (279 x 432 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:362
-msgid "US Common #10 Envelope (105 x 241 mm)"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:380
-msgid "Print selection"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_qws.cpp:382
-msgid "Print current page"
-msgstr ""
-
-#: gui/dialogs/qabstractprintdialog.cpp:116
-#: gui/dialogs/qabstractprintdialog.cpp:129
-msgctxt "QPrintDialog"
-msgid "Print"
-msgstr ""
-
-#: gui/dialogs/qprintdialog_unix.cpp:396 gui/dialogs/qprintdialog_unix.cpp:464
-msgid "&Options >>"
-msgstr ""
+#: gui/dialogs/qabstractpagesetupdialog.cpp:68
+#: gui/dialogs/qabstractpagesetupdialog.cpp:80
+msgctxt "QPrintPreviewDialog"
+msgid "Page Setup"
+msgstr "إعداد الصفحة"
 
-#: gui/dialogs/qprintdialog_unix.cpp:401
-msgid "&Print"
-msgstr ""
+#: gui/inputmethod/qinputcontextfactory.cpp:301
+msgid "XIM"
+msgstr "XIM"
 
-#: gui/dialogs/qprintdialog_unix.cpp:468
-msgid "&Options <<"
+#: gui/inputmethod/qinputcontextfactory.cpp:305
+msgid "FEP"
 msgstr ""
 
-#: gui/dialogs/qprintdialog_unix.cpp:728
-msgid "Print to File (PDF)"
-msgstr ""
+#: gui/inputmethod/qinputcontextfactory.cpp:328
+msgid "XIM input method"
+msgstr "طريقة إدخال XIM"
 
-#: gui/dialogs/qprintdialog_unix.cpp:729
-msgid "Print to File (Postscript)"
-msgstr ""
+#: gui/inputmethod/qinputcontextfactory.cpp:332
+msgid "Windows input method"
+msgstr "طريقة إدخال الويندوز"
 
-#: gui/dialogs/qprintdialog_unix.cpp:776
-msgid "Local file"
-msgstr ""
+#: gui/inputmethod/qinputcontextfactory.cpp:336
+msgid "Mac OS X input method"
+msgstr "طريقة إدخال ماك أوس أكس"
 
-#: gui/dialogs/qprintdialog_unix.cpp:777
-#, qt-format
-msgid "Write %1 file"
+#: gui/inputmethod/qinputcontextfactory.cpp:340
+msgid "S60 FEP input method"
 msgstr ""
 
-#: gui/dialogs/qprintdialog_unix.cpp:848
-msgid "Print To File ..."
-msgstr ""
+#: gui/accessible/qaccessibleobject.cpp:374
+msgid "Activate"
+msgstr "نشط"
 
-#: gui/dialogs/qprintdialog_unix.cpp:926
-#, qt-format
-msgid ""
-"%1 is a directory.\n"
-"Please choose a different file name."
-msgstr ""
+#: gui/accessible/qaccessibleobject.cpp:376
+msgid "Activates the program's main window"
+msgstr "ينشّط النافذة الرئيسة للبرنامج"
 
-#: gui/dialogs/qprintdialog_unix.cpp:930
+#: gui/util/qundogroup.cpp:388 gui/util/qundostack.cpp:877
 #, qt-format
-msgid ""
-"File %1 is not writable.\n"
-"Please choose a different file name."
+msgid "Undo %1"
 msgstr ""
 
-#: gui/dialogs/qprintdialog_unix.cpp:934
-#, qt-format
-msgid ""
-"%1 already exists.\n"
-"Do you want to overwrite it?"
+#: gui/util/qundogroup.cpp:388 gui/util/qundostack.cpp:877
+msgctxt "Default text for undo action"
+msgid "Undo"
 msgstr ""
 
-#: gui/dialogs/qprintdialog_unix.cpp:1238
-msgctxt "QPPDOptionsModel"
-msgid "Name"
+#: gui/util/qundogroup.cpp:419 gui/util/qundostack.cpp:907
+#, qt-format
+msgid "Redo %1"
 msgstr ""
 
-#: gui/dialogs/qprintdialog_unix.cpp:1240
-msgctxt "QPPDOptionsModel"
-msgid "Value"
+#: gui/util/qundogroup.cpp:419 gui/util/qundostack.cpp:907
+msgctxt "Default text for redo action"
+msgid "Redo"
 msgstr ""
 
-#: gui/dialogs/qprintpreviewdialog.cpp:249
-#, qt-format
-msgid "%1%"
-msgstr ""
+#: gui/util/qdesktopservices_mac.cpp:171
+msgid "Home"
+msgstr "المنزل"
 
-#: gui/dialogs/qprintpreviewdialog.cpp:333
-msgctxt "QPrintPreviewDialog"
-msgid "Print Preview"
-msgstr "معاينة الطباعة"
+#: gui/util/qundoview.cpp:101
+msgid "<empty>"
+msgstr "<فارغ>"
 
-#: gui/dialogs/qprintpreviewdialog.cpp:363
-msgctxt "QPrintPreviewDialog"
-msgid "Next page"
-msgstr "الصفحة التالية"
+#: gui/widgets/qabstractspinbox.cpp:1257
+msgid "&Select All"
+msgstr "اختر ال&كلّ"
 
-#: gui/dialogs/qprintpreviewdialog.cpp:364
-msgctxt "QPrintPreviewDialog"
-msgid "Previous page"
-msgstr "الصفحة السابقة"
+#: gui/widgets/qabstractspinbox.cpp:1263
+msgid "&Step up"
+msgstr "خطوة أ&على"
 
-#: gui/dialogs/qprintpreviewdialog.cpp:365
-msgctxt "QPrintPreviewDialog"
-msgid "First page"
-msgstr "الصفحة الأولى"
+#: gui/widgets/qabstractspinbox.cpp:1265
+msgid "Step &down"
+msgstr "خطوة أ&سفل"
 
-#: gui/dialogs/qprintpreviewdialog.cpp:366
-msgctxt "QPrintPreviewDialog"
-msgid "Last page"
-msgstr "الصفحة الأخيرة"
+#: gui/widgets/qmenu_symbian.cpp:457
+msgid "Actions"
+msgstr ""
 
-#: gui/dialogs/qprintpreviewdialog.cpp:375
-msgctxt "QPrintPreviewDialog"
-msgid "Fit width"
-msgstr "ناسب العرض"
+#: gui/widgets/qmdisubwindow.cpp:279
+#, qt-format
+msgid "- [%1]"
+msgstr "- [%1]"
 
-#: gui/dialogs/qprintpreviewdialog.cpp:376
-msgctxt "QPrintPreviewDialog"
-msgid "Fit page"
-msgstr "ناسب الصفحة"
+#: gui/widgets/qmdisubwindow.cpp:280 gui/widgets/qworkspace.cpp:1886
+#: gui/widgets/qworkspace.cpp:1946
+#, qt-format
+msgid "%1 - [%2]"
+msgstr "%1 - [%2]"
 
-#: gui/dialogs/qprintpreviewdialog.cpp:387
-msgctxt "QPrintPreviewDialog"
-msgid "Zoom in"
-msgstr "كبر"
+#: gui/widgets/qmdisubwindow.cpp:334 gui/widgets/qworkspace.cpp:115
+#: plugins/accessible/compat/q3complexwidgets.cpp:250
+msgid "Minimize"
+msgstr "تصغير"
 
-#: gui/dialogs/qprintpreviewdialog.cpp:388
-msgctxt "QPrintPreviewDialog"
-msgid "Zoom out"
-msgstr "صغر"
+#: gui/widgets/qmdisubwindow.cpp:337
+#: plugins/accessible/compat/q3complexwidgets.cpp:254
+msgid "Maximize"
+msgstr "تكبير"
 
-#: gui/dialogs/qprintpreviewdialog.cpp:394
-msgctxt "QPrintPreviewDialog"
-msgid "Portrait"
-msgstr "طولي"
+#: gui/widgets/qmdisubwindow.cpp:340
+msgid "Unshade"
+msgstr "إلغاء التظليل"
 
-#: gui/dialogs/qprintpreviewdialog.cpp:395
-msgctxt "QPrintPreviewDialog"
-msgid "Landscape"
-msgstr "عرضي"
+#: gui/widgets/qmdisubwindow.cpp:343
+msgid "Shade"
+msgstr "تظليل"
 
-#: gui/dialogs/qprintpreviewdialog.cpp:405
-msgctxt "QPrintPreviewDialog"
-msgid "Show single page"
-msgstr "أظهر صفحة مفردة"
+#: gui/widgets/qmdisubwindow.cpp:347 gui/widgets/qworkspace.cpp:117
+msgid "Restore Down"
+msgstr "إعادة الحالة سفليا"
 
-#: gui/dialogs/qprintpreviewdialog.cpp:406
-msgctxt "QPrintPreviewDialog"
-msgid "Show facing pages"
-msgstr "أظهر الصفحات المتقابلة"
+#: gui/widgets/qmdisubwindow.cpp:349
+msgid "Restore"
+msgstr "إسترجاع"
 
-#: gui/dialogs/qprintpreviewdialog.cpp:407
-msgctxt "QPrintPreviewDialog"
-msgid "Show overview of all pages"
-msgstr "أظهر معاينة لكل الصفحات"
+#: gui/widgets/qmdisubwindow.cpp:352 gui/widgets/qworkspace.cpp:113
+#: plugins/accessible/compat/q3complexwidgets.cpp:256
+#: plugins/accessible/widgets/complexwidgets.cpp:1847
+#: plugins/accessible/widgets/qaccessiblemenu.cpp:157
+#: plugins/accessible/widgets/qaccessiblemenu.cpp:382
+#: plugins/accessible/widgets/qaccessiblewidgets.cpp:1249
+#: scripttools/debugging/qscriptbreakpointswidget.cpp:81
+#: scripttools/debugging/qscriptdebuggercodefinderwidget.cpp:141
+msgid "Close"
+msgstr "أغلق"
 
-#: gui/dialogs/qprintpreviewdialog.cpp:422
-msgctxt "QPrintPreviewDialog"
-msgid "Print"
-msgstr "اطبع"
+#: gui/widgets/qmdisubwindow.cpp:358
+msgid "Menu"
+msgstr "قائمة"
 
-#: gui/dialogs/qprintpreviewdialog.cpp:423
-msgctxt "QPrintPreviewDialog"
-msgid "Page setup"
-msgstr "إعداد الصفحة"
+#: gui/widgets/qmdisubwindow.cpp:1054 gui/widgets/qworkspace.cpp:1089
+msgid "&Restore"
+msgstr "اس&ترجاع"
 
-#: gui/dialogs/qprintpreviewdialog.cpp:429
-msgctxt "QPrintPreviewDialog"
-msgid "Close"
-msgstr "أغلق"
+#: gui/widgets/qmdisubwindow.cpp:1057 gui/widgets/qworkspace.cpp:1090
+msgid "&Move"
+msgstr "&نقل"
 
-#: gui/dialogs/qprintpreviewdialog.cpp:577
-msgctxt "QPrintPreviewDialog"
-msgid "Export to PDF"
-msgstr ""
+#: gui/widgets/qmdisubwindow.cpp:1059 gui/widgets/qworkspace.cpp:1093
+msgid "Mi&nimize"
+msgstr "ت&صغير"
 
-#: gui/dialogs/qprintpreviewdialog.cpp:580
-msgctxt "QPrintPreviewDialog"
-msgid "Export to PostScript"
-msgstr ""
+#: gui/widgets/qmdisubwindow.cpp:1061 gui/widgets/qworkspace.cpp:1095
+msgid "Ma&ximize"
+msgstr "ت&كبير"
 
-#: gui/dialogs/qwizard.cpp:688
-msgid "Go Back"
-msgstr "ارجع للخلف"
+#: gui/widgets/qmdisubwindow.cpp:1063 gui/widgets/qworkspace.cpp:1103
+msgid "Stay on &Top"
+msgstr "البقاء في ال&وجه."
 
-#: gui/dialogs/qwizard.cpp:688 qt3support/dialogs/q3wizard.cpp:178
-msgid "< &Back"
-msgstr "< لل&خلف"
+#: gui/widgets/qmdisubwindow.cpp:1066 gui/widgets/qworkspace.cpp:1097
+msgid "&Close"
+msgstr "إ&غلاق"
 
-#: gui/dialogs/qwizard.cpp:691 scripttools/debugging/qscriptdebugger.cpp:1694
-msgid "Continue"
-msgstr "استمر"
+#: gui/widgets/qscrollbar.cpp:453
+msgid "Scroll here"
+msgstr "لف هنا"
 
-#: gui/dialogs/qwizard.cpp:694
-msgid "&Next"
-msgstr "ال&تالي"
+#: gui/widgets/qscrollbar.cpp:455
+msgid "Left edge"
+msgstr "الحافة اليسرى"
 
-#: gui/dialogs/qwizard.cpp:694 qt3support/dialogs/q3wizard.cpp:179
-msgid "&Next >"
-msgstr "ال&تالي >"
+#: gui/widgets/qscrollbar.cpp:455
+msgid "Top"
+msgstr "أعلى"
 
-#: gui/dialogs/qwizard.cpp:696
-msgid "Commit"
-msgstr "أرسِل"
+#: gui/widgets/qscrollbar.cpp:456
+msgid "Right edge"
+msgstr "الحافة اليمنى"
 
-#: gui/dialogs/qwizard.cpp:698 qt3support/dialogs/q3wizard.cpp:180
-msgid "&Finish"
-msgstr "إ&نتهاء"
+#: gui/widgets/qscrollbar.cpp:456
+msgid "Bottom"
+msgstr "أسفل"
 
-#: gui/dialogs/qwizard.cpp:702 qt3support/dialogs/q3wizard.cpp:181
-msgid "&Help"
-msgstr "&مساعدة"
+#: gui/widgets/qscrollbar.cpp:458
+#: plugins/accessible/widgets/rangecontrols.cpp:706
+msgid "Page left"
+msgstr "صفحة يسار"
 
-#: gui/dialogs/qabstractpagesetupdialog.cpp:68
-#: gui/dialogs/qabstractpagesetupdialog.cpp:80
-msgctxt "QPrintPreviewDialog"
-msgid "Page Setup"
-msgstr "إعداد الصفحة"
+#: gui/widgets/qscrollbar.cpp:458
+#: plugins/accessible/widgets/rangecontrols.cpp:553
+#: plugins/accessible/widgets/rangecontrols.cpp:706
+msgid "Page up"
+msgstr "صفحة أعلى"
 
-#: gui/dialogs/qprintdialog_win.cpp:270
-msgid "Print"
-msgstr ""
+#: gui/widgets/qscrollbar.cpp:459
+#: plugins/accessible/widgets/rangecontrols.cpp:711
+msgid "Page right"
+msgstr "صفحة يمين"
 
-#: gui/dialogs/qprintdialog_win.cpp:271
-msgid "The 'From' value cannot be greater than the 'To' value."
-msgstr ""
+#: gui/widgets/qscrollbar.cpp:459
+#: plugins/accessible/widgets/rangecontrols.cpp:557
+#: plugins/accessible/widgets/rangecontrols.cpp:711
+msgid "Page down"
+msgstr "صفحة أسفل"
 
-#: qt3support/network/q3networkprotocol.cpp:854
-msgid "Operation stopped by the user"
-msgstr "العملية توقفت من قبل المستخدم"
+#: gui/widgets/qscrollbar.cpp:461
+msgid "Scroll left"
+msgstr "تمرير لليسار"
 
-#: qt3support/sql/q3datatable.cpp:791
-msgid "Insert"
-msgstr "إدراج"
+#: gui/widgets/qscrollbar.cpp:461
+msgid "Scroll up"
+msgstr "تمرير للأعلى"
 
-#: qt3support/sql/q3datatable.cpp:792
-msgid "Update"
-msgstr "تحديث"
+#: gui/widgets/qscrollbar.cpp:462
+msgid "Scroll right"
+msgstr "تمرير لليمين"
 
-#: qt3support/sql/q3sqlmanager_p.cpp:890
-msgctxt "QSql"
-msgid "Delete"
-msgstr ""
+#: gui/widgets/qscrollbar.cpp:462
+msgid "Scroll down"
+msgstr "تمرير للأسفل"
 
-#: qt3support/sql/q3sqlmanager_p.cpp:891
-msgctxt "QSql"
-msgid "Delete this record?"
-msgstr ""
+#: gui/widgets/qdialogbuttonbox.cpp:658
+msgctxt "QDialogButtonBox"
+msgid "&OK"
+msgstr "&موافق"
 
-#: qt3support/sql/q3sqlmanager_p.cpp:892 qt3support/sql/q3sqlmanager_p.cpp:908
-#: qt3support/sql/q3sqlmanager_p.cpp:944
-msgctxt "QSql"
-msgid "Yes"
+#: gui/widgets/qdialogbuttonbox.cpp:658
+msgctxt "QDialogButtonBox"
+msgid "OK"
 msgstr ""
 
-#: qt3support/sql/q3sqlmanager_p.cpp:893 qt3support/sql/q3sqlmanager_p.cpp:909
-#: qt3support/sql/q3sqlmanager_p.cpp:945
-msgctxt "QSql"
-msgid "No"
+#: gui/widgets/qdialogbuttonbox.cpp:661
+msgctxt "QDialogButtonBox"
+msgid "&Save"
 msgstr ""
 
-#: qt3support/sql/q3sqlmanager_p.cpp:901
-msgctxt "QSql"
-msgid "Insert"
-msgstr ""
+#: gui/widgets/qdialogbuttonbox.cpp:661
+msgctxt "QDialogButtonBox"
+msgid "Save"
+msgstr "احفظ"
 
-#: qt3support/sql/q3sqlmanager_p.cpp:903
-msgctxt "QSql"
-msgid "Update"
-msgstr ""
+#: gui/widgets/qdialogbuttonbox.cpp:664
+msgctxt "QDialogButtonBox"
+msgid "Open"
+msgstr "افتح"
 
-#: qt3support/sql/q3sqlmanager_p.cpp:907
-msgctxt "QSql"
-msgid "Save edits?"
+#: gui/widgets/qdialogbuttonbox.cpp:667
+msgctxt "QDialogButtonBox"
+msgid "&Cancel"
 msgstr ""
 
-#: qt3support/sql/q3sqlmanager_p.cpp:910
-msgctxt "QSql"
+#: gui/widgets/qdialogbuttonbox.cpp:667
+msgctxt "QDialogButtonBox"
 msgid "Cancel"
-msgstr ""
-
-#: qt3support/sql/q3sqlmanager_p.cpp:942
-msgctxt "QSql"
-msgid "Confirm"
-msgstr ""
+msgstr "ألغ"
 
-#: qt3support/sql/q3sqlmanager_p.cpp:943
-msgctxt "QSql"
-msgid "Cancel your edits?"
+#: gui/widgets/qdialogbuttonbox.cpp:670
+msgctxt "QDialogButtonBox"
+msgid "&Close"
 msgstr ""
 
-#: qt3support/text/q3textedit.cpp:5441
-msgid "Clear"
-msgstr "محو"
-
-#: qt3support/widgets/q3mainwindow.cpp:2051
-#: plugins/accessible/widgets/rangecontrols.cpp:551
-msgid "Line up"
-msgstr "صُفّ على سطر"
+#: gui/widgets/qdialogbuttonbox.cpp:670
+msgctxt "QDialogButtonBox"
+msgid "Close"
+msgstr "أغلق"
 
-#: qt3support/widgets/q3mainwindow.cpp:2053
-msgid "Customize..."
-msgstr "تخصيص..."
+#: gui/widgets/qdialogbuttonbox.cpp:673
+msgctxt "QDialogButtonBox"
+msgid "Apply"
+msgstr "طبق"
 
-#: qt3support/widgets/q3toolbar.cpp:692
-msgid "More..."
-msgstr "أكثر..."
+#: gui/widgets/qdialogbuttonbox.cpp:676
+msgctxt "QDialogButtonBox"
+msgid "Reset"
+msgstr "أعد الضبط"
 
-#: qt3support/other/q3accel.cpp:481
-#, qt-format
-msgid "%1, %2 not defined"
-msgstr "%1 ،  %2 غير معرّف"
+#: gui/widgets/qdialogbuttonbox.cpp:679
+msgctxt "QDialogButtonBox"
+msgid "Help"
+msgstr "مساعدة"
 
-#: qt3support/other/q3accel.cpp:517
-#, qt-format
-msgid "Ambiguous %1 not handled"
-msgstr ""
+#: gui/widgets/qdialogbuttonbox.cpp:683
+msgctxt "QDialogButtonBox"
+msgid "Don't Save"
+msgstr "لا تحفظ"
 
-#: qt3support/dialogs/q3wizard.cpp:177
-msgid "&Cancel"
-msgstr "إل&غاء"
+#: gui/widgets/qdialogbuttonbox.cpp:685
+msgctxt "QDialogButtonBox"
+msgid "Close without Saving"
+msgstr "أغلق بدون حفظ"
 
-#: qt3support/dialogs/q3tabdialog.cpp:648
-msgid "Apply"
-msgstr "طبِق"
+#: gui/widgets/qdialogbuttonbox.cpp:687
+msgctxt "QDialogButtonBox"
+msgid "Discard"
+msgstr "أهمل"
 
-#: qt3support/dialogs/q3tabdialog.cpp:736
-msgid "Defaults"
-msgstr "الافتراضيات"
+#: gui/widgets/qdialogbuttonbox.cpp:690
+msgctxt "QDialogButtonBox"
+msgid "&Yes"
+msgstr "&نعم"
 
-#: xml/sax/qxml.cpp:58
-msgctxt "QXml"
-msgid "no error occurred"
-msgstr "لم يحدث أي خطأ"
+#: gui/widgets/qdialogbuttonbox.cpp:693
+msgctxt "QDialogButtonBox"
+msgid "Yes to &All"
+msgstr "نعم إلى ال&كل"
 
-#: xml/sax/qxml.cpp:59
-msgctxt "QXml"
-msgid "error triggered by consumer"
-msgstr "خطأ مسبب من المستخدم"
+#: gui/widgets/qdialogbuttonbox.cpp:696
+msgctxt "QDialogButtonBox"
+msgid "&No"
+msgstr "&لا"
 
-#: xml/sax/qxml.cpp:60
-msgctxt "QXml"
-msgid "unexpected end of file"
-msgstr "نهاية غير متوقعة للملف"
+#: gui/widgets/qdialogbuttonbox.cpp:699
+msgctxt "QDialogButtonBox"
+msgid "N&o to All"
+msgstr "ل&ا للكل"
 
-#: xml/sax/qxml.cpp:61
-msgctxt "QXml"
-msgid "more than one document type definition"
-msgstr "أكثر من تعريف لنوع المستند"
+#: gui/widgets/qdialogbuttonbox.cpp:702
+msgctxt "QDialogButtonBox"
+msgid "Save All"
+msgstr "احفظ الكلّ"
 
-#: xml/sax/qxml.cpp:62
-msgctxt "QXml"
-msgid "error occurred while parsing element"
-msgstr "حدث خطأ أثناء تحليل المفردة"
+#: gui/widgets/qdialogbuttonbox.cpp:705
+msgctxt "QDialogButtonBox"
+msgid "Abort"
+msgstr "أجهض"
 
-#: xml/sax/qxml.cpp:63
-msgctxt "QXml"
-msgid "tag mismatch"
-msgstr "عدم تطابق في العلامة TAG"
+#: gui/widgets/qdialogbuttonbox.cpp:708
+msgctxt "QDialogButtonBox"
+msgid "Retry"
+msgstr "أعِد المحاولة"
 
-#: xml/sax/qxml.cpp:64
-msgctxt "QXml"
-msgid "error occurred while parsing content"
-msgstr "حدث خطأ أثناء تحليل المحتوى"
+#: gui/widgets/qdialogbuttonbox.cpp:711
+msgctxt "QDialogButtonBox"
+msgid "Ignore"
+msgstr "تجاهل"
 
-#: xml/sax/qxml.cpp:65
-msgctxt "QXml"
-msgid "unexpected character"
-msgstr "حرف غير متوقع"
+#: gui/widgets/qdialogbuttonbox.cpp:714
+msgctxt "QDialogButtonBox"
+msgid "Restore Defaults"
+msgstr "استعد الإفتراضيات"
 
-#: xml/sax/qxml.cpp:66
-msgctxt "QXml"
-msgid "invalid name for processing instruction"
-msgstr "أسم غير صالح لتعليمة معالجة"
+#: gui/widgets/qworkspace.cpp:1106 gui/widgets/qworkspace.cpp:2164
+msgid "Sh&ade"
+msgstr "تظ&ليل"
 
-#: xml/sax/qxml.cpp:67
-msgctxt "QXml"
-msgid "version expected while reading the XML declaration"
-msgstr "توقع وجود رقم للإصدارة أثناء قراءة تعريف XML"
+#: gui/widgets/qworkspace.cpp:2160
+msgid "&Unshade"
+msgstr "إلغاء الت&ظليل"
 
-#: xml/sax/qxml.cpp:68
-msgctxt "QXml"
-msgid "wrong value for standalone declaration"
-msgstr "قيمة خاطئة لتعليمة منفردة"
+#: gui/widgets/qtabbar.cpp:2322
+msgid "Close Tab"
+msgstr ""
 
-#: xml/sax/qxml.cpp:69
-msgctxt "QXml"
-msgid ""
-"encoding declaration or standalone declaration expected while reading the "
-"XML declaration"
+#: gui/widgets/qmenubar.cpp:1927
+msgctxt "QMenuBar"
+msgid "Corner Toolbar"
 msgstr ""
-"كنت أتوقع تعليمة تشفير encoding أو تعليمة منفردة خلال قراءة تعريف ال XML"
 
-#: xml/sax/qxml.cpp:70
-msgctxt "QXml"
-msgid "standalone declaration expected while reading the XML declaration"
-msgstr "كان من المتوقع وجود تعليمة منفردة في تعريف ال XML"
+#: gui/widgets/qmdiarea.cpp:290
+msgid "(Untitled)"
+msgstr "(غير معنون)"
 
-#: xml/sax/qxml.cpp:71
-msgctxt "QXml"
-msgid "error occurred while parsing document type definition"
-msgstr "حدث خطأ أثناء تحليل تعريف نوع المستند"
+#: gui/widgets/qdatetimeedit.cpp:2289
+msgid "AM"
+msgstr "ص"
 
-#: xml/sax/qxml.cpp:72
-msgctxt "QXml"
-msgid "letter is expected"
-msgstr "توقع حرف"
+#: gui/widgets/qdatetimeedit.cpp:2289
+msgid "am"
+msgstr "ص"
 
-#: xml/sax/qxml.cpp:73
-msgctxt "QXml"
-msgid "error occurred while parsing comment"
-msgstr "حدث خطأ أثناء تحليل التعليق"
+#: gui/widgets/qdatetimeedit.cpp:2291
+msgid "PM"
+msgstr "م"
 
-#: xml/sax/qxml.cpp:74
-msgctxt "QXml"
-msgid "error occurred while parsing reference"
-msgstr "حدث خطأ أثناء تحليل المراجع"
+#: gui/widgets/qdatetimeedit.cpp:2291
+msgid "pm"
+msgstr "م"
 
-#: xml/sax/qxml.cpp:75
-msgctxt "QXml"
-msgid "internal general entity reference not allowed in DTD"
-msgstr "إشارة إلى وحدة داخلية عامة غير مقبول في DTD"
+#: gui/text/qfontdatabase.cpp:108 gui/text/qfontdatabase.cpp:1526
+msgctxt "QFontDatabase"
+msgid "Normal"
+msgstr "عادي"
 
-#: xml/sax/qxml.cpp:76
-msgctxt "QXml"
-msgid ""
-"external parsed general entity reference not allowed in attribute value"
-msgstr "إشارة إلى وحدة عامة خارجية محللة غير مقبول في قيمة الصفة"
+#: gui/text/qfontdatabase.cpp:111 gui/text/qfontdatabase.cpp:123
+#: gui/text/qfontdatabase.cpp:1514
+msgctxt "QFontDatabase"
+msgid "Bold"
+msgstr "عريض"
 
-#: xml/sax/qxml.cpp:77
-msgctxt "QXml"
-msgid "external parsed general entity reference not allowed in DTD"
-msgstr "إشارة إلى وحدة عامة خارجية محللة غير مقبول في DTD"
+#: gui/text/qfontdatabase.cpp:114 gui/text/qfontdatabase.cpp:1516
+msgctxt "QFontDatabase"
+msgid "Demi Bold"
+msgstr "نصف عريض"
 
-#: xml/sax/qxml.cpp:78
-msgctxt "QXml"
-msgid "unparsed entity reference in wrong context"
-msgstr "إشارة الى وحدة غير محللة في سياق خاطئ"
+#: gui/text/qfontdatabase.cpp:117 gui/text/qfontdatabase.cpp:135
+#: gui/text/qfontdatabase.cpp:1512
+msgctxt "QFontDatabase"
+msgid "Black"
+msgstr "أسود"
 
-#: xml/sax/qxml.cpp:79
-msgctxt "QXml"
-msgid "recursive entities"
-msgstr "كائنات مستدعاة ذاتيا"
+#: gui/text/qfontdatabase.cpp:125
+msgctxt "QFontDatabase"
+msgid "Demi"
+msgstr "نصف"
 
-#: xml/sax/qxml.cpp:80
-msgctxt "QXml"
-msgid "error in the text declaration of an external entity"
-msgstr "خطأ في نص بيان وحدة خارجية"
+#: gui/text/qfontdatabase.cpp:131 gui/text/qfontdatabase.cpp:1518
+msgctxt "QFontDatabase"
+msgid "Light"
+msgstr "فاتح"
 
-#: network/kernel/qhostinfo_unix.cpp:196
-#: network/kernel/qhostinfo_symbian.cpp:137
-#: network/kernel/qhostinfo_symbian.cpp:287
-msgctxt "QHostInfoAgent"
-msgid "No host name given"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:301 gui/text/qfontdatabase.cpp:1521
+msgctxt "QFontDatabase"
+msgid "Italic"
+msgstr "مائل"
 
-#: network/kernel/qhostinfo_unix.cpp:197
-#: network/kernel/qhostinfo_symbian.cpp:138
-#: network/kernel/qhostinfo_symbian.cpp:288
-msgctxt "QHostInfoAgent"
-msgid "Invalid hostname"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:304 gui/text/qfontdatabase.cpp:1523
+msgctxt "QFontDatabase"
+msgid "Oblique"
+msgstr "مائل قليلا"
 
-#: network/kernel/qhostinfo_unix.cpp:251 network/kernel/qhostinfo_unix.cpp:290
-#: network/kernel/qhostinfo_win.cpp:199 network/kernel/qhostinfo_win.cpp:228
-msgid "Unknown address type"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2252
+msgctxt "QFontDatabase"
+msgid "Any"
+msgstr "أي"
 
-#: network/kernel/qhostinfo_unix.cpp:264 network/kernel/qhostinfo_unix.cpp:296
-#: network/kernel/qhostinfo_symbian.cpp:73
-#: network/kernel/qhostinfo_win.cpp:206 network/kernel/qhostinfo_win.cpp:233
-#: network/socket/qsocks5socketengine.cpp:668
-#: network/socket/qsocks5socketengine.cpp:694
-#: network/socket/qabstractsocket.cpp:925
-msgid "Host not found"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2255
+msgctxt "QFontDatabase"
+msgid "Latin"
+msgstr "لاتيني"
 
-#: network/kernel/qhostinfo_unix.cpp:300 network/kernel/qhostinfo_win.cpp:209
-#: network/kernel/qhostinfo_win.cpp:236 network/ssl/qsslerror.cpp:289
-#: network/socket/qnativesocketengine.cpp:276
-#: network/socket/qsymbiansocketengine.cpp:1435
-#: corelib/statemachine/qstatemachine.cpp:1046 corelib/io/qiodevice.cpp:1629
-#: corelib/plugin/qlibrary.cpp:1233 corelib/plugin/qpluginloader.cpp:367
-msgid "Unknown error"
-msgstr "خطأ عير معروف"
+#: gui/text/qfontdatabase.cpp:2258
+msgctxt "QFontDatabase"
+msgid "Greek"
+msgstr "يوناني"
 
-#: network/kernel/qhostinfo.cpp:173
-msgctxt "QHostInfo"
-msgid "No host name given"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2261
+msgctxt "QFontDatabase"
+msgid "Cyrillic"
+msgstr "سيريالي"
 
-#: network/kernel/qhostinfo_win.cpp:169
-msgid "No host name given"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2264
+msgctxt "QFontDatabase"
+msgid "Armenian"
+msgstr "أرمني"
 
-#: network/kernel/qhostinfo_win.cpp:169
-msgid "Invalid hostname"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2267
+msgctxt "QFontDatabase"
+msgid "Hebrew"
+msgstr "عبري"
 
-#: network/ssl/qsslsocket_openssl.cpp:286
-#, qt-format
-msgid "Error creating SSL context (%1)"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2270
+msgctxt "QFontDatabase"
+msgid "Arabic"
+msgstr "عربي"
 
-#: network/ssl/qsslsocket_openssl.cpp:340
-#, qt-format
-msgid "Invalid or empty cipher list (%1)"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2273
+msgctxt "QFontDatabase"
+msgid "Syriac"
+msgstr "سرياني"
 
-#: network/ssl/qsslsocket_openssl.cpp:384
-#, qt-format
-msgid "Cannot provide a certificate with no key, %1"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2276
+msgctxt "QFontDatabase"
+msgid "Thaana"
+msgstr "تاأنا"
 
-#: network/ssl/qsslsocket_openssl.cpp:391
-#, qt-format
-msgid "Error loading local certificate, %1"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2279
+msgctxt "QFontDatabase"
+msgid "Devanagari"
+msgstr "دفنيجري"
 
-#: network/ssl/qsslsocket_openssl.cpp:406
-#, qt-format
-msgid "Error loading private key, %1"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2282
+msgctxt "QFontDatabase"
+msgid "Bengali"
+msgstr "بنغالي"
 
-#: network/ssl/qsslsocket_openssl.cpp:413
-#, qt-format
-msgid "Private key does not certify public key, %1"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2285
+msgctxt "QFontDatabase"
+msgid "Gurmukhi"
+msgstr "غورموخي"
 
-#: network/ssl/qsslsocket_openssl.cpp:433
-#, qt-format
-msgid "Error creating SSL session, %1"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2288
+msgctxt "QFontDatabase"
+msgid "Gujarati"
+msgstr "كوجراتي"
 
-#: network/ssl/qsslsocket_openssl.cpp:473
-#, qt-format
-msgid "Error creating SSL session: %1"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2291
+msgctxt "QFontDatabase"
+msgid "Oriya"
+msgstr "أوريا"
 
-#: network/ssl/qsslsocket_openssl.cpp:1010
-#, qt-format
-msgid "Unable to write data: %1"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2294
+msgctxt "QFontDatabase"
+msgid "Tamil"
+msgstr "تاميلي"
 
-#: network/ssl/qsslsocket_openssl.cpp:1073
-#, qt-format
-msgid "Unable to decrypt data: %1"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2297
+msgctxt "QFontDatabase"
+msgid "Telugu"
+msgstr "تلوغو"
 
-#: network/ssl/qsslsocket_openssl.cpp:1151
-#: network/ssl/qsslsocket_openssl.cpp:1161
-#, qt-format
-msgid "Error while reading: %1"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2300
+msgctxt "QFontDatabase"
+msgid "Kannada"
+msgstr "كنادا"
+
+#: gui/text/qfontdatabase.cpp:2303
+msgctxt "QFontDatabase"
+msgid "Malayalam"
+msgstr "ملايلام"
+
+#: gui/text/qfontdatabase.cpp:2306
+msgctxt "QFontDatabase"
+msgid "Sinhala"
+msgstr "صنهالا"
 
-#: network/ssl/qsslsocket_openssl.cpp:1256
-#, qt-format
-msgid "Error during SSL handshake: %1"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2309
+msgctxt "QFontDatabase"
+msgid "Thai"
+msgstr "تايلندي"
 
-#: network/ssl/qsslerror.cpp:214 3rdparty/phonon/mmf/utils.cpp:89
-msgid "No error"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2312
+msgctxt "QFontDatabase"
+msgid "Lao"
+msgstr "لاو"
 
-#: network/ssl/qsslerror.cpp:217
-msgid "The issuer certificate could not be found"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2315
+msgctxt "QFontDatabase"
+msgid "Tibetan"
+msgstr "تبيتي"
 
-#: network/ssl/qsslerror.cpp:220
-msgid "The certificate signature could not be decrypted"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2318
+msgctxt "QFontDatabase"
+msgid "Myanmar"
+msgstr "ميانمار"
 
-#: network/ssl/qsslerror.cpp:223
-msgid "The public key in the certificate could not be read"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2321
+msgctxt "QFontDatabase"
+msgid "Georgian"
+msgstr "جورجي"
 
-#: network/ssl/qsslerror.cpp:226
-msgid "The signature of the certificate is invalid"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2324
+msgctxt "QFontDatabase"
+msgid "Khmer"
+msgstr "الخمارية"
 
-#: network/ssl/qsslerror.cpp:229
-msgid "The certificate is not yet valid"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2327
+msgctxt "QFontDatabase"
+msgid "Simplified Chinese"
+msgstr "صيني مبسّط"
 
-#: network/ssl/qsslerror.cpp:232
-msgid "The certificate has expired"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2330
+msgctxt "QFontDatabase"
+msgid "Traditional Chinese"
+msgstr "صيني تقليدي"
 
-#: network/ssl/qsslerror.cpp:235
-msgid "The certificate's notBefore field contains an invalid time"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2333
+msgctxt "QFontDatabase"
+msgid "Japanese"
+msgstr "ياباني"
 
-#: network/ssl/qsslerror.cpp:238
-msgid "The certificate's notAfter field contains an invalid time"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2336
+msgctxt "QFontDatabase"
+msgid "Korean"
+msgstr "كوري"
 
-#: network/ssl/qsslerror.cpp:241
-msgid "The certificate is self-signed, and untrusted"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2339
+msgctxt "QFontDatabase"
+msgid "Vietnamese"
+msgstr "فيتنامي"
 
-#: network/ssl/qsslerror.cpp:244
-msgid ""
-"The root certificate of the certificate chain is self-signed, and untrusted"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2342
+msgctxt "QFontDatabase"
+msgid "Symbol"
+msgstr "رمز"
 
-#: network/ssl/qsslerror.cpp:247
-msgid ""
-"The issuer certificate of a locally looked up certificate could not be found"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2345
+msgctxt "QFontDatabase"
+msgid "Ogham"
+msgstr "أوغام"
 
-#: network/ssl/qsslerror.cpp:250
-msgid "No certificates could be verified"
-msgstr ""
+#: gui/text/qfontdatabase.cpp:2348
+msgctxt "QFontDatabase"
+msgid "Runic"
+msgstr "روني"
 
-#: network/ssl/qsslerror.cpp:253
-msgid "One of the CA certificates is invalid"
+#: gui/text/qfontdatabase.cpp:2351
+msgctxt "QFontDatabase"
+msgid "N'Ko"
 msgstr ""
 
-#: network/ssl/qsslerror.cpp:256
-msgid "The basicConstraints path length parameter has been exceeded"
-msgstr ""
+#: gui/text/qtextcontrol.cpp:2127
+msgid "Copy &Link Location"
+msgstr "انسخ &وصلة الموقع"
 
-#: network/ssl/qsslerror.cpp:259
-msgid "The supplied certificate is unsuitable for this purpose"
-msgstr ""
+#: gui/text/qtextcontrol.cpp:3068
+msgctxt "QUnicodeControlCharacterMenu"
+msgid "LRM Left-to-right mark"
+msgstr "LRM علامة اليسار إلى اليمين"
 
-#: network/ssl/qsslerror.cpp:262
-msgid "The root CA certificate is not trusted for this purpose"
-msgstr ""
+#: gui/text/qtextcontrol.cpp:3069
+msgctxt "QUnicodeControlCharacterMenu"
+msgid "RLM Right-to-left mark"
+msgstr "RLM علامة اليمين إلى يسار"
 
-#: network/ssl/qsslerror.cpp:265
-msgid "The root CA certificate is marked to reject the specified purpose"
-msgstr ""
+#: gui/text/qtextcontrol.cpp:3070
+msgctxt "QUnicodeControlCharacterMenu"
+msgid "ZWJ Zero width joiner"
+msgstr "ZWJ رابط ذو عرض صفري"
 
-#: network/ssl/qsslerror.cpp:268
-msgid ""
-"The current candidate issuer certificate was rejected because its subject "
-"name did not match the issuer name of the current certificate"
-msgstr ""
+#: gui/text/qtextcontrol.cpp:3071
+msgctxt "QUnicodeControlCharacterMenu"
+msgid "ZWNJ Zero width non-joiner"
+msgstr "ZWNJ محرف لا يربط ذو عرض صفري"
 
-#: network/ssl/qsslerror.cpp:272
-msgid ""
-"The current candidate issuer certificate was rejected because its issuer "
-"name and serial number was present and did not match the authority key "
-"identifier of the current certificate"
-msgstr ""
+#: gui/text/qtextcontrol.cpp:3072
+msgctxt "QUnicodeControlCharacterMenu"
+msgid "ZWSP Zero width space"
+msgstr "ZWSP فراغ ذو عرض صفري"
 
-#: network/ssl/qsslerror.cpp:277
-msgid "The peer did not present any certificate"
-msgstr ""
+#: gui/text/qtextcontrol.cpp:3073
+msgctxt "QUnicodeControlCharacterMenu"
+msgid "LRE Start of left-to-right embedding"
+msgstr "LRE ابدأ تضمين اليسار إلى اليمين"
 
-#: network/ssl/qsslerror.cpp:280
-msgid ""
-"The host name did not match any of the valid hosts for this certificate"
-msgstr ""
+#: gui/text/qtextcontrol.cpp:3074
+msgctxt "QUnicodeControlCharacterMenu"
+msgid "RLE Start of right-to-left embedding"
+msgstr "RLE ابدأ تضمين اليمين إلى اليسار"
 
-#: network/ssl/qsslerror.cpp:286
-msgid "The peer certificate is blacklisted"
-msgstr ""
+#: gui/text/qtextcontrol.cpp:3075
+msgctxt "QUnicodeControlCharacterMenu"
+msgid "LRO Start of left-to-right override"
+msgstr "LRO ابدأ تجاوز اليسار إلى اليمين"
 
-#: network/bearer/qnetworksession.cpp:456
-msgid "Invalid configuration."
-msgstr ""
+#: gui/text/qtextcontrol.cpp:3076
+msgctxt "QUnicodeControlCharacterMenu"
+msgid "RLO Start of right-to-left override"
+msgstr "RLO ابدأ تجاوز اليمين إلى يسار"
 
-#: network/access/qnetworkreplyfileimpl.cpp:79
-#: network/access/qnetworkaccessfilebackend.cpp:108
-#, qt-format
-msgctxt "QNetworkAccessFileBackend"
-msgid "Request for opening non-local file %1"
-msgstr ""
+#: gui/text/qtextcontrol.cpp:3077
+msgctxt "QUnicodeControlCharacterMenu"
+msgid "PDF Pop directional formatting"
+msgstr "تنسيق الإتجاهي PDF Pop"
 
-#: network/access/qnetworkreplyfileimpl.cpp:102
-#: network/access/qnetworkaccessfilebackend.cpp:233
-#, qt-format
-msgctxt "QNetworkAccessFileBackend"
-msgid "Cannot open %1: Path is a directory"
-msgstr ""
+#: gui/text/qtextcontrol.cpp:3083
+msgid "Insert Unicode control character"
+msgstr "أدرج محرف يونيكود تحكمي"
 
-#: network/access/qnetworkreplyfileimpl.cpp:115
-#: network/access/qnetworkaccessfilebackend.cpp:153
-#, qt-format
-msgctxt "QNetworkAccessFileBackend"
-msgid "Error opening %1: %2"
+#: gui/kernel/qsoftkeymanager.cpp:67
+#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:67
+msgid "Select"
 msgstr ""
 
-#: network/access/qnetworkaccessfilebackend.cpp:191
-#, qt-format
-msgctxt "QNetworkAccessFileBackend"
-msgid "Write error writing to %1: %2"
-msgstr ""
+#: gui/kernel/qsoftkeymanager_s60.cpp:373
+msgid "Exit"
+msgstr "خروج"
 
-#: network/access/qnetworkaccessfilebackend.cpp:254
-#, qt-format
-msgctxt "QNetworkAccessFileBackend"
-msgid "Read error reading from %1: %2"
+#: gui/kernel/qapplication.cpp:2423
+msgctxt ""
+"Translate this string to the string 'LTR' in left-to-right languages or to "
+"'RTL' in right-to-left languages (such as Hebrew and Arabic) to get proper "
+"widget layout."
+msgid "QT_LAYOUT_DIRECTION"
+msgstr "RTL"
+
+#: gui/kernel/qapplication.cpp:2430
+msgctxt "MAC_APPLICATION_MENU"
+msgid "Services"
 msgstr ""
 
-#: network/access/qnetworkreplydataimpl.cpp:95
+#: gui/kernel/qapplication.cpp:2431
 #, qt-format
-msgctxt "QNetworkAccessDataBackend"
-msgid "Invalid URI: %1"
+msgctxt "MAC_APPLICATION_MENU"
+msgid "Hide %1"
 msgstr ""
 
-#: network/access/qnetworkaccesshttpbackend.cpp:429
-#: network/access/qnetworkaccessftpbackend.cpp:131
-msgid "No suitable proxy found"
+#: gui/kernel/qapplication.cpp:2432
+msgctxt "MAC_APPLICATION_MENU"
+msgid "Hide Others"
 msgstr ""
 
-#: network/access/qnetworkaccesscachebackend.cpp:66
-#, qt-format
-msgctxt "QNetworkAccessCacheBackend"
-msgid "Error opening %1"
+#: gui/kernel/qapplication.cpp:2433
+msgctxt "MAC_APPLICATION_MENU"
+msgid "Show All"
 msgstr ""
 
-#: network/access/qnetworkaccessftpbackend.cpp:145
-#, qt-format
-msgid "Cannot open %1: is a directory"
+#: gui/kernel/qapplication.cpp:2434
+msgctxt "MAC_APPLICATION_MENU"
+msgid "Preferences..."
 msgstr ""
 
-#: network/access/qnetworkaccessftpbackend.cpp:244
+#: gui/kernel/qapplication.cpp:2435
 #, qt-format
-msgid "Logging in to %1 failed: authentication required"
+msgctxt "MAC_APPLICATION_MENU"
+msgid "Quit %1"
 msgstr ""
 
-#: network/access/qnetworkaccessftpbackend.cpp:283
+#: gui/kernel/qapplication.cpp:2436
 #, qt-format
-msgid "Error while downloading %1: %2"
+msgctxt "MAC_APPLICATION_MENU"
+msgid "About %1"
 msgstr ""
 
-#: network/access/qnetworkaccessftpbackend.cpp:285
-#, qt-format
-msgid "Error while uploading %1: %2"
+#: gui/kernel/qkeysequence.cpp:396
+msgctxt "QShortcut"
+msgid "Space"
 msgstr ""
 
-#: network/access/qnetworkreplyimpl.cpp:88
-#, qt-format
-msgctxt "QNetworkReply"
-msgid "Protocol \"%1\" is unknown"
+#: gui/kernel/qkeysequence.cpp:397
+msgctxt "QShortcut"
+msgid "Esc"
 msgstr ""
 
-#: network/access/qnetworkreplyimpl.cpp:114
-#: network/access/qnetworkreplyimpl.cpp:305
-msgctxt "QNetworkReply"
-msgid "Network session error."
+#: gui/kernel/qkeysequence.cpp:398
+msgctxt "QShortcut"
+msgid "Tab"
 msgstr ""
 
-#: network/access/qnetworkreplyimpl.cpp:121
-msgctxt "QNetworkReply"
-msgid "backend start error."
+#: gui/kernel/qkeysequence.cpp:399
+msgctxt "QShortcut"
+msgid "Backtab"
 msgstr ""
 
-#: network/access/qnetworkreplyimpl.cpp:763
-msgid "Temporary network failure."
+#: gui/kernel/qkeysequence.cpp:400
+msgctxt "QShortcut"
+msgid "Backspace"
 msgstr ""
 
-#: network/access/qnetworkreplyimpl.cpp:882
-#: network/access/qnetworkreplyimpl.cpp:912
-msgid "Operation canceled"
+#: gui/kernel/qkeysequence.cpp:401
+msgctxt "QShortcut"
+msgid "Return"
 msgstr ""
 
-#: network/access/qnetworkreplyimpl.cpp:1102
-msgctxt "QNetworkAccessManager"
-msgid "Network access is disabled."
+#: gui/kernel/qkeysequence.cpp:402
+msgctxt "QShortcut"
+msgid "Enter"
 msgstr ""
 
-#: network/access/qnetworkaccessdebugpipebackend.cpp:195
-#, qt-format
-msgctxt "QNetworkAccessDebugPipeBackend"
-msgid "Write error writing to %1: %2"
+#: gui/kernel/qkeysequence.cpp:403
+msgctxt "QShortcut"
+msgid "Ins"
 msgstr ""
 
-#: network/access/qnetworkaccessdebugpipebackend.cpp:255
-#, qt-format
-msgid "Socket error on %1: %2"
+#: gui/kernel/qkeysequence.cpp:404
+msgctxt "QShortcut"
+msgid "Del"
 msgstr ""
 
-#: network/access/qnetworkaccessdebugpipebackend.cpp:270
-#, qt-format
-msgid "Remote host closed the connection prematurely on %1"
+#: gui/kernel/qkeysequence.cpp:405
+msgctxt "QShortcut"
+msgid "Pause"
 msgstr ""
 
-#: network/socket/qsocks5socketengine.cpp:623
-msgid "Connection to proxy refused"
+#: gui/kernel/qkeysequence.cpp:406
+msgctxt "QShortcut"
+msgid "Print"
 msgstr ""
 
-#: network/socket/qsocks5socketengine.cpp:627
-msgid "Connection to proxy closed prematurely"
+#: gui/kernel/qkeysequence.cpp:407
+msgctxt "QShortcut"
+msgid "SysReq"
 msgstr ""
 
-#: network/socket/qsocks5socketengine.cpp:631
-msgid "Proxy host not found"
+#: gui/kernel/qkeysequence.cpp:408
+msgctxt "QShortcut"
+msgid "Home"
 msgstr ""
 
-#: network/socket/qsocks5socketengine.cpp:636
-msgid "Connection to proxy timed out"
+#: gui/kernel/qkeysequence.cpp:409
+msgctxt "QShortcut"
+msgid "End"
 msgstr ""
 
-#: network/socket/qsocks5socketengine.cpp:653
-msgid "Proxy authentication failed"
+#: gui/kernel/qkeysequence.cpp:410
+msgctxt "QShortcut"
+msgid "Left"
 msgstr ""
 
-#: network/socket/qsocks5socketengine.cpp:654
-#, qt-format
-msgid "Proxy authentication failed: %1"
+#: gui/kernel/qkeysequence.cpp:411
+msgctxt "QShortcut"
+msgid "Up"
 msgstr ""
 
-#: network/socket/qsocks5socketengine.cpp:663
-msgid "SOCKS version 5 protocol error"
+#: gui/kernel/qkeysequence.cpp:412
+msgctxt "QShortcut"
+msgid "Right"
 msgstr ""
 
-#: network/socket/qsocks5socketengine.cpp:682
-msgid "General SOCKSv5 server failure"
+#: gui/kernel/qkeysequence.cpp:413
+msgctxt "QShortcut"
+msgid "Down"
 msgstr ""
 
-#: network/socket/qsocks5socketengine.cpp:686
-msgid "Connection not allowed by SOCKSv5 server"
+#: gui/kernel/qkeysequence.cpp:414
+msgctxt "QShortcut"
+msgid "PgUp"
 msgstr ""
 
-#: network/socket/qsocks5socketengine.cpp:690
-#: network/socket/qnativesocketengine.cpp:231
-#: network/socket/qsymbiansocketengine.cpp:1384
-msgid "Network unreachable"
+#: gui/kernel/qkeysequence.cpp:415
+msgctxt "QShortcut"
+msgid "PgDown"
 msgstr ""
 
-#: network/socket/qsocks5socketengine.cpp:698
-#: network/socket/qnativesocketengine.cpp:240
-#: network/socket/qsymbiansocketengine.cpp:1393
-#: network/socket/qabstractsocket.cpp:975
-msgid "Connection refused"
+#: gui/kernel/qkeysequence.cpp:416
+msgctxt "QShortcut"
+msgid "CapsLock"
 msgstr ""
 
-#: network/socket/qsocks5socketengine.cpp:702
-msgid "TTL expired"
+#: gui/kernel/qkeysequence.cpp:417
+msgctxt "QShortcut"
+msgid "NumLock"
 msgstr ""
 
-#: network/socket/qsocks5socketengine.cpp:706
-msgid "SOCKSv5 command not supported"
+#: gui/kernel/qkeysequence.cpp:418
+msgctxt "QShortcut"
+msgid "ScrollLock"
 msgstr ""
 
-#: network/socket/qsocks5socketengine.cpp:710
-msgid "Address type not supported"
+#: gui/kernel/qkeysequence.cpp:419
+msgctxt "QShortcut"
+msgid "Menu"
+msgstr "قائمة"
+
+#: gui/kernel/qkeysequence.cpp:420
+msgctxt "QShortcut"
+msgid "Help"
+msgstr "مساعدة"
+
+#: gui/kernel/qkeysequence.cpp:425
+msgctxt "QShortcut"
+msgid "Back"
+msgstr "للخلف"
+
+#: gui/kernel/qkeysequence.cpp:426
+msgctxt "QShortcut"
+msgid "Forward"
+msgstr "للأمام"
+
+#: gui/kernel/qkeysequence.cpp:427
+msgctxt "QShortcut"
+msgid "Stop"
+msgstr "قف"
+
+#: gui/kernel/qkeysequence.cpp:428
+msgctxt "QShortcut"
+msgid "Refresh"
+msgstr "حدث"
+
+#: gui/kernel/qkeysequence.cpp:429
+msgctxt "QShortcut"
+msgid "Volume Down"
+msgstr "اخفِض الصوت"
+
+#: gui/kernel/qkeysequence.cpp:430
+msgctxt "QShortcut"
+msgid "Volume Mute"
+msgstr "اكتم الصوت"
+
+#: gui/kernel/qkeysequence.cpp:431
+msgctxt "QShortcut"
+msgid "Volume Up"
+msgstr "زد الصوت"
+
+#: gui/kernel/qkeysequence.cpp:432
+msgctxt "QShortcut"
+msgid "Bass Boost"
+msgstr "مكبر الباس"
+
+#: gui/kernel/qkeysequence.cpp:433
+msgctxt "QShortcut"
+msgid "Bass Up"
+msgstr "باس أعلى"
+
+#: gui/kernel/qkeysequence.cpp:434
+msgctxt "QShortcut"
+msgid "Bass Down"
+msgstr "باس أقل"
+
+#: gui/kernel/qkeysequence.cpp:435
+msgctxt "QShortcut"
+msgid "Treble Up"
+msgstr "ندى أعلى"
+
+#: gui/kernel/qkeysequence.cpp:436
+msgctxt "QShortcut"
+msgid "Treble Down"
+msgstr "ندى أقل"
+
+#: gui/kernel/qkeysequence.cpp:437
+msgctxt "QShortcut"
+msgid "Media Play"
+msgstr "شغل الوسيط"
+
+#: gui/kernel/qkeysequence.cpp:438
+msgctxt "QShortcut"
+msgid "Media Stop"
+msgstr "أوقف الوسيط"
+
+#: gui/kernel/qkeysequence.cpp:439
+msgctxt "QShortcut"
+msgid "Media Previous"
+msgstr "الوسيط السابق"
+
+#: gui/kernel/qkeysequence.cpp:440
+msgctxt "QShortcut"
+msgid "Media Next"
+msgstr "الوسيط التالي"
+
+#: gui/kernel/qkeysequence.cpp:441
+msgctxt "QShortcut"
+msgid "Media Record"
+msgstr "تسجيل الوسيط"
+
+#: gui/kernel/qkeysequence.cpp:443
+msgctxt "QShortcut"
+msgid "Media Pause"
+msgstr ""
+
+#: gui/kernel/qkeysequence.cpp:445
+msgctxt "QShortcut"
+msgid "Toggle Media Play/Pause"
 msgstr ""
 
-#: network/socket/qsocks5socketengine.cpp:715
-#, qt-format
-msgid "Unknown SOCKSv5 proxy error code 0x%1"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:446
+msgctxt "QShortcut"
+msgid "Home Page"
+msgstr "الصفحة الرئيسة"
+
+#: gui/kernel/qkeysequence.cpp:447
+msgctxt "QShortcut"
+msgid "Favorites"
+msgstr "المفضّلات"
+
+#: gui/kernel/qkeysequence.cpp:448
+msgctxt "QShortcut"
+msgid "Search"
+msgstr "البحث"
 
-#: network/socket/qsocks5socketengine.cpp:1409
-msgctxt "QSocks5SocketEngine"
-msgid "Network operation timed out"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:449
+msgctxt "QShortcut"
+msgid "Standby"
+msgstr "وضع الاستعداد"
 
-#: network/socket/qnativesocketengine.cpp:201
-#: network/socket/qsymbiansocketengine.cpp:1354
-msgid "Unable to initialize non-blocking socket"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:450
+msgctxt "QShortcut"
+msgid "Open URL"
+msgstr "افتح URL"
 
-#: network/socket/qnativesocketengine.cpp:204
-#: network/socket/qsymbiansocketengine.cpp:1357
-msgid "Unable to initialize broadcast socket"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:451
+msgctxt "QShortcut"
+msgid "Launch Mail"
+msgstr "أطلق بريد"
 
-#: network/socket/qnativesocketengine.cpp:207
-#: network/socket/qsymbiansocketengine.cpp:1360
-msgid "Attempt to use IPv6 socket on a platform with no IPv6 support"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:452
+msgctxt "QShortcut"
+msgid "Launch Media"
+msgstr "أطلق وسائط"
 
-#: network/socket/qnativesocketengine.cpp:210
-#: network/socket/qsymbiansocketengine.cpp:1363
-msgid "The remote host closed the connection"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:453
+msgctxt "QShortcut"
+msgid "Launch (0)"
+msgstr "أطلق (0)"
 
-#: network/socket/qnativesocketengine.cpp:213
-#: network/socket/qsymbiansocketengine.cpp:1366
-msgid "Network operation timed out"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:454
+msgctxt "QShortcut"
+msgid "Launch (1)"
+msgstr "أطلق (1)"
 
-#: network/socket/qnativesocketengine.cpp:216
-#: network/socket/qsymbiansocketengine.cpp:1369
-msgid "Out of resources"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:455
+msgctxt "QShortcut"
+msgid "Launch (2)"
+msgstr "أطلق (2)"
 
-#: network/socket/qnativesocketengine.cpp:219
-#: network/socket/qsymbiansocketengine.cpp:1372
-msgid "Unsupported socket operation"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:456
+msgctxt "QShortcut"
+msgid "Launch (3)"
+msgstr "أطلق (3)"
 
-#: network/socket/qnativesocketengine.cpp:222
-#: network/socket/qsymbiansocketengine.cpp:1375
-msgid "Protocol type not supported"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:457
+msgctxt "QShortcut"
+msgid "Launch (4)"
+msgstr "أطلق (4)"
 
-#: network/socket/qnativesocketengine.cpp:225
-#: network/socket/qsymbiansocketengine.cpp:1378
-msgid "Invalid socket descriptor"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:458
+msgctxt "QShortcut"
+msgid "Launch (5)"
+msgstr "أطلق (5)"
 
-#: network/socket/qnativesocketengine.cpp:228
-#: network/socket/qsymbiansocketengine.cpp:1381
-msgid "Host unreachable"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:459
+msgctxt "QShortcut"
+msgid "Launch (6)"
+msgstr "أطلق (6)"
 
-#: network/socket/qnativesocketengine.cpp:234
-#: network/socket/qsymbiansocketengine.cpp:1387
-#: 3rdparty/phonon/mmf/utils.cpp:115
-msgid "Permission denied"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:460
+msgctxt "QShortcut"
+msgid "Launch (7)"
+msgstr "أطلق (7)"
 
-#: network/socket/qnativesocketengine.cpp:237
-#: network/socket/qsymbiansocketengine.cpp:1390
-#: network/socket/qabstractsocket.cpp:1117
-msgid "Connection timed out"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:461
+msgctxt "QShortcut"
+msgid "Launch (8)"
+msgstr "أطلق (8)"
 
-#: network/socket/qnativesocketengine.cpp:243
-#: network/socket/qsymbiansocketengine.cpp:1396
-msgid "The bound address is already in use"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:462
+msgctxt "QShortcut"
+msgid "Launch (9)"
+msgstr "أطلق (9)"
 
-#: network/socket/qnativesocketengine.cpp:246
-#: network/socket/qsymbiansocketengine.cpp:1399
-msgid "The address is not available"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:463
+msgctxt "QShortcut"
+msgid "Launch (A)"
+msgstr "أطلق (أ)"
 
-#: network/socket/qnativesocketengine.cpp:249
-#: network/socket/qsymbiansocketengine.cpp:1402
-msgid "The address is protected"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:464
+msgctxt "QShortcut"
+msgid "Launch (B)"
+msgstr "أطلق (ب)"
 
-#: network/socket/qnativesocketengine.cpp:252
-#: network/socket/qsymbiansocketengine.cpp:1405
-msgid "Datagram was too large to send"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:465
+msgctxt "QShortcut"
+msgid "Launch (C)"
+msgstr "أطلق (ج)"
 
-#: network/socket/qnativesocketengine.cpp:255
-#: network/socket/qsymbiansocketengine.cpp:1408
-msgid "Unable to send a message"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:466
+msgctxt "QShortcut"
+msgid "Launch (D)"
+msgstr "أطلق (د)"
 
-#: network/socket/qnativesocketengine.cpp:258
-#: network/socket/qsymbiansocketengine.cpp:1411
-msgid "Unable to receive a message"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:467
+msgctxt "QShortcut"
+msgid "Launch (E)"
+msgstr "أطلق (هـ)"
 
-#: network/socket/qnativesocketengine.cpp:261
-#: network/socket/qsymbiansocketengine.cpp:1414
-msgid "Unable to write"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:468
+msgctxt "QShortcut"
+msgid "Launch (F)"
+msgstr "أطلق (و)"
 
-#: network/socket/qnativesocketengine.cpp:264
-#: network/socket/qsymbiansocketengine.cpp:1417
-msgid "Network error"
+#: gui/kernel/qkeysequence.cpp:469
+msgctxt "QShortcut"
+msgid "Monitor Brightness Up"
 msgstr ""
 
-#: network/socket/qnativesocketengine.cpp:267
-#: network/socket/qsymbiansocketengine.cpp:1420
-msgid "Another socket is already listening on the same port"
+#: gui/kernel/qkeysequence.cpp:470
+msgctxt "QShortcut"
+msgid "Monitor Brightness Down"
 msgstr ""
 
-#: network/socket/qnativesocketengine.cpp:270
-#: network/socket/qsymbiansocketengine.cpp:1423
-msgid "Operation on non-socket"
+#: gui/kernel/qkeysequence.cpp:471
+msgctxt "QShortcut"
+msgid "Keyboard Light On/Off"
 msgstr ""
 
-#: network/socket/qnativesocketengine.cpp:273
-#: network/socket/qsymbiansocketengine.cpp:1426
-msgid "The proxy type is invalid for this operation"
+#: gui/kernel/qkeysequence.cpp:472
+msgctxt "QShortcut"
+msgid "Keyboard Brightness Up"
 msgstr ""
 
-#: network/socket/qtcpserver.cpp:292 network/socket/qtcpserver.cpp:421
-#: network/socket/qabstractsocket.cpp:552
-#: network/socket/qabstractsocket.cpp:1389
-#: network/socket/qabstractsocket.cpp:1614
-msgid "Operation on socket is not supported"
+#: gui/kernel/qkeysequence.cpp:473
+msgctxt "QShortcut"
+msgid "Keyboard Brightness Down"
 msgstr ""
 
-#: network/socket/qudpsocket.cpp:199
-msgid "This platform does not support IPv6"
+#: gui/kernel/qkeysequence.cpp:474
+msgctxt "QShortcut"
+msgid "Power Off"
 msgstr ""
 
-#: network/socket/qsymbiansocketengine.cpp:1429
-msgid "The address is invalid for this operation"
+#: gui/kernel/qkeysequence.cpp:475
+msgctxt "QShortcut"
+msgid "Wake Up"
 msgstr ""
 
-#: network/socket/qsymbiansocketengine.cpp:1432
-msgid "The specified network session is not opened"
+#: gui/kernel/qkeysequence.cpp:476
+msgctxt "QShortcut"
+msgid "Eject"
 msgstr ""
 
-#: network/socket/qabstractsocket.cpp:1833
-msgid "Socket operation timed out"
+#: gui/kernel/qkeysequence.cpp:477
+msgctxt "QShortcut"
+msgid "Screensaver"
 msgstr ""
 
-#: network/socket/qabstractsocket.cpp:2270
-msgid "Socket is not connected"
+#: gui/kernel/qkeysequence.cpp:478
+msgctxt "QShortcut"
+msgid "WWW"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:885
-#: scripttools/debugging/qscriptdebugger.cpp:1898
-msgid "Go to Line"
+#: gui/kernel/qkeysequence.cpp:479
+msgctxt "QShortcut"
+msgid "Sleep"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:886
-msgid "Line:"
+#: gui/kernel/qkeysequence.cpp:480
+msgctxt "QShortcut"
+msgid "LightBulb"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1677
-msgid "Interrupt"
+#: gui/kernel/qkeysequence.cpp:481
+msgctxt "QShortcut"
+msgid "Shop"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1679
-msgid "Shift+F5"
+#: gui/kernel/qkeysequence.cpp:482
+msgctxt "QShortcut"
+msgid "History"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1696
-msgid "F5"
+#: gui/kernel/qkeysequence.cpp:483
+msgctxt "QShortcut"
+msgid "Add Favorite"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1711
-msgid "Step Into"
+#: gui/kernel/qkeysequence.cpp:484
+msgctxt "QShortcut"
+msgid "Hot Links"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1713
-msgid "F11"
+#: gui/kernel/qkeysequence.cpp:485
+msgctxt "QShortcut"
+msgid "Adjust Brightness"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1728
-msgid "Step Over"
+#: gui/kernel/qkeysequence.cpp:486
+msgctxt "QShortcut"
+msgid "Finance"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1730
-msgid "F10"
+#: gui/kernel/qkeysequence.cpp:487
+msgctxt "QShortcut"
+msgid "Community"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1745
-msgid "Step Out"
+#: gui/kernel/qkeysequence.cpp:488
+msgctxt "QShortcut"
+msgid "Audio Rewind"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1747
-msgid "Shift+F11"
+#: gui/kernel/qkeysequence.cpp:489
+msgctxt "QShortcut"
+msgid "Back Forward"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1762
-msgid "Run to Cursor"
+#: gui/kernel/qkeysequence.cpp:490
+msgctxt "QShortcut"
+msgid "Application Left"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1764
-msgid "Ctrl+F10"
+#: gui/kernel/qkeysequence.cpp:491
+msgctxt "QShortcut"
+msgid "Application Right"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1780
-msgid "Run to New Script"
+#: gui/kernel/qkeysequence.cpp:492
+msgctxt "QShortcut"
+msgid "Book"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1795
-#: scripttools/debugging/qscriptedit.cpp:411
-msgid "Toggle Breakpoint"
+#: gui/kernel/qkeysequence.cpp:493
+msgctxt "QShortcut"
+msgid "CD"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1796
-msgid "F9"
+#: gui/kernel/qkeysequence.cpp:494
+msgctxt "QShortcut"
+msgid "Calculator"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1810
-msgid "Clear Debug Output"
+#: gui/kernel/qkeysequence.cpp:495
+msgctxt "QShortcut"
+msgid "Clear"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1823
-msgid "Clear Error Log"
+#: gui/kernel/qkeysequence.cpp:496
+msgctxt "QShortcut"
+msgid "Clear Grab"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1836
-msgid "Clear Console"
+#: gui/kernel/qkeysequence.cpp:497
+msgctxt "QShortcut"
+msgid "Close"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1850
-msgid "&Find in Script..."
+#: gui/kernel/qkeysequence.cpp:498
+msgctxt "QShortcut"
+msgid "Copy"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1851
-msgid "Ctrl+F"
+#: gui/kernel/qkeysequence.cpp:499
+msgctxt "QShortcut"
+msgid "Cut"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1868
-msgid "Find &Next"
+#: gui/kernel/qkeysequence.cpp:500
+msgctxt "QShortcut"
+msgid "Display"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1870
-msgid "F3"
+#: gui/kernel/qkeysequence.cpp:501
+msgctxt "QShortcut"
+msgid "DOS"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1883
-msgid "Find &Previous"
+#: gui/kernel/qkeysequence.cpp:502
+msgctxt "QShortcut"
+msgid "Documents"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1885
-msgid "Shift+F3"
+#: gui/kernel/qkeysequence.cpp:503
+msgctxt "QShortcut"
+msgid "Spreadsheet"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1899
-msgid "Ctrl+G"
+#: gui/kernel/qkeysequence.cpp:504
+msgctxt "QShortcut"
+msgid "Browser"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebugger.cpp:1910
-msgid "Debug"
+#: gui/kernel/qkeysequence.cpp:505
+msgctxt "QShortcut"
+msgid "Game"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebuggerlocalsmodel.cpp:897
-msgctxt "QScriptDebuggerLocalsModel"
-msgid "Name"
+#: gui/kernel/qkeysequence.cpp:506
+msgctxt "QShortcut"
+msgid "Go"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebuggerlocalsmodel.cpp:899
-msgctxt "QScriptDebuggerLocalsModel"
-msgid "Value"
+#: gui/kernel/qkeysequence.cpp:507
+msgctxt "QShortcut"
+msgid "iTouch"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebuggerstackmodel.cpp:161
-msgctxt "QScriptDebuggerStackModel"
-msgid "Level"
+#: gui/kernel/qkeysequence.cpp:508
+msgctxt "QShortcut"
+msgid "Logoff"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebuggerstackmodel.cpp:163
-msgctxt "QScriptDebuggerStackModel"
-msgid "Name"
+#: gui/kernel/qkeysequence.cpp:509
+msgctxt "QShortcut"
+msgid "Market"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebuggerstackmodel.cpp:165
-msgctxt "QScriptDebuggerStackModel"
-msgid "Location"
+#: gui/kernel/qkeysequence.cpp:510
+msgctxt "QShortcut"
+msgid "Meeting"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebuggercodefinderwidget.cpp:154
-msgid "Previous"
+#: gui/kernel/qkeysequence.cpp:511
+msgctxt "QShortcut"
+msgid "Keyboard Menu"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebuggercodefinderwidget.cpp:161
-msgid "Next"
+#: gui/kernel/qkeysequence.cpp:512
+msgctxt "QShortcut"
+msgid "Menu PB"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebuggercodefinderwidget.cpp:166
-msgid "Case Sensitive"
+#: gui/kernel/qkeysequence.cpp:513
+msgctxt "QShortcut"
+msgid "My Sites"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebuggercodefinderwidget.cpp:169
-msgid "Whole words"
+#: gui/kernel/qkeysequence.cpp:514
+msgctxt "QShortcut"
+msgid "News"
 msgstr ""
 
-#: scripttools/debugging/qscriptdebuggercodefinderwidget.cpp:178
-msgid ""
-"<img src=\":/qt/scripttools/debugging/images/wrap.png\">&nbsp;Search wrapped"
+#: gui/kernel/qkeysequence.cpp:515
+msgctxt "QShortcut"
+msgid "Home Office"
 msgstr ""
 
-#: scripttools/debugging/qscriptedit.cpp:413
-msgid "Disable Breakpoint"
+#: gui/kernel/qkeysequence.cpp:516
+msgctxt "QShortcut"
+msgid "Option"
 msgstr ""
 
-#: scripttools/debugging/qscriptedit.cpp:414
-msgid "Enable Breakpoint"
+#: gui/kernel/qkeysequence.cpp:517
+msgctxt "QShortcut"
+msgid "Paste"
 msgstr ""
 
-#: scripttools/debugging/qscriptedit.cpp:418
-msgid "Breakpoint Condition:"
+#: gui/kernel/qkeysequence.cpp:518
+msgctxt "QShortcut"
+msgid "Phone"
 msgstr ""
 
-#: scripttools/debugging/qscriptbreakpointswidget.cpp:298
-msgid "New"
+#: gui/kernel/qkeysequence.cpp:519
+msgctxt "QShortcut"
+msgid "Reply"
 msgstr ""
 
-#: scripttools/debugging/qscriptenginedebugger.cpp:523
-msgid "Loaded Scripts"
+#: gui/kernel/qkeysequence.cpp:520
+msgctxt "QShortcut"
+msgid "Reload"
 msgstr ""
 
-#: scripttools/debugging/qscriptenginedebugger.cpp:529
-msgid "Breakpoints"
+#: gui/kernel/qkeysequence.cpp:521
+msgctxt "QShortcut"
+msgid "Rotate Windows"
 msgstr ""
 
-#: scripttools/debugging/qscriptenginedebugger.cpp:535
-msgid "Stack"
+#: gui/kernel/qkeysequence.cpp:522
+msgctxt "QShortcut"
+msgid "Rotation PB"
 msgstr ""
 
-#: scripttools/debugging/qscriptenginedebugger.cpp:541
-msgid "Locals"
+#: gui/kernel/qkeysequence.cpp:523
+msgctxt "QShortcut"
+msgid "Rotation KB"
 msgstr ""
 
-#: scripttools/debugging/qscriptenginedebugger.cpp:547
-msgid "Console"
+#: gui/kernel/qkeysequence.cpp:524
+msgctxt "QShortcut"
+msgid "Save"
 msgstr ""
 
-#: scripttools/debugging/qscriptenginedebugger.cpp:553
-msgid "Debug Output"
+#: gui/kernel/qkeysequence.cpp:525
+msgctxt "QShortcut"
+msgid "Send"
 msgstr ""
 
-#: scripttools/debugging/qscriptenginedebugger.cpp:559
-msgid "Error Log"
+#: gui/kernel/qkeysequence.cpp:526
+msgctxt "QShortcut"
+msgid "Spellchecker"
 msgstr ""
 
-#: scripttools/debugging/qscriptenginedebugger.cpp:571
-msgid "Search"
+#: gui/kernel/qkeysequence.cpp:527
+msgctxt "QShortcut"
+msgid "Split Screen"
 msgstr ""
 
-#: scripttools/debugging/qscriptenginedebugger.cpp:578
-msgid "View"
+#: gui/kernel/qkeysequence.cpp:528
+msgctxt "QShortcut"
+msgid "Support"
 msgstr ""
 
-#: scripttools/debugging/qscriptenginedebugger.cpp:596
-msgid "Qt Script Debugger"
+#: gui/kernel/qkeysequence.cpp:529
+msgctxt "QShortcut"
+msgid "Task Panel"
 msgstr ""
 
-#: scripttools/debugging/qscriptbreakpointsmodel.cpp:455
-msgctxt "QScriptBreakpointsModel"
-msgid "ID"
+#: gui/kernel/qkeysequence.cpp:530
+msgctxt "QShortcut"
+msgid "Terminal"
 msgstr ""
 
-#: scripttools/debugging/qscriptbreakpointsmodel.cpp:457
-msgctxt "QScriptBreakpointsModel"
-msgid "Location"
+#: gui/kernel/qkeysequence.cpp:531
+msgctxt "QShortcut"
+msgid "Tools"
 msgstr ""
 
-#: scripttools/debugging/qscriptbreakpointsmodel.cpp:459
-msgctxt "QScriptBreakpointsModel"
-msgid "Condition"
+#: gui/kernel/qkeysequence.cpp:532
+msgctxt "QShortcut"
+msgid "Travel"
 msgstr ""
 
-#: scripttools/debugging/qscriptbreakpointsmodel.cpp:461
-msgctxt "QScriptBreakpointsModel"
-msgid "Ignore-count"
+#: gui/kernel/qkeysequence.cpp:533
+msgctxt "QShortcut"
+msgid "Video"
 msgstr ""
 
-#: scripttools/debugging/qscriptbreakpointsmodel.cpp:463
-msgctxt "QScriptBreakpointsModel"
-msgid "Single-shot"
+#: gui/kernel/qkeysequence.cpp:534
+msgctxt "QShortcut"
+msgid "Word Processor"
 msgstr ""
 
-#: scripttools/debugging/qscriptbreakpointsmodel.cpp:465
-msgctxt "QScriptBreakpointsModel"
-msgid "Hit-count"
+#: gui/kernel/qkeysequence.cpp:535
+msgctxt "QShortcut"
+msgid "XFer"
 msgstr ""
 
-#: plugins/imageformats/tga/qtgafile.cpp:136
-msgid "Could not read image data"
+#: gui/kernel/qkeysequence.cpp:536
+msgctxt "QShortcut"
+msgid "Zoom In"
 msgstr ""
 
-#: plugins/imageformats/tga/qtgafile.cpp:141
-msgid "Sequential device (eg socket) for image read not supported"
+#: gui/kernel/qkeysequence.cpp:537
+msgctxt "QShortcut"
+msgid "Zoom Out"
 msgstr ""
 
-#: plugins/imageformats/tga/qtgafile.cpp:146
-msgid "Seek file/device for image read failed"
+#: gui/kernel/qkeysequence.cpp:538
+msgctxt "QShortcut"
+msgid "Away"
 msgstr ""
 
-#: plugins/imageformats/tga/qtgafile.cpp:152
-msgid "Image mHeader read failed"
+#: gui/kernel/qkeysequence.cpp:539
+msgctxt "QShortcut"
+msgid "Messenger"
 msgstr ""
 
-#: plugins/imageformats/tga/qtgafile.cpp:158
-msgid "Image type not supported"
+#: gui/kernel/qkeysequence.cpp:540
+msgctxt "QShortcut"
+msgid "WebCam"
 msgstr ""
 
-#: plugins/imageformats/tga/qtgafile.cpp:165
-msgid "Image dpeth not valid"
+#: gui/kernel/qkeysequence.cpp:541
+msgctxt "QShortcut"
+msgid "Mail Forward"
 msgstr ""
 
-#: plugins/imageformats/tga/qtgafile.cpp:171
-msgid "Could not seek to image read footer"
+#: gui/kernel/qkeysequence.cpp:542
+msgctxt "QShortcut"
+msgid "Pictures"
 msgstr ""
 
-#: plugins/imageformats/tga/qtgafile.cpp:178
-msgid "Could not read footer"
+#: gui/kernel/qkeysequence.cpp:543
+msgctxt "QShortcut"
+msgid "Music"
 msgstr ""
 
-#: plugins/imageformats/tga/qtgafile.cpp:182
-msgid "Image type (non-TrueVision 2.0) not supported"
+#: gui/kernel/qkeysequence.cpp:544
+msgctxt "QShortcut"
+msgid "Battery"
 msgstr ""
 
-#: plugins/imageformats/tga/qtgafile.cpp:186
-msgid "Could not reset to read data"
+#: gui/kernel/qkeysequence.cpp:545
+msgctxt "QShortcut"
+msgid "Bluetooth"
 msgstr ""
 
-#: plugins/bearer/qnetworksession_impl.cpp:254
-#: plugins/bearer/symbian/qnetworksession_impl.cpp:301
-msgid "Unknown session error."
+#: gui/kernel/qkeysequence.cpp:546
+msgctxt "QShortcut"
+msgid "Wireless"
 msgstr ""
 
-#: plugins/bearer/qnetworksession_impl.cpp:256
-#: plugins/bearer/symbian/qnetworksession_impl.cpp:303
-msgid "The session was aborted by the user or system."
+#: gui/kernel/qkeysequence.cpp:547
+msgctxt "QShortcut"
+msgid "Ultra Wide Band"
 msgstr ""
 
-#: plugins/bearer/qnetworksession_impl.cpp:258
-#: plugins/bearer/symbian/qnetworksession_impl.cpp:305
-msgid "The requested operation is not supported by the system."
+#: gui/kernel/qkeysequence.cpp:548
+msgctxt "QShortcut"
+msgid "Audio Forward"
 msgstr ""
 
-#: plugins/bearer/qnetworksession_impl.cpp:260
-#: plugins/bearer/symbian/qnetworksession_impl.cpp:307
-#: plugins/bearer/icd/qnetworksession_impl.cpp:1036
-msgid "The specified configuration cannot be used."
+#: gui/kernel/qkeysequence.cpp:549
+msgctxt "QShortcut"
+msgid "Audio Repeat"
 msgstr ""
 
-#: plugins/bearer/qnetworksession_impl.cpp:262
-#: plugins/bearer/symbian/qnetworksession_impl.cpp:309
-msgid "Roaming was aborted or is not possible."
+#: gui/kernel/qkeysequence.cpp:550
+msgctxt "QShortcut"
+msgid "Audio Random Play"
 msgstr ""
 
-#: plugins/bearer/icd/qnetworksession_impl.cpp:1030
-msgid "Roaming error"
+#: gui/kernel/qkeysequence.cpp:551
+msgctxt "QShortcut"
+msgid "Subtitle"
 msgstr ""
 
-#: plugins/bearer/icd/qnetworksession_impl.cpp:1033
-msgid "Session aborted by user or system"
+#: gui/kernel/qkeysequence.cpp:552
+msgctxt "QShortcut"
+msgid "Audio Cycle Track"
 msgstr ""
 
-#: plugins/bearer/icd/qnetworksession_impl.cpp:1040
-msgid "Unidentified Error"
+#: gui/kernel/qkeysequence.cpp:553
+msgctxt "QShortcut"
+msgid "Time"
 msgstr ""
 
-#: plugins/accessible/compat/q3complexwidgets.cpp:246
-msgid "System"
-msgstr "النظام"
+#: gui/kernel/qkeysequence.cpp:554 gui/kernel/qkeysequence.cpp:576
+msgctxt "QShortcut"
+msgid "Select"
+msgstr "اختر"
 
-#: plugins/accessible/compat/q3complexwidgets.cpp:249
-msgid "Restore up"
+#: gui/kernel/qkeysequence.cpp:555
+msgctxt "QShortcut"
+msgid "View"
 msgstr ""
 
-#: plugins/accessible/compat/q3complexwidgets.cpp:253
-msgid "Restore down"
+#: gui/kernel/qkeysequence.cpp:556
+msgctxt "QShortcut"
+msgid "Top Menu"
 msgstr ""
 
-#: plugins/accessible/compat/q3complexwidgets.cpp:274
-msgid "Contains commands to manipulate the window"
+#: gui/kernel/qkeysequence.cpp:557
+msgctxt "QShortcut"
+msgid "Suspend"
 msgstr ""
 
-#: plugins/accessible/compat/q3complexwidgets.cpp:277
-msgid "Puts a minimized window back to normal"
+#: gui/kernel/qkeysequence.cpp:558
+msgctxt "QShortcut"
+msgid "Hibernate"
 msgstr ""
 
-#: plugins/accessible/compat/q3complexwidgets.cpp:278
-msgid "Moves the window out of the way"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:562
+msgctxt "QShortcut"
+msgid "Print Screen"
+msgstr "اطبع الشاشة"
 
-#: plugins/accessible/compat/q3complexwidgets.cpp:281
-msgid "Puts a maximized window back to normal"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:563
+msgctxt "QShortcut"
+msgid "Page Up"
+msgstr "صفحة أعلى"
 
-#: plugins/accessible/compat/q3complexwidgets.cpp:282
-msgid "Makes the window full screen"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:564
+msgctxt "QShortcut"
+msgid "Page Down"
+msgstr "صفحة للأسفل"
 
-#: plugins/accessible/compat/q3complexwidgets.cpp:284
-msgid "Closes the window"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:565
+msgctxt "QShortcut"
+msgid "Caps Lock"
+msgstr "قفل الأحرف الكبيرة"
 
-#: plugins/accessible/compat/q3complexwidgets.cpp:286
-msgid ""
-"Displays the name of the window and contains controls to manipulate it"
-msgstr ""
+#: gui/kernel/qkeysequence.cpp:566
+msgctxt "QShortcut"
+msgid "Num Lock"
+msgstr "قفل الأرقام"
 
-#: plugins/accessible/widgets/qaccessiblewidgets.cpp:1251
-msgid "Dock"
-msgstr "إرساء"
+#: gui/kernel/qkeysequence.cpp:567
+msgctxt "QShortcut"
+msgid "Number Lock"
+msgstr "قفل الأرقام"
 
-#: plugins/accessible/widgets/qaccessiblewidgets.cpp:1252
-msgid "Float"
-msgstr "عشري"
+#: gui/kernel/qkeysequence.cpp:568
+msgctxt "QShortcut"
+msgid "Scroll Lock"
+msgstr "قفل اللف"
 
-#: plugins/accessible/widgets/qaccessiblemenu.cpp:158
-#: plugins/accessible/widgets/qaccessiblemenu.cpp:383
-#: plugins/accessible/widgets/qaccessiblemenu.cpp:437
-#: plugins/accessible/widgets/complexwidgets.cpp:1781
-#: plugins/accessible/widgets/complexwidgets.cpp:1847
-#: plugins/accessible/widgets/simplewidgets.cpp:117
-#: plugins/accessible/widgets/simplewidgets.cpp:452
-#: plugins/accessible/widgets/simplewidgets.cpp:460
-msgid "Open"
-msgstr "افتح"
+#: gui/kernel/qkeysequence.cpp:569
+msgctxt "QShortcut"
+msgid "Insert"
+msgstr "إدراج"
 
-#: plugins/accessible/widgets/qaccessiblemenu.cpp:160
-#: plugins/accessible/widgets/qaccessiblemenu.cpp:385
-#: plugins/accessible/widgets/qaccessiblemenu.cpp:438
-msgid "Execute"
-msgstr "نفّذ"
+#: gui/kernel/qkeysequence.cpp:570
+msgctxt "QShortcut"
+msgid "Delete"
+msgstr "حذف"
 
-#: plugins/accessible/widgets/rangecontrols.cpp:149
-#: plugins/accessible/widgets/rangecontrols.cpp:412
-msgid "More"
-msgstr "المزيد"
+#: gui/kernel/qkeysequence.cpp:571
+msgctxt "QShortcut"
+msgid "Escape"
+msgstr "إفلات"
+
+#: gui/kernel/qkeysequence.cpp:572
+msgctxt "QShortcut"
+msgid "System Request"
+msgstr "طلب النظام"
+
+#: gui/kernel/qkeysequence.cpp:577
+msgctxt "QShortcut"
+msgid "Yes"
+msgstr "نعم"
+
+#: gui/kernel/qkeysequence.cpp:578
+msgctxt "QShortcut"
+msgid "No"
+msgstr "لا"
+
+#: gui/kernel/qkeysequence.cpp:582
+msgctxt "QShortcut"
+msgid "Context1"
+msgstr "سياق1"
+
+#: gui/kernel/qkeysequence.cpp:583
+msgctxt "QShortcut"
+msgid "Context2"
+msgstr "سياق2"
+
+#: gui/kernel/qkeysequence.cpp:584
+msgctxt "QShortcut"
+msgid "Context3"
+msgstr "سياق3"
+
+#: gui/kernel/qkeysequence.cpp:585
+msgctxt "QShortcut"
+msgid "Context4"
+msgstr "سياق4"
+
+#: gui/kernel/qkeysequence.cpp:587
+msgctxt "QShortcut"
+msgid "Call"
+msgstr "نداء"
 
-#: plugins/accessible/widgets/rangecontrols.cpp:151
-#: plugins/accessible/widgets/rangecontrols.cpp:414
-msgid "Less"
-msgstr "أقل"
+#: gui/kernel/qkeysequence.cpp:589
+msgctxt "QShortcut"
+msgid "Hangup"
+msgstr "إغلاق الخط"
 
-#: plugins/accessible/widgets/rangecontrols.cpp:555
-#: plugins/accessible/widgets/rangecontrols.cpp:708
-msgid "Position"
-msgstr "الموضع"
+#: gui/kernel/qkeysequence.cpp:591
+msgctxt "QShortcut"
+msgid "Toggle Call/Hangup"
+msgstr ""
 
-#: plugins/accessible/widgets/rangecontrols.cpp:559
-msgid "Line down"
-msgstr "خط أسفل"
+#: gui/kernel/qkeysequence.cpp:592
+msgctxt "QShortcut"
+msgid "Flip"
+msgstr "قلب"
 
-#: plugins/accessible/widgets/rangecontrols.cpp:933
-msgid "QDial"
-msgstr "QDial"
+#: gui/kernel/qkeysequence.cpp:594
+msgctxt "QShortcut"
+msgid "Voice Dial"
+msgstr ""
 
-#: plugins/accessible/widgets/rangecontrols.cpp:935
-msgid "SpeedoMeter"
-msgstr "SpeedoMeter"
+#: gui/kernel/qkeysequence.cpp:596
+msgctxt "QShortcut"
+msgid "Last Number Redial"
+msgstr ""
 
-#: plugins/accessible/widgets/rangecontrols.cpp:937
-msgid "SliderHandle"
-msgstr "SliderHandle"
+#: gui/kernel/qkeysequence.cpp:598
+msgctxt "QShortcut"
+msgid "Camera Shutter"
+msgstr ""
 
-#: plugins/accessible/widgets/complexwidgets.cpp:1515
-msgid "Scroll Left"
-msgstr "اللف اليساري"
+#: gui/kernel/qkeysequence.cpp:600
+msgctxt "QShortcut"
+msgid "Camera Focus"
+msgstr ""
 
-#: plugins/accessible/widgets/complexwidgets.cpp:1515
-msgid "Scroll Right"
-msgstr "اللف اليميني"
+#: gui/kernel/qkeysequence.cpp:604
+msgctxt "QShortcut"
+msgid "Kanji"
+msgstr ""
 
-#: plugins/accessible/widgets/simplewidgets.cpp:121
-#: plugins/accessible/widgets/simplewidgets.cpp:266
-msgid "Uncheck"
-msgstr "أزل الاختيار"
+#: gui/kernel/qkeysequence.cpp:605
+msgctxt "QShortcut"
+msgid "Muhenkan"
+msgstr ""
 
-#: plugins/accessible/widgets/simplewidgets.cpp:124
-#: plugins/accessible/widgets/simplewidgets.cpp:129
-#: plugins/accessible/widgets/simplewidgets.cpp:268
-msgid "Check"
-msgstr "اختر"
+#: gui/kernel/qkeysequence.cpp:606
+msgctxt "QShortcut"
+msgid "Henkan"
+msgstr ""
 
-#: plugins/accessible/widgets/simplewidgets.cpp:125
-msgid "Toggle"
-msgstr "بدل"
+#: gui/kernel/qkeysequence.cpp:607
+msgctxt "QShortcut"
+msgid "Romaji"
+msgstr ""
 
-#: plugins/accessible/widgets/simplewidgets.cpp:271
-#: plugins/accessible/widgets/simplewidgets.cpp:450
-#: plugins/accessible/widgets/simplewidgets.cpp:456
-msgid "Press"
-msgstr "اضغط"
+#: gui/kernel/qkeysequence.cpp:608
+msgctxt "QShortcut"
+msgid "Hiragana"
+msgstr ""
 
-#: plugins/inputmethods/imsw-multi/qmultiinputcontext.cpp:88
-msgid "Select IM"
+#: gui/kernel/qkeysequence.cpp:609
+msgctxt "QShortcut"
+msgid "Katakana"
 msgstr ""
 
-#: plugins/inputmethods/imsw-multi/qmultiinputcontextplugin.cpp:95
-msgid "Multiple input method switcher"
+#: gui/kernel/qkeysequence.cpp:610
+msgctxt "QShortcut"
+msgid "Hiragana Katakana"
 msgstr ""
 
-#: plugins/inputmethods/imsw-multi/qmultiinputcontextplugin.cpp:102
-msgid ""
-"Multiple input method switcher that uses the context menu of the text widgets"
+#: gui/kernel/qkeysequence.cpp:611
+msgctxt "QShortcut"
+msgid "Zenkaku"
 msgstr ""
 
-#: plugins/qmltooling/qmldbg_inspector/editor/zoomtool.cpp:63
-msgid "Zoom to &100%"
+#: gui/kernel/qkeysequence.cpp:612
+msgctxt "QShortcut"
+msgid "Hankaku"
 msgstr ""
 
-#: plugins/qmltooling/qmldbg_inspector/editor/zoomtool.cpp:64
-msgid "Zoom In"
+#: gui/kernel/qkeysequence.cpp:613
+msgctxt "QShortcut"
+msgid "Zenkaku Hankaku"
 msgstr ""
 
-#: plugins/qmltooling/qmldbg_inspector/editor/zoomtool.cpp:65
-msgid "Zoom Out"
+#: gui/kernel/qkeysequence.cpp:614
+msgctxt "QShortcut"
+msgid "Touroku"
 msgstr ""
 
-#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:65
-msgid "Inspector Mode"
+#: gui/kernel/qkeysequence.cpp:615
+msgctxt "QShortcut"
+msgid "Massyo"
 msgstr ""
 
-#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:66
-msgid "Play/Pause Animations"
+#: gui/kernel/qkeysequence.cpp:616
+msgctxt "QShortcut"
+msgid "Kana Lock"
 msgstr ""
 
-#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:69
-msgid "Select (Marquee)"
+#: gui/kernel/qkeysequence.cpp:617
+msgctxt "QShortcut"
+msgid "Kana Shift"
 msgstr ""
 
-#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:70
-msgid "Zoom"
+#: gui/kernel/qkeysequence.cpp:618
+msgctxt "QShortcut"
+msgid "Eisu Shift"
 msgstr ""
 
-#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:72
-msgid "Color Picker"
+#: gui/kernel/qkeysequence.cpp:619
+msgctxt "QShortcut"
+msgid "Eisu toggle"
 msgstr ""
 
-#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:74
-msgid "Apply Changes to QML Viewer"
+#: gui/kernel/qkeysequence.cpp:620
+msgctxt "QShortcut"
+msgid "Code input"
 msgstr ""
 
-#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:76
-msgid "Apply Changes to Document"
+#: gui/kernel/qkeysequence.cpp:621
+msgctxt "QShortcut"
+msgid "Multiple Candidate"
 msgstr ""
 
-#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:86
-msgid "Tools"
+#: gui/kernel/qkeysequence.cpp:622
+msgctxt "QShortcut"
+msgid "Previous Candidate"
 msgstr ""
 
-#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:112
-msgid "1x"
+#: gui/kernel/qkeysequence.cpp:626
+msgctxt "QShortcut"
+msgid "Hangul"
 msgstr ""
 
-#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:118
-msgid "0.5x"
+#: gui/kernel/qkeysequence.cpp:627
+msgctxt "QShortcut"
+msgid "Hangul Start"
 msgstr ""
 
-#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:123
-msgid "0.25x"
+#: gui/kernel/qkeysequence.cpp:628
+msgctxt "QShortcut"
+msgid "Hangul End"
 msgstr ""
 
-#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:128
-msgid "0.125x"
+#: gui/kernel/qkeysequence.cpp:629
+msgctxt "QShortcut"
+msgid "Hangul Hanja"
 msgstr ""
 
-#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:133
-msgid "0.1x"
+#: gui/kernel/qkeysequence.cpp:630
+msgctxt "QShortcut"
+msgid "Hangul Jamo"
 msgstr ""
 
-#: plugins/qmltooling/qmldbg_inspector/editor/toolbarcolorbox.cpp:65
-msgid "Copy Color"
+#: gui/kernel/qkeysequence.cpp:631
+msgctxt "QShortcut"
+msgid "Hangul Romaja"
 msgstr ""
 
-#: plugins/qmltooling/qmldbg_inspector/editor/liveselectiontool.cpp:143
-msgid "Items"
+#: gui/kernel/qkeysequence.cpp:632
+msgctxt "QShortcut"
+msgid "Hangul Jeonja"
 msgstr ""
 
-#: sql/drivers/mysql/qsql_mysql.cpp:506 sql/drivers/mysql/qsql_mysql.cpp:537
-msgctxt "QMYSQLResult"
-msgid "Unable to fetch data"
+#: gui/kernel/qkeysequence.cpp:633
+msgctxt "QShortcut"
+msgid "Hangul Banja"
 msgstr ""
 
-#: sql/drivers/mysql/qsql_mysql.cpp:697
-msgctxt "QMYSQLResult"
-msgid "Unable to execute query"
+#: gui/kernel/qkeysequence.cpp:634
+msgctxt "QShortcut"
+msgid "Hangul PreHanja"
 msgstr ""
 
-#: sql/drivers/mysql/qsql_mysql.cpp:703
-msgctxt "QMYSQLResult"
-msgid "Unable to store result"
+#: gui/kernel/qkeysequence.cpp:635
+msgctxt "QShortcut"
+msgid "Hangul PostHanja"
 msgstr ""
 
-#: sql/drivers/mysql/qsql_mysql.cpp:806
-msgctxt "QMYSQLResult"
-msgid "Unable to execute next query"
+#: gui/kernel/qkeysequence.cpp:636
+msgctxt "QShortcut"
+msgid "Hangul Special"
+msgstr ""
+
+#: gui/kernel/qkeysequence.cpp:1237 gui/kernel/qkeysequence.cpp:1372
+msgid "Ctrl"
+msgstr "Ctrl"
+
+#: gui/kernel/qkeysequence.cpp:1238 gui/kernel/qkeysequence.cpp:1376
+msgid "Shift"
+msgstr "Shift"
+
+#: gui/kernel/qkeysequence.cpp:1239 gui/kernel/qkeysequence.cpp:1374
+msgid "Alt"
+msgstr "Alt"
+
+#: gui/kernel/qkeysequence.cpp:1240 gui/kernel/qkeysequence.cpp:1370
+msgid "Meta"
+msgstr "Meta"
+
+#: gui/kernel/qkeysequence.cpp:1330
+msgid "+"
+msgstr "+"
+
+#: gui/kernel/qkeysequence.cpp:1391
+#, qt-format
+msgid "F%1"
+msgstr "F%1"
+
+#: gui/kernel/qwidget.cpp:6049
+msgid "*"
+msgstr "*"
+
+#: xmlpatterns/expr/qprocessinginstructionconstructor.cpp:84
+#, qt-format
+msgid "The data of a processing instruction cannot contain the string %1"
 msgstr ""
 
-#: sql/drivers/mysql/qsql_mysql.cpp:816
-msgctxt "QMYSQLResult"
-msgid "Unable to store next result"
+#: xmlpatterns/expr/qcommentconstructor.cpp:67
+#, qt-format
+msgid "A comment cannot contain %1"
 msgstr ""
 
-#: sql/drivers/mysql/qsql_mysql.cpp:894 sql/drivers/mysql/qsql_mysql.cpp:903
-msgctxt "QMYSQLResult"
-msgid "Unable to prepare statement"
+#: xmlpatterns/expr/qcommentconstructor.cpp:73
+#, qt-format
+msgid "A comment cannot end with a %1."
 msgstr ""
 
-#: sql/drivers/mysql/qsql_mysql.cpp:940
-msgctxt "QMYSQLResult"
-msgid "Unable to reset statement"
+#: xmlpatterns/expr/qcomputednamespaceconstructor.cpp:69
+msgid ""
+"In a namespace constructor, the value for a namespace cannot be an empty "
+"string."
 msgstr ""
 
-#: sql/drivers/mysql/qsql_mysql.cpp:1026
-msgctxt "QMYSQLResult"
-msgid "Unable to bind value"
+#: xmlpatterns/expr/qcomputednamespaceconstructor.cpp:80
+#, qt-format
+msgid "The prefix must be a valid %1, which %2 is not."
 msgstr ""
 
-#: sql/drivers/mysql/qsql_mysql.cpp:1037
-msgctxt "QMYSQLResult"
-msgid "Unable to execute statement"
+#: xmlpatterns/expr/qcomputednamespaceconstructor.cpp:94
+#, qt-format
+msgid "The prefix %1 cannot be bound."
 msgstr ""
 
-#: sql/drivers/mysql/qsql_mysql.cpp:1051 sql/drivers/mysql/qsql_mysql.cpp:1072
-msgctxt "QMYSQLResult"
-msgid "Unable to bind outvalues"
+#: xmlpatterns/expr/qcomputednamespaceconstructor.cpp:104
+#, qt-format
+msgid "Only the prefix %1 can be bound to %2 and vice versa."
 msgstr ""
 
-#: sql/drivers/mysql/qsql_mysql.cpp:1060
-msgctxt "QMYSQLResult"
-msgid "Unable to store statement results"
+#: xmlpatterns/expr/qarithmeticexpression.cpp:208
+#, qt-format
+msgid "Operator %1 cannot be used on type %2."
 msgstr ""
 
-#: sql/drivers/mysql/qsql_mysql.cpp:1287
-msgid "Unable to open database '"
+#: xmlpatterns/expr/qarithmeticexpression.cpp:224
+#, qt-format
+msgid "Operator %1 cannot be used on atomic values of type %2 and %3."
 msgstr ""
 
-#: sql/drivers/mysql/qsql_mysql.cpp:1298 sql/drivers/odbc/qsql_odbc.cpp:1879
-#: sql/drivers/psql/qsql_psql.cpp:819 sql/drivers/db2/qsql_db2.cpp:1253
-msgid "Unable to connect"
-msgstr "عاجز عن الاتصال"
-
-#: sql/drivers/mysql/qsql_mysql.cpp:1452
-#: sql/drivers/sqlite/qsql_sqlite.cpp:577
-#: sql/drivers/sqlite2/qsql_sqlite2.cpp:440
-#: sql/drivers/symsql/qsql_symsql.cpp:1041
-msgid "Unable to begin transaction"
+#: xmlpatterns/expr/qcastas.cpp:88
+#, qt-format
+msgid "Type error in cast, expected %1, received %2."
 msgstr ""
 
-#: sql/drivers/mysql/qsql_mysql.cpp:1469
-#: sql/drivers/sqlite/qsql_sqlite.cpp:592 sql/drivers/odbc/qsql_odbc.cpp:2165
-#: sql/drivers/sqlite2/qsql_sqlite2.cpp:457
-#: sql/drivers/symsql/qsql_symsql.cpp:1056 sql/drivers/db2/qsql_db2.cpp:1551
-msgid "Unable to commit transaction"
-msgstr "عاجز عن تسليم العملية"
-
-#: sql/drivers/mysql/qsql_mysql.cpp:1486
-#: sql/drivers/sqlite/qsql_sqlite.cpp:607 sql/drivers/odbc/qsql_odbc.cpp:2182
-#: sql/drivers/sqlite2/qsql_sqlite2.cpp:474
-#: sql/drivers/symsql/qsql_symsql.cpp:1071 sql/drivers/db2/qsql_db2.cpp:1568
-msgid "Unable to rollback transaction"
-msgstr "عاجز عن التراجع عن العملية"
+#: xmlpatterns/expr/qcastas.cpp:117
+#, qt-format
+msgid ""
+"When casting to %1 or types derived from it, the source value must be of the "
+"same type, or it must be a string literal. Type %2 is not allowed."
+msgstr ""
 
-#: sql/drivers/ibase/qsql_ibase.cpp:422
-msgctxt "QIBaseResult"
-msgid "Unable to create BLOB"
-msgstr "عاجز عن إنشاء BLOB"
+#: xmlpatterns/expr/qpath.cpp:109
+msgid ""
+"The last step in a path must contain either nodes or atomic values. It "
+"cannot be a mixture between the two."
+msgstr ""
 
-#: sql/drivers/ibase/qsql_ibase.cpp:428
-msgctxt "QIBaseResult"
-msgid "Unable to write BLOB"
-msgstr "عاجز عن كتابة BLOB"
+#: xmlpatterns/expr/qgenericpredicate.cpp:106
+#, qt-format
+msgid ""
+"A value of type %1 cannot be a predicate. A predicate must have either a "
+"numeric type or an Effective Boolean Value type."
+msgstr ""
 
-#: sql/drivers/ibase/qsql_ibase.cpp:442
-msgctxt "QIBaseResult"
-msgid "Unable to open BLOB"
-msgstr "عاجز عن فتح BLOB"
+#: xmlpatterns/expr/qgenericpredicate.cpp:138
+msgid "A positional predicate must evaluate to a single numeric value."
+msgstr ""
 
-#: sql/drivers/ibase/qsql_ibase.cpp:459
-msgctxt "QIBaseResult"
-msgid "Unable to read BLOB"
-msgstr "عاجز عن قراءة BLOB"
+#: xmlpatterns/expr/qapplytemplate.cpp:119
+msgid "Ambiguous rule match."
+msgstr ""
 
-#: sql/drivers/ibase/qsql_ibase.cpp:583 sql/drivers/ibase/qsql_ibase.cpp:770
-msgctxt "QIBaseResult"
-msgid "Could not find array"
+#: xmlpatterns/expr/qcomparisonplatform.cpp:167
+#, qt-format
+msgid "No comparisons can be done involving the type %1."
 msgstr ""
 
-#: sql/drivers/ibase/qsql_ibase.cpp:615
-msgctxt "QIBaseResult"
-msgid "Could not get array data"
+#: xmlpatterns/expr/qcomparisonplatform.cpp:181
+#, qt-format
+msgid "Operator %1 is not available between atomic values of type %2 and %3."
 msgstr ""
 
-#: sql/drivers/ibase/qsql_ibase.cpp:825
-msgctxt "QIBaseResult"
-msgid "Could not get query info"
+#: xmlpatterns/expr/qqnameconstructor.cpp:82
+#, qt-format
+msgid "No namespace binding exists for the prefix %1"
 msgstr ""
 
-#: sql/drivers/ibase/qsql_ibase.cpp:845
-msgctxt "QIBaseResult"
-msgid "Could not start transaction"
+#: xmlpatterns/expr/qcastingplatform.cpp:136
+#, qt-format
+msgid "No casting is possible with %1 as the target type."
 msgstr ""
 
-#: sql/drivers/ibase/qsql_ibase.cpp:864
-msgctxt "QIBaseResult"
-msgid "Unable to commit transaction"
+#: xmlpatterns/expr/qcastingplatform.cpp:151
+#, qt-format
+msgid "It is not possible to cast from %1 to %2."
 msgstr ""
 
-#: sql/drivers/ibase/qsql_ibase.cpp:906
-msgctxt "QIBaseResult"
-msgid "Could not allocate statement"
+#: xmlpatterns/expr/qcastingplatform.cpp:178
+#, qt-format
+msgid ""
+"Casting to %1 is not possible because it is an abstract type, and can "
+"therefore never be instantiated."
 msgstr ""
 
-#: sql/drivers/ibase/qsql_ibase.cpp:911
-msgctxt "QIBaseResult"
-msgid "Could not prepare statement"
+#: xmlpatterns/expr/qcastingplatform.cpp:201
+#, qt-format
+msgid "It's not possible to cast the value %1 of type %2 to %3"
 msgstr ""
 
-#: sql/drivers/ibase/qsql_ibase.cpp:917 sql/drivers/ibase/qsql_ibase.cpp:928
-msgctxt "QIBaseResult"
-msgid "Could not describe input statement"
+#: xmlpatterns/expr/qcastingplatform.cpp:209
+#, qt-format
+msgid "Failure when casting from %1 to %2: %3"
 msgstr ""
 
-#: sql/drivers/ibase/qsql_ibase.cpp:941
-msgctxt "QIBaseResult"
-msgid "Could not describe statement"
+#: xmlpatterns/expr/qattributenamevalidator.cpp:66
+#, qt-format
+msgid "The namespace URI in the name for a computed attribute cannot be %1."
 msgstr ""
 
-#: sql/drivers/ibase/qsql_ibase.cpp:1056
-msgctxt "QIBaseResult"
-msgid "Unable to close statement"
+#: xmlpatterns/expr/qattributenamevalidator.cpp:75
+#, qt-format
+msgid ""
+"The name for a computed attribute cannot have the namespace URI %1 with the "
+"local name %2."
 msgstr ""
 
-#: sql/drivers/ibase/qsql_ibase.cpp:1064
-msgctxt "QIBaseResult"
-msgid "Unable to execute query"
+#: xmlpatterns/expr/qdocumentcontentvalidator.cpp:86
+#, qt-format
+msgid ""
+"An attribute node cannot be a child of a document node. Therefore, the "
+"attribute %1 is out of place."
 msgstr ""
 
-#: sql/drivers/ibase/qsql_ibase.cpp:1110
-msgctxt "QIBaseResult"
-msgid "Could not fetch next item"
+#: xmlpatterns/expr/qevaluationcache.cpp:116
+msgid "Circularity detected"
 msgstr ""
 
-#: sql/drivers/ibase/qsql_ibase.cpp:1307
-msgctxt "QIBaseResult"
-msgid "Could not get statement info"
+#: xmlpatterns/expr/qtemplate.cpp:74
+#, qt-format
+msgid "The parameter %1 is passed, but no corresponding %2 exists."
 msgstr ""
 
-#: sql/drivers/ibase/qsql_ibase.cpp:1491
-msgctxt "QIBaseDriver"
-msgid "Error opening database"
+#: xmlpatterns/expr/qtemplate.cpp:145
+#, qt-format
+msgid "The parameter %1 is required, but no corresponding %2 is supplied."
 msgstr ""
 
-#: sql/drivers/ibase/qsql_ibase.cpp:1545
-msgctxt "QIBaseDriver"
-msgid "Could not start transaction"
+#: xmlpatterns/expr/qexpressionfactory.cpp:162
+msgid ""
+"A library module cannot be evaluated directly. It must be imported from a "
+"main module."
 msgstr ""
 
-#: sql/drivers/ibase/qsql_ibase.cpp:1558
-msgctxt "QIBaseDriver"
-msgid "Unable to commit transaction"
+#: xmlpatterns/expr/qexpressionfactory.cpp:202
+#, qt-format
+msgid "No template by name %1 exists."
 msgstr ""
 
-#: sql/drivers/ibase/qsql_ibase.cpp:1571
-msgctxt "QIBaseDriver"
-msgid "Unable to rollback transaction"
+#: xmlpatterns/parser/qxslttokenizer.cpp:519
+#, qt-format
+msgid "Element %1 is not allowed at this location."
 msgstr ""
 
-#: sql/drivers/sqlite/qsql_sqlite.cpp:204
-#: sql/drivers/sqlite/qsql_sqlite.cpp:268
-#: sql/drivers/sqlite/qsql_sqlite.cpp:276
-msgctxt "QSQLiteResult"
-msgid "Unable to fetch row"
+#: xmlpatterns/parser/qxslttokenizer.cpp:528
+msgid "Text nodes are not allowed at this location."
 msgstr ""
 
-#: sql/drivers/sqlite/qsql_sqlite.cpp:205
-msgctxt "QSQLiteResult"
-msgid "No query"
+#: xmlpatterns/parser/qxslttokenizer.cpp:548
+#, qt-format
+msgid "Parse error: %1"
 msgstr ""
 
-#: sql/drivers/sqlite/qsql_sqlite.cpp:337
-msgctxt "QSQLiteResult"
-msgid "Unable to execute statement"
+#: xmlpatterns/parser/qxslttokenizer.cpp:610
+#, qt-format
+msgid ""
+"The value of the XSL-T version attribute must be a value of type %1, which "
+"%2 isn't."
 msgstr ""
 
-#: sql/drivers/sqlite/qsql_sqlite.cpp:342
-msgctxt "QSQLiteResult"
-msgid "Unable to execute multiple statements at a time"
+#: xmlpatterns/parser/qxslttokenizer.cpp:630
+msgid "Running an XSL-T 1.0 stylesheet with a 2.0 processor."
 msgstr ""
 
-#: sql/drivers/sqlite/qsql_sqlite.cpp:362
-msgctxt "QSQLiteResult"
-msgid "Unable to reset statement"
+#: xmlpatterns/parser/qxslttokenizer.cpp:738
+#, qt-format
+msgid "Unknown XSL-T attribute %1."
 msgstr ""
 
-#: sql/drivers/sqlite/qsql_sqlite.cpp:407
-msgctxt "QSQLiteResult"
-msgid "Unable to bind parameters"
+#: xmlpatterns/parser/qxslttokenizer.cpp:761
+#, qt-format
+msgid "Attribute %1 and %2 are mutually exclusive."
 msgstr ""
 
-#: sql/drivers/sqlite/qsql_sqlite.cpp:414
-msgctxt "QSQLiteResult"
-msgid "Parameter count mismatch"
+#: xmlpatterns/parser/qxslttokenizer.cpp:927
+#, qt-format
+msgid "In a simplified stylesheet module, attribute %1 must be present."
 msgstr ""
 
-#: sql/drivers/sqlite/qsql_sqlite.cpp:546
-#: sql/drivers/sqlite2/qsql_sqlite2.cpp:399
-#: sql/drivers/symsql/qsql_symsql.cpp:985
-#: sql/drivers/symsql/qsql_symsql.cpp:1002
-msgid "Error opening database"
+#: xmlpatterns/parser/qxslttokenizer.cpp:999
+#, qt-format
+msgid "If element %1 has no attribute %2, it cannot have attribute %3 or %4."
 msgstr ""
 
-#: sql/drivers/sqlite/qsql_sqlite.cpp:557
-msgid "Error closing database"
+#: xmlpatterns/parser/qxslttokenizer.cpp:1008
+#, qt-format
+msgid "Element %1 must have at least one of the attributes %2 or %3."
 msgstr ""
 
-#: sql/drivers/odbc/qsql_odbc.cpp:945 sql/drivers/odbc/qsql_odbc.cpp:1296
-msgctxt "QODBCResult"
+#: xmlpatterns/parser/qxslttokenizer.cpp:1036
+#, qt-format
 msgid ""
-"QODBCResult::reset: Unable to set 'SQL_CURSOR_STATIC' as statement "
-"attribute. Please check your ODBC driver configuration"
+"At least one mode must be specified in the %1-attribute on element %2."
 msgstr ""
 
-#: sql/drivers/odbc/qsql_odbc.cpp:962 sql/drivers/odbc/qsql_odbc.cpp:1589
-msgctxt "QODBCResult"
-msgid "Unable to execute statement"
-msgstr "عاجز عن تنفيذ الجملة"
-
-#: sql/drivers/odbc/qsql_odbc.cpp:1021
-msgctxt "QODBCResult"
-msgid "Unable to fetch"
-msgstr "عاجز عن الجلب"
-
-#: sql/drivers/odbc/qsql_odbc.cpp:1043
-msgctxt "QODBCResult"
-msgid "Unable to fetch next"
-msgstr "عاجز عن جلب التالي"
-
-#: sql/drivers/odbc/qsql_odbc.cpp:1065
-msgctxt "QODBCResult"
-msgid "Unable to fetch first"
-msgstr "عاجز عن جلب الأول"
-
-#: sql/drivers/odbc/qsql_odbc.cpp:1084
-msgctxt "QODBCResult"
-msgid "Unable to fetch previous"
-msgstr "عاجز عن جلب السابق"
-
-#: sql/drivers/odbc/qsql_odbc.cpp:1115 sql/drivers/odbc/qsql_odbc.cpp:1693
-#: sql/drivers/db2/qsql_db2.cpp:1102
-msgctxt "QODBCResult"
-msgid "Unable to fetch last"
-msgstr "عاجز عن جلب الأخير"
-
-#: sql/drivers/odbc/qsql_odbc.cpp:1314
-msgctxt "QODBCResult"
-msgid "Unable to prepare statement"
-msgstr "عاجز عن تحضير الجملة"
-
-#: sql/drivers/odbc/qsql_odbc.cpp:1581
-msgctxt "QODBCResult"
-msgid "Unable to bind variable"
-msgstr "عاجز عن ربط متغير"
+#: xmlpatterns/parser/qxslttokenizer.cpp:1159
+#, qt-format
+msgid "Element %1 must come last."
+msgstr ""
 
-#: sql/drivers/odbc/qsql_odbc.cpp:1885
-msgid "Unable to connect - Driver doesn't support all functionality required"
+#: xmlpatterns/parser/qxslttokenizer.cpp:1183
+#, qt-format
+msgid "At least one %1-element must occur before %2."
 msgstr ""
 
-#: sql/drivers/odbc/qsql_odbc.cpp:2148
-msgid "Unable to disable autocommit"
-msgstr "عاجز عن تعطيل التسليم التلقائي"
+#: xmlpatterns/parser/qxslttokenizer.cpp:1190
+#, qt-format
+msgid "Only one %1-element can appear."
+msgstr ""
 
-#: sql/drivers/odbc/qsql_odbc.cpp:2197
-msgid "Unable to enable autocommit"
-msgstr "عاجز عن تمكين التسليم التلقائي"
+#: xmlpatterns/parser/qxslttokenizer.cpp:1221
+#, qt-format
+msgid "At least one %1-element must occur inside %2."
+msgstr ""
 
-#: sql/drivers/sqlite2/qsql_sqlite2.cpp:149
-msgctxt "QSQLite2Result"
-msgid "Unable to fetch results"
+#: xmlpatterns/parser/qxslttokenizer.cpp:1279
+#, qt-format
+msgid ""
+"When attribute %1 is present on %2, a sequence constructor cannot be used."
 msgstr ""
 
-#: sql/drivers/sqlite2/qsql_sqlite2.cpp:299
-msgctxt "QSQLite2Result"
-msgid "Unable to execute statement"
+#: xmlpatterns/parser/qxslttokenizer.cpp:1292
+#, qt-format
+msgid "Element %1 must have either a %2-attribute or a sequence constructor."
 msgstr ""
 
-#: sql/drivers/psql/qsql_psql.cpp:198
-msgctxt "QPSQLResult"
-msgid "Unable to create query"
-msgstr "عاجز عن إنشاء استعلام"
+#: xmlpatterns/parser/qxslttokenizer.cpp:1417
+#, qt-format
+msgid ""
+"When a parameter is required, a default value cannot be supplied through a "
+"%1-attribute or a sequence constructor."
+msgstr ""
 
-#: sql/drivers/psql/qsql_psql.cpp:570
-msgctxt "QPSQLResult"
-msgid "Unable to prepare statement"
-msgstr "عاجز عن تحضير الجملة"
+#: xmlpatterns/parser/qxslttokenizer.cpp:1687
+#, qt-format
+msgid "Element %1 cannot have children."
+msgstr ""
 
-#: sql/drivers/psql/qsql_psql.cpp:868
-msgid "Could not begin transaction"
-msgstr "لا يمكن بدء العملية"
+#: xmlpatterns/parser/qxslttokenizer.cpp:2121
+#, qt-format
+msgid "Element %1 cannot have a sequence constructor."
+msgstr ""
 
-#: sql/drivers/psql/qsql_psql.cpp:901
-msgid "Could not commit transaction"
-msgstr "لا يمكن تسليم العملية"
+#: xmlpatterns/parser/qxslttokenizer.cpp:2207
+#: xmlpatterns/parser/qxslttokenizer.cpp:2216
+#, qt-format
+msgid "The attribute %1 cannot appear on %2, when it is a child of %3."
+msgstr ""
 
-#: sql/drivers/psql/qsql_psql.cpp:917
-msgid "Could not rollback transaction"
-msgstr "لا يمكن التراجع عن العملية"
+#: xmlpatterns/parser/qxslttokenizer.cpp:2231
+msgid "A parameter in a function cannot be declared to be a tunnel."
+msgstr ""
 
-#: sql/drivers/psql/qsql_psql.cpp:1303
-msgid "Unable to subscribe"
-msgstr "عاجز عن الإشتراك"
+#: xmlpatterns/parser/qxslttokenizer.cpp:2380
+#, qt-format
+msgid "This processor is not Schema-aware and therefore %1 cannot be used."
+msgstr ""
 
-#: sql/drivers/psql/qsql_psql.cpp:1335
-msgid "Unable to unsubscribe"
-msgstr "عاجز عن إلغاء الإشتراك"
+#: xmlpatterns/parser/qxslttokenizer.cpp:2437
+#, qt-format
+msgid ""
+"Top level stylesheet elements must be in a non-null namespace, which %1 "
+"isn't."
+msgstr ""
 
-#: sql/drivers/symsql/qsql_symsql.cpp:220
-msgctxt "QSymSQLResult"
-msgid "Error retrieving column count"
+#: xmlpatterns/parser/qxslttokenizer.cpp:2485
+#, qt-format
+msgid ""
+"The value for attribute %1 on element %2 must either be %3 or %4, not %5."
 msgstr ""
 
-#: sql/drivers/symsql/qsql_symsql.cpp:230
-msgctxt "QSymSQLResult"
-msgid "Error retrieving column name"
+#: xmlpatterns/parser/qxslttokenizer.cpp:2505
+#, qt-format
+msgid "Attribute %1 cannot have the value %2."
 msgstr ""
 
-#: sql/drivers/symsql/qsql_symsql.cpp:243
-msgctxt "QSymSQLResult"
-msgid "Error retrieving column type"
+#: xmlpatterns/parser/qxslttokenizer.cpp:2563
+#, qt-format
+msgid "The attribute %1 can only appear on the first %2 element."
 msgstr ""
 
-#: sql/drivers/symsql/qsql_symsql.cpp:279
-#: sql/drivers/symsql/qsql_symsql.cpp:287
-msgctxt "QSymSQLResult"
-msgid "Unable to fetch row"
+#: xmlpatterns/parser/qxslttokenizer.cpp:2662
+#, qt-format
+msgid "At least one %1 element must appear as child of %2."
 msgstr ""
 
-#: sql/drivers/symsql/qsql_symsql.cpp:331
-msgctxt "QSymSQLResult"
-msgid "Unable to execute statement"
+#: querytransformparser.ypp:202
+msgid "W3C XML Schema identity constraint selector"
 msgstr ""
 
-#: sql/drivers/symsql/qsql_symsql.cpp:345
-msgctxt "QSymSQLResult"
-msgid "Statement is not prepared"
+#: querytransformparser.ypp:205
+msgid "W3C XML Schema identity constraint field"
 msgstr ""
 
-#: sql/drivers/symsql/qsql_symsql.cpp:359
-msgctxt "QSymSQLResult"
-msgid "Unable to reset statement"
+#: querytransformparser.ypp:209
+#, qt-format
+msgid ""
+"A construct was encountered which is disallowed in the current language(%1)."
 msgstr ""
 
-#: sql/drivers/symsql/qsql_symsql.cpp:407
-msgctxt "QSymSQLResult"
-msgid "Unable to bind parameters"
+#: querytransformparser.ypp:259 querytransformparser.ypp:4492
+#, qt-format
+msgid "%1 is an unknown schema type."
 msgstr ""
 
-#: sql/drivers/symsql/qsql_symsql.cpp:414
-msgctxt "QSymSQLResult"
-msgid "Parameter count mismatch"
+#: querytransformparser.ypp:328
+#, qt-format
+msgid "A template with name %1 has already been declared."
 msgstr ""
 
-#: sql/drivers/symsql/qsql_symsql.cpp:975
-#: sql/drivers/symsql/qsql_symsql.cpp:991
-msgid "Invalid option: "
+#: querytransformparser.ypp:354
+#, qt-format
+msgid "%1 is not a valid numeric literal."
 msgstr ""
 
-#: sql/drivers/symsql/qsql_symsql.cpp:1005
-msgid ""
-"POLICY_DB_DEFAULT must be defined before any other POLICY definitions can be "
-"used"
+#: querytransformparser.ypp:541
+#, qt-format
+msgid "Only one %1 declaration can occur in the query prolog."
 msgstr ""
 
-#: sql/drivers/oci/qsql_oci.cpp:1315 sql/drivers/oci/qsql_oci.cpp:1509
-#: sql/drivers/oci/qsql_oci.cpp:1524
-msgctxt "QOCIResult"
-msgid "Unable to bind column for batch execute"
+#: querytransformparser.ypp:729
+#, qt-format
+msgid "The initialization of variable %1 depends on itself"
 msgstr ""
 
-#: sql/drivers/oci/qsql_oci.cpp:1539
-msgctxt "QOCIResult"
-msgid "Unable to execute batch statement"
+#: querytransformparser.ypp:792
+#, qt-format
+msgid "No variable with name %1 exists"
 msgstr ""
 
-#: sql/drivers/oci/qsql_oci.cpp:1858
-msgctxt "QOCIResult"
-msgid "Unable to goto next"
+#: querytransformparser.ypp:1403
+#, qt-format
+msgid "Version %1 is not supported. The supported XQuery version is 1.0."
 msgstr ""
 
-#: sql/drivers/oci/qsql_oci.cpp:1917
-msgctxt "QOCIResult"
-msgid "Unable to alloc statement"
+#: querytransformparser.ypp:1417
+#, qt-format
+msgid ""
+"The encoding %1 is invalid. It must contain Latin characters only, must not "
+"contain whitespace, and must match the regular expression %2."
 msgstr ""
 
-#: sql/drivers/oci/qsql_oci.cpp:1932
-msgctxt "QOCIResult"
-msgid "Unable to prepare statement"
+#: querytransformparser.ypp:1469
+#, qt-format
+msgid "No function with signature %1 is available"
 msgstr ""
 
-#: sql/drivers/oci/qsql_oci.cpp:1958
-msgctxt "QOCIResult"
-msgid "Unable to get statement type"
+#: querytransformparser.ypp:1539 querytransformparser.ypp:1545
+msgid ""
+"A default namespace declaration must occur before function, variable, and "
+"option declarations."
 msgstr ""
 
-#: sql/drivers/oci/qsql_oci.cpp:1977
-msgctxt "QOCIResult"
-msgid "Unable to bind value"
+#: querytransformparser.ypp:1551
+msgid ""
+"Namespace declarations must occur before function, variable, and option "
+"declarations."
 msgstr ""
 
-#: sql/drivers/oci/qsql_oci.cpp:1997
-msgctxt "QOCIResult"
-msgid "Unable to execute statement"
+#: querytransformparser.ypp:1558
+msgid ""
+"Module imports must occur before function, variable, and option declarations."
 msgstr ""
 
-#: sql/drivers/oci/qsql_oci.cpp:2081
-msgctxt "QOCIDriver"
-msgid "Unable to initialize"
+#: querytransformparser.ypp:1659
+#, qt-format
+msgid "The keyword %1 cannot occur with any other mode name."
 msgstr ""
 
-#: sql/drivers/oci/qsql_oci.cpp:2225
-msgid "Unable to logon"
+#: querytransformparser.ypp:1682
+#, qt-format
+msgid "The value of attribute %1 must be of type %2, which %3 isn't."
 msgstr ""
 
-#: sql/drivers/oci/qsql_oci.cpp:2297
-msgctxt "QOCIDriver"
-msgid "Unable to begin transaction"
+#: querytransformparser.ypp:1736
+#, qt-format
+msgid "It is not possible to redeclare prefix %1."
 msgstr ""
 
-#: sql/drivers/oci/qsql_oci.cpp:2316
-msgctxt "QOCIDriver"
-msgid "Unable to commit transaction"
+#: querytransformparser.ypp:1743
+#, qt-format
+msgid ""
+"The prefix %1 cannot be bound. By default, it is already bound to the "
+"namespace %2."
 msgstr ""
 
-#: sql/drivers/oci/qsql_oci.cpp:2335
-msgctxt "QOCIDriver"
-msgid "Unable to rollback transaction"
+#: querytransformparser.ypp:1754
+#, qt-format
+msgid "Prefix %1 is already declared in the prolog."
 msgstr ""
 
-#: sql/drivers/tds/qsql_tds.cpp:595
-msgid "Unable to open connection"
+#: querytransformparser.ypp:1836
+msgid ""
+"The name of an option must have a prefix. There is no default namespace for "
+"options."
 msgstr ""
 
-#: sql/drivers/tds/qsql_tds.cpp:600
-msgid "Unable to use database"
+#: querytransformparser.ypp:1964
+#, qt-format
+msgid ""
+"The Schema Import feature is not supported, and therefore %1 declarations "
+"cannot occur."
 msgstr ""
 
-#: sql/drivers/db2/qsql_db2.cpp:554 sql/drivers/db2/qsql_db2.cpp:794
-msgctxt "QDB2Result"
-msgid "Unable to execute statement"
+#: querytransformparser.ypp:1978
+#, qt-format
+msgid "The target namespace of a %1 cannot be empty."
 msgstr ""
 
-#: sql/drivers/db2/qsql_db2.cpp:591
-msgctxt "QDB2Result"
-msgid "Unable to prepare statement"
+#: querytransformparser.ypp:1986
+msgid "The module import feature is not supported"
 msgstr ""
 
-#: sql/drivers/db2/qsql_db2.cpp:784
-msgctxt "QDB2Result"
-msgid "Unable to bind variable"
+#: querytransformparser.ypp:2006
+#, qt-format
+msgid "A variable with name %1 has already been declared."
 msgstr ""
 
-#: sql/drivers/db2/qsql_db2.cpp:873
+#: querytransformparser.ypp:2045
 #, qt-format
-msgctxt "QDB2Result"
-msgid "Unable to fetch record %1"
+msgid "No value is available for the external variable with name %1."
 msgstr ""
 
-#: sql/drivers/db2/qsql_db2.cpp:892
-msgctxt "QDB2Result"
-msgid "Unable to fetch next"
+#: querytransformparser.ypp:2110
+msgid "A stylesheet function must have a prefixed name."
 msgstr ""
 
-#: sql/drivers/db2/qsql_db2.cpp:912
-msgctxt "QDB2Result"
-msgid "Unable to fetch first"
+#: querytransformparser.ypp:2119
+#, qt-format
+msgid ""
+"The namespace for a user defined function cannot be empty (try the "
+"predefined prefix %1, which exists for cases like this)"
 msgstr ""
 
-#: sql/drivers/db2/qsql_db2.cpp:1583
-msgid "Unable to set autocommit"
+#: querytransformparser.ypp:2129
+#, qt-format
+msgid ""
+"The namespace %1 is reserved; therefore user defined functions may not use "
+"it. Try the predefined prefix %2, which exists for these cases."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:519
+#: querytransformparser.ypp:2141
 #, qt-format
-msgid "Element %1 is not allowed at this location."
+msgid ""
+"The namespace of a user defined function in a library module must be "
+"equivalent to the module namespace. In other words, it should be %1 instead "
+"of %2"
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:528
-msgid "Text nodes are not allowed at this location."
+#: querytransformparser.ypp:2174
+#, qt-format
+msgid "A function already exists with the signature %1."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:548
+#: querytransformparser.ypp:2197
+msgid ""
+"No external functions are supported. All supported functions can be used "
+"directly, without first declaring them as external"
+msgstr ""
+
+#: querytransformparser.ypp:2223
 #, qt-format
-msgid "Parse error: %1"
+msgid ""
+"An argument with name %1 has already been declared. Every argument name must "
+"be unique."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:610
+#: querytransformparser.ypp:2382
 #, qt-format
 msgid ""
-"The value of the XSL-T version attribute must be a value of type %1, which "
-"%2 isn't."
+"When function %1 is used for matching inside a pattern, the argument must be "
+"a variable reference or a string literal."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:630
-msgid "Running an XSL-T 1.0 stylesheet with a 2.0 processor."
+#: querytransformparser.ypp:2393
+#, qt-format
+msgid ""
+"In an XSL-T pattern, the first argument to function %1 must be a string "
+"literal, when used for matching."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:738
+#: querytransformparser.ypp:2407
 #, qt-format
-msgid "Unknown XSL-T attribute %1."
+msgid ""
+"In an XSL-T pattern, the first argument to function %1 must be a literal or "
+"a variable reference, when used for matching."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:761
+#: querytransformparser.ypp:2416
 #, qt-format
-msgid "Attribute %1 and %2 are mutually exclusive."
+msgid "In an XSL-T pattern, function %1 cannot have a third argument."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:927
+#: querytransformparser.ypp:2426
 #, qt-format
-msgid "In a simplified stylesheet module, attribute %1 must be present."
+msgid ""
+"In an XSL-T pattern, only function %1 and %2, not %3, can be used for "
+"matching."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:999
+#: querytransformparser.ypp:2480
 #, qt-format
-msgid "If element %1 has no attribute %2, it cannot have attribute %3 or %4."
+msgid "In an XSL-T pattern, axis %1 cannot be used, only axis %2 or %3 can."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:1008
+#: querytransformparser.ypp:2571
 #, qt-format
-msgid "Element %1 must have at least one of the attributes %2 or %3."
+msgid "%1 is an invalid template mode name."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:1036
+#: querytransformparser.ypp:2608
 #, qt-format
 msgid ""
-"At least one mode must be specified in the %1-attribute on element %2."
+"The name of a variable bound in a for-expression must be different from the "
+"positional variable. Hence, the two variables named %1 collide."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:1159
+#: querytransformparser.ypp:3123
 #, qt-format
-msgid "Element %1 must come last."
+msgid ""
+"The Schema Validation Feature is not supported. Hence, %1-expressions may "
+"not be used."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:1183
+#: querytransformparser.ypp:3148
+msgid ""
+"None of the pragma expressions are supported. Therefore, a fallback "
+"expression must be present"
+msgstr ""
+
+#: querytransformparser.ypp:3340
 #, qt-format
-msgid "At least one %1-element must occur before %2."
+msgid "Each name of a template parameter must be unique; %1 is duplicated."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:1190
+#: querytransformparser.ypp:3443
 #, qt-format
-msgid "Only one %1-element can appear."
+msgid "The %1-axis is unsupported in XQuery"
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:1221
+#: querytransformparser.ypp:3653
 #, qt-format
-msgid "At least one %1-element must occur inside %2."
+msgid "No function with name %1 is available."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:1279
+#: querytransformparser.ypp:3784
 #, qt-format
 msgid ""
-"When attribute %1 is present on %2, a sequence constructor cannot be used."
+"The namespace URI cannot be the empty string when binding to a prefix, %1."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:1292
+#: querytransformparser.ypp:3791
 #, qt-format
-msgid "Element %1 must have either a %2-attribute or a sequence constructor."
+msgid "%1 is an invalid namespace URI."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:1417
+#: querytransformparser.ypp:3797
 #, qt-format
-msgid ""
-"When a parameter is required, a default value cannot be supplied through a "
-"%1-attribute or a sequence constructor."
+msgid "It is not possible to bind to the prefix %1"
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:1687
+#: querytransformparser.ypp:3804
 #, qt-format
-msgid "Element %1 cannot have children."
+msgid ""
+"Namespace %1 can only be bound to %2 (and it is, in either case, pre-"
+"declared)."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:2121
+#: querytransformparser.ypp:3812
 #, qt-format
-msgid "Element %1 cannot have a sequence constructor."
+msgid ""
+"Prefix %1 can only be bound to %2 (and it is, in either case, pre-declared)."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:2207
-#: xmlpatterns/parser/qxslttokenizer.cpp:2216
+#: querytransformparser.ypp:3827
 #, qt-format
-msgid "The attribute %1 cannot appear on %2, when it is a child of %3."
+msgid "Two namespace declaration attributes have the same name: %1."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:2231
-msgid "A parameter in a function cannot be declared to be a tunnel."
+#: querytransformparser.ypp:3914
+msgid ""
+"The namespace URI must be a constant and cannot use enclosed expressions."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:2380
+#: querytransformparser.ypp:3930
 #, qt-format
-msgid "This processor is not Schema-aware and therefore %1 cannot be used."
+msgid "An attribute with name %1 has already appeared on this element."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:2437
+#: querytransformparser.ypp:3984
 #, qt-format
-msgid ""
-"Top level stylesheet elements must be in a non-null namespace, which %1 "
-"isn't."
+msgid "A direct element constructor is not well-formed. %1 is ended with %2."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:2485
+#: querytransformparser.ypp:4310
 #, qt-format
-msgid ""
-"The value for attribute %1 on element %2 must either be %3 or %4, not %5."
+msgid "The name %1 does not refer to any schema type."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:2505
+#: querytransformparser.ypp:4320
 #, qt-format
-msgid "Attribute %1 cannot have the value %2."
+msgid ""
+"%1 is an complex type. Casting to complex types is not possible. However, "
+"casting to atomic types such as %2 works."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:2563
+#: querytransformparser.ypp:4329
 #, qt-format
-msgid "The attribute %1 can only appear on the first %2 element."
+msgid "%1 is not an atomic type. Casting is only possible to atomic types."
 msgstr ""
 
-#: xmlpatterns/parser/qxslttokenizer.cpp:2662
+#: querytransformparser.ypp:4395
 #, qt-format
-msgid "At least one %1 element must appear as child of %2."
+msgid "%1 is not a valid name for a processing-instruction."
 msgstr ""
 
-#: xmlpatterns/parser/qparsercontext.cpp:93
+#: querytransformparser.ypp:4447 querytransformparser.ypp:4503
 #, qt-format
-msgid "The variable %1 is unused"
+msgid ""
+"%1 is not in the in-scope attribute declarations. Note that the schema "
+"import feature is not supported."
+msgstr ""
+
+#: querytransformparser.ypp:4553
+msgid "The name of an extension expression must be in a namespace."
 msgstr ""
 
 #: xmlpatterns/parser/qmaintainingreader.cpp:184
@@ -4867,978 +5021,1053 @@
 msgid "The element with local name %1 does not exist in XSL-T."
 msgstr ""
 
-#: querytransformparser.ypp:202
-msgid "W3C XML Schema identity constraint selector"
+#: xmlpatterns/parser/qparsercontext.cpp:93
+#, qt-format
+msgid "The variable %1 is unused"
 msgstr ""
 
-#: querytransformparser.ypp:205
-msgid "W3C XML Schema identity constraint field"
+#: xmlpatterns/functions/qcontextnodechecker.cpp:54
+#, qt-format
+msgid ""
+"The root node of the second argument to function %1 must be a document node. "
+"%2 is not a document node."
 msgstr ""
 
-#: querytransformparser.ypp:209
+#: xmlpatterns/functions/qsequencegeneratingfns.cpp:282
+msgid "The default collection is undefined"
+msgstr ""
+
+#: xmlpatterns/functions/qsequencegeneratingfns.cpp:295
+#, qt-format
+msgid "%1 cannot be retrieved"
+msgstr ""
+
+#: xmlpatterns/functions/qcomparingaggregator.cpp:197
+#, qt-format
+msgid "The first argument to %1 cannot be of type %2."
+msgstr ""
+
+#: xmlpatterns/functions/qtimezonefns.cpp:87
 #, qt-format
 msgid ""
-"A construct was encountered which is disallowed in the current language(%1)."
+"A zone offset must be in the range %1..%2 inclusive. %3 is out of range."
 msgstr ""
 
-#: querytransformparser.ypp:259 querytransformparser.ypp:4492
+#: xmlpatterns/functions/qtimezonefns.cpp:99
 #, qt-format
-msgid "%1 is an unknown schema type."
+msgid "%1 is not a whole number of minutes."
 msgstr ""
 
-#: querytransformparser.ypp:328
+#: xmlpatterns/functions/qpatternplatform.cpp:92
 #, qt-format
-msgid "A template with name %1 has already been declared."
+msgid "%1 matches newline characters"
 msgstr ""
 
-#: querytransformparser.ypp:354
+#: xmlpatterns/functions/qpatternplatform.cpp:96
 #, qt-format
-msgid "%1 is not a valid numeric literal."
+msgid "%1 and %2 match the start and end of a line."
 msgstr ""
 
-#: querytransformparser.ypp:541
+#: xmlpatterns/functions/qpatternplatform.cpp:102
+msgid "Matches are case insensitive"
+msgstr ""
+
+#: xmlpatterns/functions/qpatternplatform.cpp:106
+msgid ""
+"Whitespace characters are removed, except when they appear in character "
+"classes"
+msgstr ""
+
+#: xmlpatterns/functions/qpatternplatform.cpp:206
 #, qt-format
-msgid "Only one %1 declaration can occur in the query prolog."
+msgid "%1 is an invalid regular expression pattern: %2"
 msgstr ""
 
-#: querytransformparser.ypp:729
+#: xmlpatterns/functions/qpatternplatform.cpp:236
 #, qt-format
-msgid "The initialization of variable %1 depends on itself"
+msgid "%1 is an invalid flag for regular expressions. Valid flags are:"
 msgstr ""
 
-#: querytransformparser.ypp:792
+#: xmlpatterns/functions/qsequencefns.cpp:346
 #, qt-format
-msgid "No variable with name %1 exists"
+msgid "It will not be possible to retrieve %1."
 msgstr ""
 
-#: querytransformparser.ypp:1403
+#: xmlpatterns/functions/qassemblestringfns.cpp:88
 #, qt-format
-msgid "Version %1 is not supported. The supported XQuery version is 1.0."
+msgid "%1 is not a valid XML 1.0 character."
 msgstr ""
 
-#: querytransformparser.ypp:1417
+#: xmlpatterns/functions/qdatetimefn.cpp:86
 #, qt-format
 msgid ""
-"The encoding %1 is invalid. It must contain Latin characters only, must not "
-"contain whitespace, and must match the regular expression %2."
+"If both values have zone offsets, they must have the same zone offset. %1 "
+"and %2 are not the same."
 msgstr ""
 
-#: querytransformparser.ypp:1469
+#: xmlpatterns/functions/qqnamefns.cpp:69
 #, qt-format
-msgid "No function with signature %1 is available"
+msgid "%1 is an invalid %2"
 msgstr ""
 
-#: querytransformparser.ypp:1539 querytransformparser.ypp:1545
+#: xmlpatterns/functions/qqnamefns.cpp:87
+#, qt-format
 msgid ""
-"A default namespace declaration must occur before function, variable, and "
-"option declarations."
+"If the first argument is the empty sequence or a zero-length string (no "
+"namespace), a prefix cannot be specified. Prefix %1 was specified."
 msgstr ""
 
-#: querytransformparser.ypp:1551
-msgid ""
-"Namespace declarations must occur before function, variable, and option "
-"declarations."
+#: xmlpatterns/functions/qunparsedtextfn.cpp:65
+msgid "The URI cannot have a fragment"
 msgstr ""
 
-#: querytransformparser.ypp:1558
+#: xmlpatterns/functions/qstringvaluefns.cpp:252
+#, qt-format
 msgid ""
-"Module imports must occur before function, variable, and option declarations."
+"The normalization form %1 is unsupported. The supported forms are %2, %3, "
+"%4, and %5, and none, i.e. the empty string (no normalization)."
 msgstr ""
 
-#: querytransformparser.ypp:1659
+#: xmlpatterns/functions/qerrorfn.cpp:61
 #, qt-format
-msgid "The keyword %1 cannot occur with any other mode name."
+msgid "%1 was called."
 msgstr ""
 
-#: querytransformparser.ypp:1682
+#: xmlpatterns/functions/qpatternmatchingfns.cpp:94
 #, qt-format
-msgid "The value of attribute %1 must be of type %2, which %3 isn't."
+msgid ""
+"%1 must be followed by %2 or %3, not at the end of the replacement string."
 msgstr ""
 
-#: querytransformparser.ypp:1736
+#: xmlpatterns/functions/qpatternmatchingfns.cpp:133
 #, qt-format
-msgid "It is not possible to redeclare prefix %1."
+msgid ""
+"In the replacement string, %1 must be followed by at least one digit when "
+"not escaped."
 msgstr ""
 
-#: querytransformparser.ypp:1743
+#: xmlpatterns/functions/qpatternmatchingfns.cpp:159
 #, qt-format
 msgid ""
-"The prefix %1 cannot be bound. By default, it is already bound to the "
-"namespace %2."
+"In the replacement string, %1 can only be used to escape itself or %2, not %3"
 msgstr ""
 
-#: querytransformparser.ypp:1754
+#: xmlpatterns/functions/qaggregatefns.cpp:120
 #, qt-format
-msgid "Prefix %1 is already declared in the prolog."
+msgid ""
+"The first argument to %1 cannot be of type %2. It must be a numeric type, "
+"xs:yearMonthDuration or xs:dayTimeDuration."
 msgstr ""
 
-#: querytransformparser.ypp:1836
+#: xmlpatterns/functions/qaggregatefns.cpp:194
+#, qt-format
 msgid ""
-"The name of an option must have a prefix. There is no default namespace for "
-"options."
+"The first argument to %1 cannot be of type %2. It must be of type %3, %4, or "
+"%5."
 msgstr ""
 
-#: querytransformparser.ypp:1964
+#: xmlpatterns/functions/qaggregatefns.cpp:285
 #, qt-format
 msgid ""
-"The Schema Import feature is not supported, and therefore %1 declarations "
-"cannot occur."
+"The second argument to %1 cannot be of type %2. It must be of type %3, %4, "
+"or %5."
 msgstr ""
 
-#: querytransformparser.ypp:1978
+#: xmlpatterns/type/qtypechecker.cpp:63
 #, qt-format
-msgid "The target namespace of a %1 cannot be empty."
+msgid "Required type is %1, but %2 was found."
 msgstr ""
 
-#: querytransformparser.ypp:1986
-msgid "The module import feature is not supported"
+#: xmlpatterns/type/qtypechecker.cpp:107
+#, qt-format
+msgid "Promoting %1 to %2 may cause loss of precision."
 msgstr ""
 
-#: querytransformparser.ypp:2006
-#, qt-format
-msgid "A variable with name %1 has already been declared."
+#: xmlpatterns/type/qtypechecker.cpp:156
+msgid "The focus is undefined."
 msgstr ""
 
-#: querytransformparser.ypp:2045
+#: xmlpatterns/type/qcardinality.cpp:55
+msgid "empty"
+msgstr ""
+
+#: xmlpatterns/type/qcardinality.cpp:57
+msgid "zero or one"
+msgstr ""
+
+#: xmlpatterns/type/qcardinality.cpp:59
+msgid "exactly one"
+msgstr ""
+
+#: xmlpatterns/type/qcardinality.cpp:61
+msgid "one or more"
+msgstr ""
+
+#: xmlpatterns/type/qcardinality.cpp:63
+msgid "zero or more"
+msgstr ""
+
+#: xmlpatterns/data/qabstractduration.cpp:99
+#: xmlpatterns/data/qabstractduration.cpp:114
+msgid "At least one component must be present."
+msgstr ""
+
+#: xmlpatterns/data/qabstractduration.cpp:107
 #, qt-format
-msgid "No value is available for the external variable with name %1."
+msgid "At least one time component must appear after the %1-delimiter."
 msgstr ""
 
-#: querytransformparser.ypp:2110
-msgid "A stylesheet function must have a prefixed name."
+#: xmlpatterns/data/qatomicvalue.cpp:79
+#, qt-format
+msgid "A value of type %1 cannot have an Effective Boolean Value."
 msgstr ""
 
-#: querytransformparser.ypp:2119
+#: xmlpatterns/data/qhexbinary.cpp:92
 #, qt-format
 msgid ""
-"The namespace for a user defined function cannot be empty (try the "
-"predefined prefix %1, which exists for cases like this)"
+"A value of type %1 must contain an even number of digits. The value %2 does "
+"not."
 msgstr ""
 
-#: querytransformparser.ypp:2129
+#: xmlpatterns/data/qhexbinary.cpp:111
 #, qt-format
-msgid ""
-"The namespace %1 is reserved; therefore user defined functions may not use "
-"it. Try the predefined prefix %2, which exists for these cases."
+msgid "%1 is not valid as a value of type %2."
 msgstr ""
 
-#: querytransformparser.ypp:2141
+#: xmlpatterns/data/qabstractdatetime.cpp:80
 #, qt-format
-msgid ""
-"The namespace of a user defined function in a library module must be "
-"equivalent to the module namespace. In other words, it should be %1 instead "
-"of %2"
+msgid "Year %1 is invalid because it begins with %2."
 msgstr ""
 
-#: querytransformparser.ypp:2174
+#: xmlpatterns/data/qabstractdatetime.cpp:99
 #, qt-format
-msgid "A function already exists with the signature %1."
+msgid "Day %1 is outside the range %2..%3."
 msgstr ""
 
-#: querytransformparser.ypp:2197
-msgid ""
-"No external functions are supported. All supported functions can be used "
-"directly, without first declaring them as external"
+#: xmlpatterns/data/qabstractdatetime.cpp:106
+#, qt-format
+msgid "Month %1 is outside the range %2..%3."
 msgstr ""
 
-#: querytransformparser.ypp:2223
+#: xmlpatterns/data/qabstractdatetime.cpp:117
 #, qt-format
-msgid ""
-"An argument with name %1 has already been declared. Every argument name must "
-"be unique."
+msgid "Overflow: Can't represent date %1."
 msgstr ""
 
-#: querytransformparser.ypp:2382
+#: xmlpatterns/data/qabstractdatetime.cpp:125
 #, qt-format
-msgid ""
-"When function %1 is used for matching inside a pattern, the argument must be "
-"a variable reference or a string literal."
+msgid "Day %1 is invalid for month %2."
 msgstr ""
 
-#: querytransformparser.ypp:2393
+#: xmlpatterns/data/qabstractdatetime.cpp:174
 #, qt-format
 msgid ""
-"In an XSL-T pattern, the first argument to function %1 must be a string "
-"literal, when used for matching."
+"Time 24:%1:%2.%3 is invalid. Hour is 24, but minutes, seconds, and "
+"milliseconds are not all 0; "
 msgstr ""
 
-#: querytransformparser.ypp:2407
+#: xmlpatterns/data/qabstractdatetime.cpp:187
 #, qt-format
-msgid ""
-"In an XSL-T pattern, the first argument to function %1 must be a literal or "
-"a variable reference, when used for matching."
+msgid "Time %1:%2:%3.%4 is invalid."
+msgstr ""
+
+#: xmlpatterns/data/qabstractdatetime.cpp:302
+msgid "Overflow: Date can't be represented."
 msgstr ""
 
-#: querytransformparser.ypp:2416
+#: xmlpatterns/data/qatomicmathematicians.cpp:65
 #, qt-format
-msgid "In an XSL-T pattern, function %1 cannot have a third argument."
+msgid "Integer division (%1) by zero (%2) is undefined."
 msgstr ""
 
-#: querytransformparser.ypp:2426
+#: xmlpatterns/data/qatomicmathematicians.cpp:72
 #, qt-format
-msgid ""
-"In an XSL-T pattern, only function %1 and %2, not %3, can be used for "
-"matching."
+msgid "Division (%1) by zero (%2) is undefined."
 msgstr ""
 
-#: querytransformparser.ypp:2480
+#: xmlpatterns/data/qatomicmathematicians.cpp:79
 #, qt-format
-msgid "In an XSL-T pattern, axis %1 cannot be used, only axis %2 or %3 can."
+msgid "Modulus division (%1) by zero (%2) is undefined."
 msgstr ""
 
-#: querytransformparser.ypp:2571
+#: xmlpatterns/data/qatomicmathematicians.cpp:202
+#: xmlpatterns/data/qatomicmathematicians.cpp:234
 #, qt-format
-msgid "%1 is an invalid template mode name."
+msgid "Dividing a value of type %1 by %2 (not-a-number) is not allowed."
 msgstr ""
 
-#: querytransformparser.ypp:2608
+#: xmlpatterns/data/qatomicmathematicians.cpp:214
 #, qt-format
 msgid ""
-"The name of a variable bound in a for-expression must be different from the "
-"positional variable. Hence, the two variables named %1 collide."
+"Dividing a value of type %1 by %2 or %3 (plus or minus zero) is not allowed."
 msgstr ""
 
-#: querytransformparser.ypp:3123
+#: xmlpatterns/data/qatomicmathematicians.cpp:246
 #, qt-format
 msgid ""
-"The Schema Validation Feature is not supported. Hence, %1-expressions may "
-"not be used."
-msgstr ""
-
-#: querytransformparser.ypp:3148
-msgid ""
-"None of the pragma expressions are supported. Therefore, a fallback "
-"expression must be present"
+"Multiplication of a value of type %1 by %2 or %3 (plus or minus infinity) is "
+"not allowed."
 msgstr ""
 
-#: querytransformparser.ypp:3340
+#: xmlpatterns/data/qabstractfloatmathematician.cpp:64
 #, qt-format
-msgid "Each name of a template parameter must be unique; %1 is duplicated."
+msgid "No operand in an integer division, %1, can be %2."
 msgstr ""
 
-#: querytransformparser.ypp:3443
+#: xmlpatterns/data/qabstractfloatmathematician.cpp:71
 #, qt-format
-msgid "The %1-axis is unsupported in XQuery"
+msgid ""
+"The first operand in an integer division, %1, cannot be infinity (%2)."
 msgstr ""
 
-#: querytransformparser.ypp:3653
+#: xmlpatterns/data/qabstractfloatmathematician.cpp:77
 #, qt-format
-msgid "No function with name %1 is available."
+msgid "The second operand in a division, %1, cannot be zero (%2)."
 msgstr ""
 
-#: querytransformparser.ypp:3784
-#, qt-format
+#: xmlpatterns/data/qboolean.cpp:78
 msgid ""
-"The namespace URI cannot be the empty string when binding to a prefix, %1."
+"Effective Boolean Value cannot be calculated for a sequence containing two "
+"or more atomic values."
 msgstr ""
 
-#: querytransformparser.ypp:3791
-#, qt-format
-msgid "%1 is an invalid namespace URI."
+#: xmlpatterns/utils/qoutputvalidator.cpp:86
+msgid "It's not possible to add attributes after any other kind of node."
 msgstr ""
 
-#: querytransformparser.ypp:3797
+#: xmlpatterns/utils/qoutputvalidator.cpp:93
 #, qt-format
-msgid "It is not possible to bind to the prefix %1"
+msgid "An attribute by name %1 has already been created."
 msgstr ""
 
-#: querytransformparser.ypp:3804
+#: xmlpatterns/api/qxmlserializer.cpp:321
 #, qt-format
 msgid ""
-"Namespace %1 can only be bound to %2 (and it is, in either case, pre-"
-"declared)."
+"Element %1 can't be serialized because it appears outside the document "
+"element."
 msgstr ""
 
-#: querytransformparser.ypp:3812
+#: xmlpatterns/api/qxmlserializer.cpp:381
 #, qt-format
-msgid ""
-"Prefix %1 can only be bound to %2 (and it is, in either case, pre-declared)."
+msgid "Attribute %1 can't be serialized because it appears at the top level."
 msgstr ""
 
-#: querytransformparser.ypp:3827
-#, qt-format
-msgid "Two namespace declaration attributes have the same name: %1."
+#: xmlpatterns/api/qiodevicedelegate.cpp:84
+msgid "Network timeout."
 msgstr ""
 
-#: querytransformparser.ypp:3914
-msgid ""
-"The namespace URI must be a constant and cannot use enclosed expressions."
+#: xmlpatterns/api/qcoloringmessagehandler.cpp:87
+#, qt-format
+msgid "Warning in %1, at line %2, column %3: %4"
 msgstr ""
 
-#: querytransformparser.ypp:3930
+#: xmlpatterns/api/qcoloringmessagehandler.cpp:94
 #, qt-format
-msgid "An attribute with name %1 has already appeared on this element."
+msgid "Warning in %1: %2"
 msgstr ""
 
-#: querytransformparser.ypp:3984
-#, qt-format
-msgid "A direct element constructor is not well-formed. %1 is ended with %2."
+#: xmlpatterns/api/qcoloringmessagehandler.cpp:110
+msgid "Unknown location"
 msgstr ""
 
-#: querytransformparser.ypp:4310
+#: xmlpatterns/api/qcoloringmessagehandler.cpp:124
 #, qt-format
-msgid "The name %1 does not refer to any schema type."
+msgid "Error %1 in %2, at line %3, column %4: %5"
 msgstr ""
 
-#: querytransformparser.ypp:4320
+#: xmlpatterns/api/qcoloringmessagehandler.cpp:132
 #, qt-format
-msgid ""
-"%1 is an complex type. Casting to complex types is not possible. However, "
-"casting to atomic types such as %2 works."
+msgid "Error %1 in %2: %3"
 msgstr ""
 
-#: querytransformparser.ypp:4329
+#: xmlpatterns/schema/qxsdschemaparser.cpp:170
 #, qt-format
-msgid "%1 is not an atomic type. Casting is only possible to atomic types."
+msgid "Can not process unknown element %1, expected elements are: %2."
 msgstr ""
 
-#: querytransformparser.ypp:4395
+#: xmlpatterns/schema/qxsdschemaparser.cpp:183
 #, qt-format
-msgid "%1 is not a valid name for a processing-instruction."
+msgid "Element %1 is not allowed in this scope, possible elements are: %2."
 msgstr ""
 
-#: querytransformparser.ypp:4447 querytransformparser.ypp:4503
+#: xmlpatterns/schema/qxsdschemaparser.cpp:199
 #, qt-format
 msgid ""
-"%1 is not in the in-scope attribute declarations. Note that the schema "
-"import feature is not supported."
+"Child element is missing in that scope, possible child elements are: %1."
 msgstr ""
 
-#: querytransformparser.ypp:4553
-msgid "The name of an extension expression must be in a namespace."
+#: xmlpatterns/schema/qxsdschemaparser.cpp:342
+msgid "Document is not a XML schema."
 msgstr ""
 
-#: xmlpatterns/acceltree/qacceltreeresourceloader.cpp:344
+#: xmlpatterns/schema/qxsdschemaparser.cpp:364
 #, qt-format
-msgid "%1 is an unsupported encoding."
+msgid ""
+"%1 attribute of %2 element contains invalid content: {%3} is not a value of "
+"type %4."
 msgstr ""
 
-#: xmlpatterns/acceltree/qacceltreeresourceloader.cpp:360
+#: xmlpatterns/schema/qxsdschemaparser.cpp:370
 #, qt-format
-msgid "%1 contains octets which are disallowed in the requested encoding %2."
+msgid "%1 attribute of %2 element contains invalid content: {%3}."
 msgstr ""
 
-#: xmlpatterns/acceltree/qacceltreeresourceloader.cpp:378
+#: xmlpatterns/schema/qxsdschemaparser.cpp:396
 #, qt-format
 msgid ""
-"The codepoint %1, occurring in %2 using encoding %3, is an invalid XML "
-"character."
-msgstr ""
-
-#: xmlpatterns/acceltree/qacceltreebuilder.cpp:216
-#, qt-format
-msgid "An %1-attribute with value %2 has already been declared."
+"Target namespace %1 of included schema is different from the target "
+"namespace %2 as defined by the including schema."
 msgstr ""
 
-#: xmlpatterns/acceltree/qacceltreebuilder.cpp:229
+#: xmlpatterns/schema/qxsdschemaparser.cpp:410
+#: xmlpatterns/schema/qxsdschemaparser.cpp:421
 #, qt-format
-msgid "An %1-attribute must have a valid %2 as value, which %3 isn't."
+msgid ""
+"Target namespace %1 of imported schema is different from the target "
+"namespace %2 as defined by the importing schema."
 msgstr ""
 
-#: xmlpatterns/janitors/qitemverifier.cpp:67
+#: xmlpatterns/schema/qxsdschemaparser.cpp:664
 #, qt-format
-msgid "The item %1 did not match the required type %2."
+msgid ""
+"%1 element is not allowed to have the same %2 attribute value as the target "
+"namespace %3."
 msgstr ""
 
-#: xmlpatterns/janitors/qcardinalityverifier.cpp:58
+#: xmlpatterns/schema/qxsdschemaparser.cpp:672
 #, qt-format
-msgid "Required cardinality is %1; got cardinality %2."
+msgid ""
+"%1 element without %2 attribute is not allowed inside schema without target "
+"namespace."
 msgstr ""
 
-#: xmlpatterns/functions/qtimezonefns.cpp:87
+#: xmlpatterns/schema/qxsdschemaparser.cpp:1523
+#: xmlpatterns/schema/qxsdschemaparser.cpp:1681
 #, qt-format
 msgid ""
-"A zone offset must be in the range %1..%2 inclusive. %3 is out of range."
+"%1 element is not allowed inside %2 element if %3 attribute is present."
 msgstr ""
 
-#: xmlpatterns/functions/qtimezonefns.cpp:99
+#: xmlpatterns/schema/qxsdschemaparser.cpp:1584
+#: xmlpatterns/schema/qxsdschemaparser.cpp:1703
+#: xmlpatterns/schema/qxsdschemaparser.cpp:1795
 #, qt-format
-msgid "%1 is not a whole number of minutes."
+msgid "%1 element has neither %2 attribute nor %3 child element."
 msgstr ""
 
-#: xmlpatterns/functions/qpatternmatchingfns.cpp:94
+#: xmlpatterns/schema/qxsdschemaparser.cpp:2630
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4104
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4336
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4343
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4603
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4620
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4878
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4884
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4901
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4907
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4924
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4935
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4946
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4957
 #, qt-format
-msgid ""
-"%1 must be followed by %2 or %3, not at the end of the replacement string."
+msgid "%1 element with %2 child element must not have a %3 attribute."
 msgstr ""
 
-#: xmlpatterns/functions/qpatternmatchingfns.cpp:133
+#: xmlpatterns/schema/qxsdschemaparser.cpp:3632
 #, qt-format
-msgid ""
-"In the replacement string, %1 must be followed by at least one digit when "
-"not escaped."
+msgid "%1 attribute of %2 element must be %3 or %4."
 msgstr ""
 
-#: xmlpatterns/functions/qpatternmatchingfns.cpp:159
+#: xmlpatterns/schema/qxsdschemaparser.cpp:3668
 #, qt-format
-msgid ""
-"In the replacement string, %1 can only be used to escape itself or %2, not %3"
+msgid "%1 attribute of %2 element must have a value of %3."
 msgstr ""
 
-#: xmlpatterns/functions/qdatetimefn.cpp:86
+#: xmlpatterns/schema/qxsdschemaparser.cpp:3675
+#: xmlpatterns/schema/qxsdschemaparser.cpp:3709
 #, qt-format
-msgid ""
-"If both values have zone offsets, they must have the same zone offset. %1 "
-"and %2 are not the same."
+msgid "%1 attribute of %2 element must have a value of %3 or %4."
 msgstr ""
 
-#: xmlpatterns/functions/qcomparingaggregator.cpp:197
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4028
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4157
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4166
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4173
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4180
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4507
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4710
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4716
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4722
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4728
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4734
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4740
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4746
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4823
 #, qt-format
-msgid "The first argument to %1 cannot be of type %2."
+msgid "%1 element must not have %2 and %3 attribute together."
 msgstr ""
 
-#: xmlpatterns/functions/qassemblestringfns.cpp:88
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4055
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4277
 #, qt-format
-msgid "%1 is not a valid XML 1.0 character."
-msgstr ""
-
-#: xmlpatterns/functions/qunparsedtextfn.cpp:65
-msgid "The URI cannot have a fragment"
+msgid "Content of %1 attribute of %2 element must not be from namespace %3."
 msgstr ""
 
-#: xmlpatterns/functions/qerrorfn.cpp:61
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4062
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4284
 #, qt-format
-msgid "%1 was called."
+msgid "%1 attribute of %2 element must not be %3."
 msgstr ""
 
-#: xmlpatterns/functions/qaggregatefns.cpp:120
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4220
 #, qt-format
 msgid ""
-"The first argument to %1 cannot be of type %2. It must be a numeric type, "
-"xs:yearMonthDuration or xs:dayTimeDuration."
+"%1 attribute of %2 element must have the value %3 because the %4 attribute "
+"is set."
 msgstr ""
 
-#: xmlpatterns/functions/qaggregatefns.cpp:194
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4407
+msgid "Specifying use='prohibited' inside an attribute group has no effect."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdschemaparser.cpp:4760
 #, qt-format
-msgid ""
-"The first argument to %1 cannot be of type %2. It must be of type %3, %4, or "
-"%5."
+msgid "%1 element must have either %2 or %3 attribute."
 msgstr ""
 
-#: xmlpatterns/functions/qaggregatefns.cpp:285
+#: xmlpatterns/schema/qxsdschemaparser.cpp:5314
 #, qt-format
 msgid ""
-"The second argument to %1 cannot be of type %2. It must be of type %3, %4, "
-"or %5."
+"%1 element must have either %2 attribute or %3 or %4 as child element."
 msgstr ""
 
-#: xmlpatterns/functions/qcontextnodechecker.cpp:54
+#: xmlpatterns/schema/qxsdschemaparser.cpp:5369
 #, qt-format
-msgid ""
-"The root node of the second argument to function %1 must be a document node. "
-"%2 is not a document node."
+msgid "%1 element requires either %2 or %3 attribute."
 msgstr ""
 
-#: xmlpatterns/functions/qqnamefns.cpp:69
+#: xmlpatterns/schema/qxsdschemaparser.cpp:5388
 #, qt-format
-msgid "%1 is an invalid %2"
+msgid "Text or entity references not allowed inside %1 element"
 msgstr ""
 
-#: xmlpatterns/functions/qqnamefns.cpp:87
+#: xmlpatterns/schema/qxsdschemaparser.cpp:5429
+#: xmlpatterns/schema/qxsdschemaparser.cpp:5541
 #, qt-format
-msgid ""
-"If the first argument is the empty sequence or a zero-length string (no "
-"namespace), a prefix cannot be specified. Prefix %1 was specified."
+msgid "%1 attribute of %2 element must contain %3, %4 or a list of URIs."
 msgstr ""
 
-#: xmlpatterns/functions/qsequencefns.cpp:346
+#: xmlpatterns/schema/qxsdschemaparser.cpp:5667
 #, qt-format
-msgid "It will not be possible to retrieve %1."
+msgid "%1 element is not allowed in this context."
 msgstr ""
 
-#: xmlpatterns/functions/qsequencegeneratingfns.cpp:282
-msgid "The default collection is undefined"
+#: xmlpatterns/schema/qxsdschemaparser.cpp:5720
+#, qt-format
+msgid "%1 attribute of %2 element has larger value than %3 attribute."
 msgstr ""
 
-#: xmlpatterns/functions/qsequencegeneratingfns.cpp:295
+#: xmlpatterns/schema/qxsdschemaparser.cpp:5745
 #, qt-format
-msgid "%1 cannot be retrieved"
+msgid "Prefix of qualified name %1 is not defined."
 msgstr ""
 
-#: xmlpatterns/functions/qstringvaluefns.cpp:252
+#: xmlpatterns/schema/qxsdschemaparser.cpp:5810
+#: xmlpatterns/schema/qxsdschemaparser.cpp:5871
 #, qt-format
 msgid ""
-"The normalization form %1 is unsupported. The supported forms are %2, %3, "
-"%4, and %5, and none, i.e. the empty string (no normalization)."
+"%1 attribute of %2 element must either contain %3 or the other values."
 msgstr ""
 
-#: xmlpatterns/functions/qpatternplatform.cpp:92
+#: xmlpatterns/schema/qxsdschemaparser.cpp:6002
 #, qt-format
-msgid "%1 matches newline characters"
+msgid "Component with ID %1 has been defined previously."
 msgstr ""
 
-#: xmlpatterns/functions/qpatternplatform.cpp:96
+#: xmlpatterns/schema/qxsdschemaparser.cpp:6019
 #, qt-format
-msgid "%1 and %2 match the start and end of a line."
+msgid "Element %1 already defined."
 msgstr ""
 
-#: xmlpatterns/functions/qpatternplatform.cpp:102
-msgid "Matches are case insensitive"
+#: xmlpatterns/schema/qxsdschemaparser.cpp:6030
+#, qt-format
+msgid "Attribute %1 already defined."
 msgstr ""
 
-#: xmlpatterns/functions/qpatternplatform.cpp:106
-msgid ""
-"Whitespace characters are removed, except when they appear in character "
-"classes"
+#: xmlpatterns/schema/qxsdschemaparser.cpp:6045
+#, qt-format
+msgid "Type %1 already defined."
 msgstr ""
 
-#: xmlpatterns/functions/qpatternplatform.cpp:206
+#: xmlpatterns/schema/qxsdschemaparser.cpp:6068
 #, qt-format
-msgid "%1 is an invalid regular expression pattern: %2"
+msgid "Attribute group %1 already defined."
 msgstr ""
 
-#: xmlpatterns/functions/qpatternplatform.cpp:236
+#: xmlpatterns/schema/qxsdschemaparser.cpp:6079
 #, qt-format
-msgid "%1 is an invalid flag for regular expressions. Valid flags are:"
+msgid "Element group %1 already defined."
 msgstr ""
 
-#: xmlpatterns/api/qcoloringmessagehandler.cpp:87
+#: xmlpatterns/schema/qxsdschemaparser.cpp:6090
 #, qt-format
-msgid "Warning in %1, at line %2, column %3: %4"
+msgid "Notation %1 already defined."
 msgstr ""
 
-#: xmlpatterns/api/qcoloringmessagehandler.cpp:94
+#: xmlpatterns/schema/qxsdschemaparser.cpp:6101
 #, qt-format
-msgid "Warning in %1: %2"
+msgid "Identity constraint %1 already defined."
 msgstr ""
 
-#: xmlpatterns/api/qcoloringmessagehandler.cpp:110
-msgid "Unknown location"
+#: xmlpatterns/schema/qxsdschemaparser.cpp:6112
+#, qt-format
+msgid "Duplicated facets in simple type %1."
 msgstr ""
 
-#: xmlpatterns/api/qcoloringmessagehandler.cpp:124
+#: xmlpatterns/schema/qxsdschemachecker.cpp:227
 #, qt-format
-msgid "Error %1 in %2, at line %3, column %4: %5"
+msgid "%1 has inheritance loop in its base type %2."
 msgstr ""
 
-#: xmlpatterns/api/qcoloringmessagehandler.cpp:132
+#: xmlpatterns/schema/qxsdschemachecker.cpp:232
+#: xmlpatterns/schema/qxsdschemachecker.cpp:256
 #, qt-format
-msgid "Error %1 in %2: %3"
+msgid "Circular inheritance of base type %1."
 msgstr ""
 
-#: xmlpatterns/api/qxmlserializer.cpp:321
+#: xmlpatterns/schema/qxsdschemachecker.cpp:267
 #, qt-format
-msgid ""
-"Element %1 can't be serialized because it appears outside the document "
-"element."
+msgid "Circular inheritance of union %1."
 msgstr ""
 
-#: xmlpatterns/api/qxmlserializer.cpp:381
+#: xmlpatterns/schema/qxsdschemachecker.cpp:292
 #, qt-format
-msgid "Attribute %1 can't be serialized because it appears at the top level."
+msgid ""
+"%1 is not allowed to derive from %2 by restriction as the latter defines it "
+"as final."
 msgstr ""
 
-#: xmlpatterns/api/qiodevicedelegate.cpp:84
-msgid "Network timeout."
+#: xmlpatterns/schema/qxsdschemachecker.cpp:297
+#, qt-format
+msgid ""
+"%1 is not allowed to derive from %2 by extension as the latter defines it as "
+"final."
 msgstr ""
 
-#: xmlpatterns/expr/qqnameconstructor.cpp:82
+#: xmlpatterns/schema/qxsdschemachecker.cpp:328
 #, qt-format
-msgid "No namespace binding exists for the prefix %1"
+msgid "Base type of simple type %1 cannot be complex type %2."
 msgstr ""
 
-#: xmlpatterns/expr/qcommentconstructor.cpp:67
+#: xmlpatterns/schema/qxsdschemachecker.cpp:337
 #, qt-format
-msgid "A comment cannot contain %1"
+msgid "Simple type %1 cannot have direct base type %2."
 msgstr ""
 
-#: xmlpatterns/expr/qcommentconstructor.cpp:73
+#: xmlpatterns/schema/qxsdschemachecker.cpp:370
+#: xmlpatterns/schema/qxsdschemachecker.cpp:379
 #, qt-format
-msgid "A comment cannot end with a %1."
+msgid "Simple type %1 is not allowed to have base type %2."
 msgstr ""
 
-#: xmlpatterns/expr/qattributenamevalidator.cpp:66
+#: xmlpatterns/schema/qxsdschemachecker.cpp:391
 #, qt-format
-msgid "The namespace URI in the name for a computed attribute cannot be %1."
+msgid "Simple type %1 can only have simple atomic type as base type."
 msgstr ""
 
-#: xmlpatterns/expr/qattributenamevalidator.cpp:75
+#: xmlpatterns/schema/qxsdschemachecker.cpp:397
 #, qt-format
 msgid ""
-"The name for a computed attribute cannot have the namespace URI %1 with the "
-"local name %2."
+"Simple type %1 cannot derive from %2 as the latter defines restriction as "
+"final."
 msgstr ""
 
-#: xmlpatterns/expr/qprocessinginstructionconstructor.cpp:84
+#: xmlpatterns/schema/qxsdschemachecker.cpp:410
+#: xmlpatterns/schema/qxsdschemachecker.cpp:894
 #, qt-format
-msgid "The data of a processing instruction cannot contain the string %1"
+msgid "Variety of item type of %1 must be either atomic or union."
 msgstr ""
 
-#: xmlpatterns/expr/qgenericpredicate.cpp:106
+#: xmlpatterns/schema/qxsdschemachecker.cpp:420
+#: xmlpatterns/schema/qxsdschemachecker.cpp:903
 #, qt-format
-msgid ""
-"A value of type %1 cannot be a predicate. A predicate must have either a "
-"numeric type or an Effective Boolean Value type."
+msgid "Variety of member types of %1 must be atomic."
 msgstr ""
 
-#: xmlpatterns/expr/qgenericpredicate.cpp:138
-msgid "A positional predicate must evaluate to a single numeric value."
+#: xmlpatterns/schema/qxsdschemachecker.cpp:433
+#: xmlpatterns/schema/qxsdschemachecker.cpp:884
+#, qt-format
+msgid ""
+"%1 is not allowed to derive from %2 by list as the latter defines it as "
+"final."
 msgstr ""
 
-#: xmlpatterns/expr/qevaluationcache.cpp:116
-msgid "Circularity detected"
+#: xmlpatterns/schema/qxsdschemachecker.cpp:453
+#, qt-format
+msgid "Simple type %1 is only allowed to have %2 facet."
 msgstr ""
 
-#: xmlpatterns/expr/qarithmeticexpression.cpp:208
+#: xmlpatterns/schema/qxsdschemachecker.cpp:463
 #, qt-format
-msgid "Operator %1 cannot be used on type %2."
+msgid "Base type of simple type %1 must have variety of type list."
 msgstr ""
 
-#: xmlpatterns/expr/qarithmeticexpression.cpp:224
+#: xmlpatterns/schema/qxsdschemachecker.cpp:469
 #, qt-format
-msgid "Operator %1 cannot be used on atomic values of type %2 and %3."
+msgid ""
+"Base type of simple type %1 has defined derivation by restriction as final."
 msgstr ""
 
-#: xmlpatterns/expr/qexpressionfactory.cpp:162
-msgid ""
-"A library module cannot be evaluated directly. It must be imported from a "
-"main module."
+#: xmlpatterns/schema/qxsdschemachecker.cpp:475
+#, qt-format
+msgid "Item type of base type does not match item type of %1."
 msgstr ""
 
-#: xmlpatterns/expr/qexpressionfactory.cpp:202
+#: xmlpatterns/schema/qxsdschemachecker.cpp:501
+#: xmlpatterns/schema/qxsdschemachecker.cpp:594
 #, qt-format
-msgid "No template by name %1 exists."
+msgid "Simple type %1 contains not allowed facet type %2."
 msgstr ""
 
-#: xmlpatterns/expr/qcomputednamespaceconstructor.cpp:69
+#: xmlpatterns/schema/qxsdschemachecker.cpp:522
+#: xmlpatterns/schema/qxsdschemachecker.cpp:935
+#, qt-format
 msgid ""
-"In a namespace constructor, the value for a namespace cannot be an empty "
-"string."
+"%1 is not allowed to derive from %2 by union as the latter defines it as "
+"final."
 msgstr ""
 
-#: xmlpatterns/expr/qcomputednamespaceconstructor.cpp:80
+#: xmlpatterns/schema/qxsdschemachecker.cpp:531
 #, qt-format
-msgid "The prefix must be a valid %1, which %2 is not."
+msgid "%1 is not allowed to have any facets."
 msgstr ""
 
-#: xmlpatterns/expr/qcomputednamespaceconstructor.cpp:94
+#: xmlpatterns/schema/qxsdschemachecker.cpp:539
 #, qt-format
-msgid "The prefix %1 cannot be bound."
+msgid "Base type %1 of simple type %2 must have variety of union."
 msgstr ""
 
-#: xmlpatterns/expr/qcomputednamespaceconstructor.cpp:104
+#: xmlpatterns/schema/qxsdschemachecker.cpp:548
 #, qt-format
-msgid "Only the prefix %1 can be bound to %2 and vice versa."
+msgid ""
+"Base type %1 of simple type %2 is not allowed to have restriction in %3 "
+"attribute."
 msgstr ""
 
-#: xmlpatterns/expr/qtemplate.cpp:74
+#: xmlpatterns/schema/qxsdschemachecker.cpp:566
 #, qt-format
-msgid "The parameter %1 is passed, but no corresponding %2 exists."
+msgid ""
+"Member type %1 cannot be derived from member type %2 of %3's base type %4."
 msgstr ""
 
-#: xmlpatterns/expr/qtemplate.cpp:145
+#: xmlpatterns/schema/qxsdschemachecker.cpp:631
 #, qt-format
-msgid "The parameter %1 is required, but no corresponding %2 is supplied."
+msgid ""
+"Derivation method of %1 must be extension because the base type %2 is a "
+"simple type."
 msgstr ""
 
-#: xmlpatterns/expr/qcastingplatform.cpp:136
+#: xmlpatterns/schema/qxsdschemachecker.cpp:661
 #, qt-format
-msgid "No casting is possible with %1 as the target type."
+msgid "Complex type %1 has duplicated element %2 in its content model."
 msgstr ""
 
-#: xmlpatterns/expr/qcastingplatform.cpp:151
+#: xmlpatterns/schema/qxsdschemachecker.cpp:669
 #, qt-format
-msgid "It is not possible to cast from %1 to %2."
+msgid "Complex type %1 has non-deterministic content."
 msgstr ""
 
-#: xmlpatterns/expr/qcastingplatform.cpp:178
+#: xmlpatterns/schema/qxsdschemachecker.cpp:690
 #, qt-format
 msgid ""
-"Casting to %1 is not possible because it is an abstract type, and can "
-"therefore never be instantiated."
+"Attributes of complex type %1 are not a valid extension of the attributes of "
+"base type %2: %3."
 msgstr ""
 
-#: xmlpatterns/expr/qcastingplatform.cpp:201
+#: xmlpatterns/schema/qxsdschemachecker.cpp:727
 #, qt-format
-msgid "It's not possible to cast the value %1 of type %2 to %3"
+msgid ""
+"Content model of complex type %1 is not a valid extension of content model "
+"of %2."
 msgstr ""
 
-#: xmlpatterns/expr/qcastingplatform.cpp:209
+#: xmlpatterns/schema/qxsdschemachecker.cpp:737
 #, qt-format
-msgid "Failure when casting from %1 to %2: %3"
+msgid "Complex type %1 must have simple content."
 msgstr ""
 
-#: xmlpatterns/expr/qpath.cpp:109
-msgid ""
-"The last step in a path must contain either nodes or atomic values. It "
-"cannot be a mixture between the two."
+#: xmlpatterns/schema/qxsdschemachecker.cpp:744
+#, qt-format
+msgid "Complex type %1 must have the same simple type as its base class %2."
 msgstr ""
 
-#: xmlpatterns/expr/qapplytemplate.cpp:119
-msgid "Ambiguous rule match."
+#: xmlpatterns/schema/qxsdschemachecker.cpp:811
+#, qt-format
+msgid "Complex type %1 cannot be derived from base type %2%3."
 msgstr ""
 
-#: xmlpatterns/expr/qdocumentcontentvalidator.cpp:86
+#: xmlpatterns/schema/qxsdschemachecker.cpp:825
+#, qt-format
+msgid ""
+"Attributes of complex type %1 are not a valid restriction from the "
+"attributes of base type %2: %3."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdschemachecker.cpp:839
 #, qt-format
 msgid ""
-"An attribute node cannot be a child of a document node. Therefore, the "
-"attribute %1 is out of place."
+"Complex type %1 with simple content cannot be derived from complex base type "
+"%2."
 msgstr ""
 
-#: xmlpatterns/expr/qcastas.cpp:88
+#: xmlpatterns/schema/qxsdschemachecker.cpp:874
 #, qt-format
-msgid "Type error in cast, expected %1, received %2."
+msgid "Item type of simple type %1 cannot be a complex type."
 msgstr ""
 
-#: xmlpatterns/expr/qcastas.cpp:117
+#: xmlpatterns/schema/qxsdschemachecker.cpp:918
 #, qt-format
-msgid ""
-"When casting to %1 or types derived from it, the source value must be of the "
-"same type, or it must be a string literal. Type %2 is not allowed."
+msgid "Member type of simple type %1 cannot be a complex type."
 msgstr ""
 
-#: xmlpatterns/expr/qcomparisonplatform.cpp:167
+#: xmlpatterns/schema/qxsdschemachecker.cpp:926
 #, qt-format
-msgid "No comparisons can be done involving the type %1."
+msgid "%1 is not allowed to have a member type with the same name as itself."
 msgstr ""
 
-#: xmlpatterns/expr/qcomparisonplatform.cpp:181
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1009
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1038
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1072
 #, qt-format
-msgid "Operator %1 is not available between atomic values of type %2 and %3."
+msgid "%1 facet collides with %2 facet."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:170
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1052
 #, qt-format
-msgid "Can not process unknown element %1, expected elements are: %2."
+msgid "%1 facet must have the same value as %2 facet of base type."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:183
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1089
 #, qt-format
-msgid "Element %1 is not allowed in this scope, possible elements are: %2."
+msgid "%1 facet must be equal or greater than %2 facet of base type."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:199
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1108
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1233
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1288
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1300
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1391
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1449
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1483
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1518
 #, qt-format
-msgid ""
-"Child element is missing in that scope, possible child elements are: %1."
+msgid "%1 facet must be less than or equal to %2 facet of base type."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:342
-msgid "Document is not a XML schema."
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1129
+#, qt-format
+msgid "%1 facet contains invalid regular expression"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:364
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1144
 #, qt-format
-msgid ""
-"%1 attribute of %2 element contains invalid content: {%3} is not a value of "
-"type %4."
+msgid "Unknown notation %1 used in %2 facet."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:370
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1164
 #, qt-format
-msgid "%1 attribute of %2 element contains invalid content: {%3}."
+msgid "%1 facet contains invalid value %2: %3."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:396
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1186
 #, qt-format
-msgid ""
-"Target namespace %1 of included schema is different from the target "
-"namespace %2 as defined by the including schema."
+msgid "%1 facet cannot be %2 or %3 if %4 facet of base type is %5."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:410
-#: xmlpatterns/schema/qxsdschemaparser.cpp:421
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1197
 #, qt-format
-msgid ""
-"Target namespace %1 of imported schema is different from the target "
-"namespace %2 as defined by the importing schema."
+msgid "%1 facet cannot be %2 if %3 facet of base type is %4."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:664
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1217
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1272
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1502
 #, qt-format
-msgid ""
-"%1 element is not allowed to have the same %2 attribute value as the target "
-"namespace %3."
+msgid "%1 facet must be less than or equal to %2 facet."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:672
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1245
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1379
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1461
 #, qt-format
-msgid ""
-"%1 element without %2 attribute is not allowed inside schema without target "
-"namespace."
+msgid "%1 facet must be less than %2 facet of base type."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:1523
-#: xmlpatterns/schema/qxsdschemaparser.cpp:1681
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1260
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1339
 #, qt-format
-msgid ""
-"%1 element is not allowed inside %2 element if %3 attribute is present."
+msgid "%1 facet and %2 facet cannot appear together."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:1584
-#: xmlpatterns/schema/qxsdschemaparser.cpp:1703
-#: xmlpatterns/schema/qxsdschemaparser.cpp:1795
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1312
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1324
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1437
 #, qt-format
-msgid "%1 element has neither %2 attribute nor %3 child element."
+msgid "%1 facet must be greater than %2 facet of base type."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:2630
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4104
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4336
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4343
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4603
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4620
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4878
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4884
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4901
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4907
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4924
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4935
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4946
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4957
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1351
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1409
 #, qt-format
-msgid "%1 element with %2 child element must not have a %3 attribute."
+msgid "%1 facet must be less than %2 facet."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:3632
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1367
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1425
 #, qt-format
-msgid "%1 attribute of %2 element must be %3 or %4."
+msgid "%1 facet must be greater than or equal to %2 facet of base type."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:3668
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1538
 #, qt-format
-msgid "%1 attribute of %2 element must have a value of %3."
+msgid "Simple type contains not allowed facet %1."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:3675
-#: xmlpatterns/schema/qxsdschemaparser.cpp:3709
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1550
 #, qt-format
-msgid "%1 attribute of %2 element must have a value of %3 or %4."
+msgid ""
+"%1, %2, %3, %4, %5 and %6 facets are not allowed when derived by list."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4028
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4157
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4166
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4173
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4180
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4507
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4710
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4716
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4722
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4728
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4734
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4740
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4746
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4823
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1566
 #, qt-format
-msgid "%1 element must not have %2 and %3 attribute together."
+msgid "Only %1 and %2 facets are allowed when derived by union."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4055
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4277
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1589
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1605
 #, qt-format
-msgid "Content of %1 attribute of %2 element must not be from namespace %3."
+msgid "%1 contains %2 facet with invalid data: %3."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4062
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4284
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1629
 #, qt-format
-msgid "%1 attribute of %2 element must not be %3."
+msgid "Attribute group %1 contains attribute %2 twice."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4220
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1638
 #, qt-format
 msgid ""
-"%1 attribute of %2 element must have the value %3 because the %4 attribute "
-"is set."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4407
-msgid "Specifying use='prohibited' inside an attribute group has no effect."
+"Attribute group %1 contains two different attributes that both have types "
+"derived from %2."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:4760
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1646
 #, qt-format
-msgid "%1 element must have either %2 or %3 attribute."
+msgid ""
+"Attribute group %1 contains attribute %2 that has value constraint but type "
+"that inherits from %3."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:5314
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1669
 #, qt-format
-msgid ""
-"%1 element must have either %2 attribute or %3 or %4 as child element."
+msgid "Complex type %1 contains attribute %2 twice."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:5369
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1678
 #, qt-format
-msgid "%1 element requires either %2 or %3 attribute."
+msgid ""
+"Complex type %1 contains two different attributes that both have types "
+"derived from %2."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:5388
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1686
 #, qt-format
-msgid "Text or entity references not allowed inside %1 element"
+msgid ""
+"Complex type %1 contains attribute %2 that has value constraint but type "
+"that inherits from %3."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:5429
-#: xmlpatterns/schema/qxsdschemaparser.cpp:5541
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1729
 #, qt-format
-msgid "%1 attribute of %2 element must contain %3, %4 or a list of URIs."
+msgid ""
+"Element %1 is not allowed to have a value constraint if its base type is "
+"complex."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:5667
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1736
 #, qt-format
-msgid "%1 element is not allowed in this context."
+msgid ""
+"Element %1 is not allowed to have a value constraint if its type is derived "
+"from %2."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:5720
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1746
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1757
 #, qt-format
-msgid "%1 attribute of %2 element has larger value than %3 attribute."
+msgid "Value constraint of element %1 is not of elements type: %2."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:5745
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1770
 #, qt-format
-msgid "Prefix of qualified name %1 is not defined."
+msgid ""
+"Element %1 is not allowed to have substitution group affiliation as it is no "
+"global element."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:5810
-#: xmlpatterns/schema/qxsdschemaparser.cpp:5871
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1798
 #, qt-format
 msgid ""
-"%1 attribute of %2 element must either contain %3 or the other values."
+"Type of element %1 cannot be derived from type of substitution group "
+"affiliation."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:6002
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1839
 #, qt-format
-msgid "Component with ID %1 has been defined previously."
+msgid "Value constraint of attribute %1 is not of attributes type: %2."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:6019
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1848
 #, qt-format
-msgid "Element %1 already defined."
+msgid "Attribute %1 has value constraint but has type derived from %2."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:6030
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1904
 #, qt-format
-msgid "Attribute %1 already defined."
+msgid "%1 attribute in derived complex type must be %2 like in base type."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:6045
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1915
 #, qt-format
-msgid "Type %1 already defined."
+msgid ""
+"Attribute %1 in derived complex type must have %2 value constraint like in "
+"base type."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:6068
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1924
 #, qt-format
-msgid "Attribute group %1 already defined."
+msgid ""
+"Attribute %1 in derived complex type must have the same %2 value constraint "
+"like in base type."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:6079
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1931
 #, qt-format
-msgid "Element group %1 already defined."
+msgid "Attribute %1 in derived complex type must have %2 value constraint."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:6090
-#, qt-format
-msgid "Notation %1 already defined."
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1949
+msgid "processContent of base wildcard must be weaker than derived wildcard."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:6101
+#: xmlpatterns/schema/qxsdschemachecker.cpp:1988
+#: xmlpatterns/schema/qxsdschemachecker.cpp:2003
 #, qt-format
-msgid "Identity constraint %1 already defined."
+msgid "Element %1 exists twice with different types."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemaparser.cpp:6112
-#, qt-format
-msgid "Duplicated facets in simple type %1."
+#: xmlpatterns/schema/qxsdschemachecker.cpp:2031
+msgid "Particle contains non-deterministic wildcards."
 msgstr ""
 
 #: xmlpatterns/schema/qxsdschemaresolver.cpp:354
@@ -5988,256 +6217,23 @@
 "Union of attribute wildcard of type %1 and attribute wildcard of its base "
 "type %2 is not expressible."
 msgstr ""
-
-#: xmlpatterns/schema/qxsdschemaresolver.cpp:1613
-#, qt-format
-msgid ""
-"Enumeration facet contains invalid content: {%1} is not a value of type %2."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdschemaresolver.cpp:1623
-#, qt-format
-msgid "Namespace prefix of qualified name %1 is not defined."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdschemaresolver.cpp:1674
-#: xmlpatterns/schema/qxsdschemaresolver.cpp:1692
-#, qt-format
-msgid ""
-"%1 element %2 is not a valid restriction of the %3 element it redefines: %4."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:235
-#: xmlpatterns/schema/qxsdtypechecker.cpp:242
-#: xmlpatterns/schema/qxsdtypechecker.cpp:263
-#, qt-format
-msgid "%1 is not valid according to %2."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:430
-msgid "String content does not match the length facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:438
-msgid "String content does not match the minLength facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:446
-msgid "String content does not match the maxLength facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:464
-msgid "String content does not match pattern facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:482
-msgid "String content is not listed in the enumeration facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:499
-msgid "Signed integer content does not match the maxInclusive facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:507
-msgid "Signed integer content does not match the maxExclusive facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:515
-msgid "Signed integer content does not match the minInclusive facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:523
-msgid "Signed integer content does not match the minExclusive facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:541
-msgid "Signed integer content is not listed in the enumeration facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:559
-msgid "Signed integer content does not match pattern facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:568
-msgid "Signed integer content does not match in the totalDigits facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:585
-msgid "Unsigned integer content does not match the maxInclusive facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:593
-msgid "Unsigned integer content does not match the maxExclusive facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:601
-msgid "Unsigned integer content does not match the minInclusive facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:609
-msgid "Unsigned integer content does not match the minExclusive facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:627
-msgid "Unsigned integer content is not listed in the enumeration facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:645
-msgid "Unsigned integer content does not match pattern facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:654
-msgid "Unsigned integer content does not match in the totalDigits facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:671
-msgid "Double content does not match the maxInclusive facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:679
-msgid "Double content does not match the maxExclusive facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:687
-msgid "Double content does not match the minInclusive facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:695
-msgid "Double content does not match the minExclusive facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:721
-msgid "Double content is not listed in the enumeration facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:739
-msgid "Double content does not match pattern facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:757
-msgid "Decimal content does not match in the fractionDigits facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:766
-msgid "Decimal content does not match in the totalDigits facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:780
-msgid "Date time content does not match the maxInclusive facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:788
-msgid "Date time content does not match the maxExclusive facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:796
-msgid "Date time content does not match the minInclusive facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:804
-msgid "Date time content does not match the minExclusive facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:822
-msgid "Date time content is not listed in the enumeration facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:840
-msgid "Date time content does not match pattern facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:855
-msgid "Duration content does not match the maxInclusive facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:864
-msgid "Duration content does not match the maxExclusive facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:873
-msgid "Duration content does not match the minInclusive facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:882
-msgid "Duration content does not match the minExclusive facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:900
-msgid "Duration content is not listed in the enumeration facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:918
-msgid "Duration content does not match pattern facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:945
-msgid "Boolean content does not match pattern facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:962
-msgid "Binary content does not match the length facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:970
-msgid "Binary content does not match the minLength facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:978
-msgid "Binary content does not match the maxLength facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:996
-msgid "Binary content is not listed in the enumeration facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:1023
-#, qt-format
-msgid "Invalid QName content: %1."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:1040
-msgid "QName content is not listed in the enumeration facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:1058
-msgid "QName content does not match pattern facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:1094
-msgid "Notation content is not listed in the enumeration facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:1113
-msgid "List content does not match length facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:1120
-msgid "List content does not match minLength facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:1127
-msgid "List content does not match maxLength facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:1217
-msgid "List content is not listed in the enumeration facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:1235
-msgid "List content does not match pattern facet."
-msgstr ""
-
-#: xmlpatterns/schema/qxsdtypechecker.cpp:1274
-msgid "Union content is not listed in the enumeration facet."
+
+#: xmlpatterns/schema/qxsdschemaresolver.cpp:1613
+#, qt-format
+msgid ""
+"Enumeration facet contains invalid content: {%1} is not a value of type %2."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdtypechecker.cpp:1292
-msgid "Union content does not match pattern facet."
+#: xmlpatterns/schema/qxsdschemaresolver.cpp:1623
+#, qt-format
+msgid "Namespace prefix of qualified name %1 is not defined."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdtypechecker.cpp:1307
+#: xmlpatterns/schema/qxsdschemaresolver.cpp:1674
+#: xmlpatterns/schema/qxsdschemaresolver.cpp:1692
 #, qt-format
-msgid "Data of type %1 are not allowed to be empty."
+msgid ""
+"%1 element %2 is not a valid restriction of the %3 element it redefines: %4."
 msgstr ""
 
 #: xmlpatterns/schema/qxsdvalidatinginstancereader.cpp:160
@@ -6477,54 +6473,287 @@
 "base attribute."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemahelper.cpp:730
-#, qt-format
-msgid "Derived attribute %1 does not exist in the base definition."
+#: xmlpatterns/schema/qxsdschemahelper.cpp:730
+#, qt-format
+msgid "Derived attribute %1 does not exist in the base definition."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdschemahelper.cpp:741
+#, qt-format
+msgid ""
+"Derived attribute %1 does not match the wildcard in the base definition."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdschemahelper.cpp:758
+#, qt-format
+msgid "Base attribute %1 is required but missing in derived definition."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdschemahelper.cpp:767
+#, qt-format
+msgid ""
+"Derived definition contains an %1 element that does not exists in the base "
+"definition"
+msgstr ""
+
+#: xmlpatterns/schema/qxsdschemahelper.cpp:772
+msgid "Derived wildcard is not a subset of the base wildcard."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdschemahelper.cpp:777
+#, qt-format
+msgid ""
+"%1 of derived wildcard is not a valid restriction of %2 of base wildcard"
+msgstr ""
+
+#: xmlpatterns/schema/qxsdschemahelper.cpp:800
+#, qt-format
+msgid "Attribute %1 from base type is missing in derived type."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdschemahelper.cpp:805
+#, qt-format
+msgid "Type of derived attribute %1 differs from type of base attribute."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdschemahelper.cpp:813
+#, qt-format
+msgid ""
+"Base definition contains an %1 element that is missing in the derived "
+"definition"
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:235
+#: xmlpatterns/schema/qxsdtypechecker.cpp:242
+#: xmlpatterns/schema/qxsdtypechecker.cpp:263
+#, qt-format
+msgid "%1 is not valid according to %2."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:430
+msgid "String content does not match the length facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:438
+msgid "String content does not match the minLength facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:446
+msgid "String content does not match the maxLength facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:464
+msgid "String content does not match pattern facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:482
+msgid "String content is not listed in the enumeration facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:499
+msgid "Signed integer content does not match the maxInclusive facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:507
+msgid "Signed integer content does not match the maxExclusive facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:515
+msgid "Signed integer content does not match the minInclusive facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:523
+msgid "Signed integer content does not match the minExclusive facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:541
+msgid "Signed integer content is not listed in the enumeration facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:559
+msgid "Signed integer content does not match pattern facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:568
+msgid "Signed integer content does not match in the totalDigits facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:585
+msgid "Unsigned integer content does not match the maxInclusive facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:593
+msgid "Unsigned integer content does not match the maxExclusive facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:601
+msgid "Unsigned integer content does not match the minInclusive facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:609
+msgid "Unsigned integer content does not match the minExclusive facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:627
+msgid "Unsigned integer content is not listed in the enumeration facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:645
+msgid "Unsigned integer content does not match pattern facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:654
+msgid "Unsigned integer content does not match in the totalDigits facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:671
+msgid "Double content does not match the maxInclusive facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:679
+msgid "Double content does not match the maxExclusive facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:687
+msgid "Double content does not match the minInclusive facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:695
+msgid "Double content does not match the minExclusive facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:721
+msgid "Double content is not listed in the enumeration facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:739
+msgid "Double content does not match pattern facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:757
+msgid "Decimal content does not match in the fractionDigits facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:766
+msgid "Decimal content does not match in the totalDigits facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:780
+msgid "Date time content does not match the maxInclusive facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:788
+msgid "Date time content does not match the maxExclusive facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:796
+msgid "Date time content does not match the minInclusive facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:804
+msgid "Date time content does not match the minExclusive facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:822
+msgid "Date time content is not listed in the enumeration facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:840
+msgid "Date time content does not match pattern facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:855
+msgid "Duration content does not match the maxInclusive facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:864
+msgid "Duration content does not match the maxExclusive facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:873
+msgid "Duration content does not match the minInclusive facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:882
+msgid "Duration content does not match the minExclusive facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:900
+msgid "Duration content is not listed in the enumeration facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:918
+msgid "Duration content does not match pattern facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:945
+msgid "Boolean content does not match pattern facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:962
+msgid "Binary content does not match the length facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:970
+msgid "Binary content does not match the minLength facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:978
+msgid "Binary content does not match the maxLength facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:996
+msgid "Binary content is not listed in the enumeration facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:1023
+#, qt-format
+msgid "Invalid QName content: %1."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:1040
+msgid "QName content is not listed in the enumeration facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:1058
+msgid "QName content does not match pattern facet."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemahelper.cpp:741
-#, qt-format
-msgid ""
-"Derived attribute %1 does not match the wildcard in the base definition."
+#: xmlpatterns/schema/qxsdtypechecker.cpp:1094
+msgid "Notation content is not listed in the enumeration facet."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemahelper.cpp:758
-#, qt-format
-msgid "Base attribute %1 is required but missing in derived definition."
+#: xmlpatterns/schema/qxsdtypechecker.cpp:1113
+msgid "List content does not match length facet."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemahelper.cpp:767
-#, qt-format
-msgid ""
-"Derived definition contains an %1 element that does not exists in the base "
-"definition"
+#: xmlpatterns/schema/qxsdtypechecker.cpp:1120
+msgid "List content does not match minLength facet."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemahelper.cpp:772
-msgid "Derived wildcard is not a subset of the base wildcard."
+#: xmlpatterns/schema/qxsdtypechecker.cpp:1127
+msgid "List content does not match maxLength facet."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemahelper.cpp:777
-#, qt-format
-msgid ""
-"%1 of derived wildcard is not a valid restriction of %2 of base wildcard"
+#: xmlpatterns/schema/qxsdtypechecker.cpp:1217
+msgid "List content is not listed in the enumeration facet."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemahelper.cpp:800
-#, qt-format
-msgid "Attribute %1 from base type is missing in derived type."
+#: xmlpatterns/schema/qxsdtypechecker.cpp:1235
+msgid "List content does not match pattern facet."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemahelper.cpp:805
-#, qt-format
-msgid "Type of derived attribute %1 differs from type of base attribute."
+#: xmlpatterns/schema/qxsdtypechecker.cpp:1274
+msgid "Union content is not listed in the enumeration facet."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemahelper.cpp:813
+#: xmlpatterns/schema/qxsdtypechecker.cpp:1292
+msgid "Union content does not match pattern facet."
+msgstr ""
+
+#: xmlpatterns/schema/qxsdtypechecker.cpp:1307
 #, qt-format
-msgid ""
-"Base definition contains an %1 element that is missing in the derived "
-"definition"
+msgid "Data of type %1 are not allowed to be empty."
 msgstr ""
 
 #: xmlpatterns/schema/qxsdparticlechecker.cpp:165
@@ -6609,2811 +6838,2720 @@
 "Derived particle allows content that is not allowed in the base particle."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:227
+#: xmlpatterns/janitors/qitemverifier.cpp:67
 #, qt-format
-msgid "%1 has inheritance loop in its base type %2."
+msgid "The item %1 did not match the required type %2."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:232
-#: xmlpatterns/schema/qxsdschemachecker.cpp:256
+#: xmlpatterns/janitors/qcardinalityverifier.cpp:58
 #, qt-format
-msgid "Circular inheritance of base type %1."
+msgid "Required cardinality is %1; got cardinality %2."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:267
+#: xmlpatterns/acceltree/qacceltreeresourceloader.cpp:344
 #, qt-format
-msgid "Circular inheritance of union %1."
+msgid "%1 is an unsupported encoding."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:292
+#: xmlpatterns/acceltree/qacceltreeresourceloader.cpp:360
 #, qt-format
-msgid ""
-"%1 is not allowed to derive from %2 by restriction as the latter defines it "
-"as final."
+msgid "%1 contains octets which are disallowed in the requested encoding %2."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:297
+#: xmlpatterns/acceltree/qacceltreeresourceloader.cpp:378
 #, qt-format
 msgid ""
-"%1 is not allowed to derive from %2 by extension as the latter defines it as "
-"final."
+"The codepoint %1, occurring in %2 using encoding %3, is an invalid XML "
+"character."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:328
+#: xmlpatterns/acceltree/qacceltreebuilder.cpp:216
 #, qt-format
-msgid "Base type of simple type %1 cannot be complex type %2."
+msgid "An %1-attribute with value %2 has already been declared."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:337
+#: xmlpatterns/acceltree/qacceltreebuilder.cpp:229
 #, qt-format
-msgid "Simple type %1 cannot have direct base type %2."
+msgid "An %1-attribute must have a valid %2 as value, which %3 isn't."
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:370
-#: xmlpatterns/schema/qxsdschemachecker.cpp:379
-#, qt-format
-msgid "Simple type %1 is not allowed to have base type %2."
-msgstr ""
+#: sql/drivers/psql/qsql_psql.cpp:198
+msgctxt "QPSQLResult"
+msgid "Unable to create query"
+msgstr "عاجز عن إنشاء استعلام"
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:391
-#, qt-format
-msgid "Simple type %1 can only have simple atomic type as base type."
-msgstr ""
+#: sql/drivers/psql/qsql_psql.cpp:570
+msgctxt "QPSQLResult"
+msgid "Unable to prepare statement"
+msgstr "عاجز عن تحضير الجملة"
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:397
-#, qt-format
-msgid ""
-"Simple type %1 cannot derive from %2 as the latter defines restriction as "
-"final."
-msgstr ""
+#: sql/drivers/psql/qsql_psql.cpp:819 sql/drivers/db2/qsql_db2.cpp:1253
+#: sql/drivers/mysql/qsql_mysql.cpp:1298 sql/drivers/odbc/qsql_odbc.cpp:1879
+msgid "Unable to connect"
+msgstr "عاجز عن الاتصال"
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:410
-#: xmlpatterns/schema/qxsdschemachecker.cpp:894
-#, qt-format
-msgid "Variety of item type of %1 must be either atomic or union."
-msgstr ""
+#: sql/drivers/psql/qsql_psql.cpp:868
+msgid "Could not begin transaction"
+msgstr "لا يمكن بدء العملية"
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:420
-#: xmlpatterns/schema/qxsdschemachecker.cpp:903
-#, qt-format
-msgid "Variety of member types of %1 must be atomic."
-msgstr ""
+#: sql/drivers/psql/qsql_psql.cpp:901
+msgid "Could not commit transaction"
+msgstr "لا يمكن تسليم العملية"
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:433
-#: xmlpatterns/schema/qxsdschemachecker.cpp:884
-#, qt-format
-msgid ""
-"%1 is not allowed to derive from %2 by list as the latter defines it as "
-"final."
-msgstr ""
+#: sql/drivers/psql/qsql_psql.cpp:917
+msgid "Could not rollback transaction"
+msgstr "لا يمكن التراجع عن العملية"
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:453
-#, qt-format
-msgid "Simple type %1 is only allowed to have %2 facet."
-msgstr ""
+#: sql/drivers/psql/qsql_psql.cpp:1303
+msgid "Unable to subscribe"
+msgstr "عاجز عن الإشتراك"
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:463
-#, qt-format
-msgid "Base type of simple type %1 must have variety of type list."
-msgstr ""
+#: sql/drivers/psql/qsql_psql.cpp:1335
+msgid "Unable to unsubscribe"
+msgstr "عاجز عن إلغاء الإشتراك"
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:469
-#, qt-format
-msgid ""
-"Base type of simple type %1 has defined derivation by restriction as final."
-msgstr ""
+#: sql/drivers/ibase/qsql_ibase.cpp:422
+msgctxt "QIBaseResult"
+msgid "Unable to create BLOB"
+msgstr "عاجز عن إنشاء BLOB"
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:475
-#, qt-format
-msgid "Item type of base type does not match item type of %1."
+#: sql/drivers/ibase/qsql_ibase.cpp:428
+msgctxt "QIBaseResult"
+msgid "Unable to write BLOB"
+msgstr "عاجز عن كتابة BLOB"
+
+#: sql/drivers/ibase/qsql_ibase.cpp:442
+msgctxt "QIBaseResult"
+msgid "Unable to open BLOB"
+msgstr "عاجز عن فتح BLOB"
+
+#: sql/drivers/ibase/qsql_ibase.cpp:459
+msgctxt "QIBaseResult"
+msgid "Unable to read BLOB"
+msgstr "عاجز عن قراءة BLOB"
+
+#: sql/drivers/ibase/qsql_ibase.cpp:583 sql/drivers/ibase/qsql_ibase.cpp:770
+msgctxt "QIBaseResult"
+msgid "Could not find array"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:501
-#: xmlpatterns/schema/qxsdschemachecker.cpp:594
-#, qt-format
-msgid "Simple type %1 contains not allowed facet type %2."
+#: sql/drivers/ibase/qsql_ibase.cpp:615
+msgctxt "QIBaseResult"
+msgid "Could not get array data"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:522
-#: xmlpatterns/schema/qxsdschemachecker.cpp:935
-#, qt-format
-msgid ""
-"%1 is not allowed to derive from %2 by union as the latter defines it as "
-"final."
+#: sql/drivers/ibase/qsql_ibase.cpp:825
+msgctxt "QIBaseResult"
+msgid "Could not get query info"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:531
-#, qt-format
-msgid "%1 is not allowed to have any facets."
+#: sql/drivers/ibase/qsql_ibase.cpp:845
+msgctxt "QIBaseResult"
+msgid "Could not start transaction"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:539
-#, qt-format
-msgid "Base type %1 of simple type %2 must have variety of union."
+#: sql/drivers/ibase/qsql_ibase.cpp:864
+msgctxt "QIBaseResult"
+msgid "Unable to commit transaction"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:548
-#, qt-format
-msgid ""
-"Base type %1 of simple type %2 is not allowed to have restriction in %3 "
-"attribute."
+#: sql/drivers/ibase/qsql_ibase.cpp:906
+msgctxt "QIBaseResult"
+msgid "Could not allocate statement"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:566
-#, qt-format
-msgid ""
-"Member type %1 cannot be derived from member type %2 of %3's base type %4."
+#: sql/drivers/ibase/qsql_ibase.cpp:911
+msgctxt "QIBaseResult"
+msgid "Could not prepare statement"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:631
-#, qt-format
-msgid ""
-"Derivation method of %1 must be extension because the base type %2 is a "
-"simple type."
+#: sql/drivers/ibase/qsql_ibase.cpp:917 sql/drivers/ibase/qsql_ibase.cpp:928
+msgctxt "QIBaseResult"
+msgid "Could not describe input statement"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:661
-#, qt-format
-msgid "Complex type %1 has duplicated element %2 in its content model."
+#: sql/drivers/ibase/qsql_ibase.cpp:941
+msgctxt "QIBaseResult"
+msgid "Could not describe statement"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:669
-#, qt-format
-msgid "Complex type %1 has non-deterministic content."
+#: sql/drivers/ibase/qsql_ibase.cpp:1056
+msgctxt "QIBaseResult"
+msgid "Unable to close statement"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:690
-#, qt-format
-msgid ""
-"Attributes of complex type %1 are not a valid extension of the attributes of "
-"base type %2: %3."
+#: sql/drivers/ibase/qsql_ibase.cpp:1064
+msgctxt "QIBaseResult"
+msgid "Unable to execute query"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:727
-#, qt-format
-msgid ""
-"Content model of complex type %1 is not a valid extension of content model "
-"of %2."
+#: sql/drivers/ibase/qsql_ibase.cpp:1110
+msgctxt "QIBaseResult"
+msgid "Could not fetch next item"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:737
-#, qt-format
-msgid "Complex type %1 must have simple content."
+#: sql/drivers/ibase/qsql_ibase.cpp:1307
+msgctxt "QIBaseResult"
+msgid "Could not get statement info"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:744
-#, qt-format
-msgid "Complex type %1 must have the same simple type as its base class %2."
+#: sql/drivers/ibase/qsql_ibase.cpp:1491
+msgctxt "QIBaseDriver"
+msgid "Error opening database"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:811
-#, qt-format
-msgid "Complex type %1 cannot be derived from base type %2%3."
+#: sql/drivers/ibase/qsql_ibase.cpp:1545
+msgctxt "QIBaseDriver"
+msgid "Could not start transaction"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:825
-#, qt-format
-msgid ""
-"Attributes of complex type %1 are not a valid restriction from the "
-"attributes of base type %2: %3."
+#: sql/drivers/ibase/qsql_ibase.cpp:1558
+msgctxt "QIBaseDriver"
+msgid "Unable to commit transaction"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:839
-#, qt-format
-msgid ""
-"Complex type %1 with simple content cannot be derived from complex base type "
-"%2."
+#: sql/drivers/ibase/qsql_ibase.cpp:1571
+msgctxt "QIBaseDriver"
+msgid "Unable to rollback transaction"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:874
-#, qt-format
-msgid "Item type of simple type %1 cannot be a complex type."
+#: sql/drivers/db2/qsql_db2.cpp:554 sql/drivers/db2/qsql_db2.cpp:794
+msgctxt "QDB2Result"
+msgid "Unable to execute statement"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:918
-#, qt-format
-msgid "Member type of simple type %1 cannot be a complex type."
+#: sql/drivers/db2/qsql_db2.cpp:591
+msgctxt "QDB2Result"
+msgid "Unable to prepare statement"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:926
-#, qt-format
-msgid "%1 is not allowed to have a member type with the same name as itself."
+#: sql/drivers/db2/qsql_db2.cpp:784
+msgctxt "QDB2Result"
+msgid "Unable to bind variable"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1009
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1038
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1072
+#: sql/drivers/db2/qsql_db2.cpp:873
 #, qt-format
-msgid "%1 facet collides with %2 facet."
+msgctxt "QDB2Result"
+msgid "Unable to fetch record %1"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1052
-#, qt-format
-msgid "%1 facet must have the same value as %2 facet of base type."
+#: sql/drivers/db2/qsql_db2.cpp:892
+msgctxt "QDB2Result"
+msgid "Unable to fetch next"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1089
-#, qt-format
-msgid "%1 facet must be equal or greater than %2 facet of base type."
+#: sql/drivers/db2/qsql_db2.cpp:912
+msgctxt "QDB2Result"
+msgid "Unable to fetch first"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1108
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1233
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1288
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1300
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1391
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1449
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1483
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1518
-#, qt-format
-msgid "%1 facet must be less than or equal to %2 facet of base type."
-msgstr ""
+#: sql/drivers/db2/qsql_db2.cpp:1102 sql/drivers/odbc/qsql_odbc.cpp:1115
+#: sql/drivers/odbc/qsql_odbc.cpp:1693
+msgctxt "QODBCResult"
+msgid "Unable to fetch last"
+msgstr "عاجز عن جلب الأخير"
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1129
-#, qt-format
-msgid "%1 facet contains invalid regular expression"
+#: sql/drivers/db2/qsql_db2.cpp:1551 sql/drivers/symsql/qsql_symsql.cpp:1056
+#: sql/drivers/mysql/qsql_mysql.cpp:1469
+#: sql/drivers/sqlite2/qsql_sqlite2.cpp:457
+#: sql/drivers/odbc/qsql_odbc.cpp:2165 sql/drivers/sqlite/qsql_sqlite.cpp:592
+msgid "Unable to commit transaction"
+msgstr "عاجز عن تسليم العملية"
+
+#: sql/drivers/db2/qsql_db2.cpp:1568 sql/drivers/symsql/qsql_symsql.cpp:1071
+#: sql/drivers/mysql/qsql_mysql.cpp:1486
+#: sql/drivers/sqlite2/qsql_sqlite2.cpp:474
+#: sql/drivers/odbc/qsql_odbc.cpp:2182 sql/drivers/sqlite/qsql_sqlite.cpp:607
+msgid "Unable to rollback transaction"
+msgstr "عاجز عن التراجع عن العملية"
+
+#: sql/drivers/db2/qsql_db2.cpp:1583
+msgid "Unable to set autocommit"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1144
-#, qt-format
-msgid "Unknown notation %1 used in %2 facet."
+#: sql/drivers/symsql/qsql_symsql.cpp:220
+msgctxt "QSymSQLResult"
+msgid "Error retrieving column count"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1164
-#, qt-format
-msgid "%1 facet contains invalid value %2: %3."
+#: sql/drivers/symsql/qsql_symsql.cpp:230
+msgctxt "QSymSQLResult"
+msgid "Error retrieving column name"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1186
-#, qt-format
-msgid "%1 facet cannot be %2 or %3 if %4 facet of base type is %5."
+#: sql/drivers/symsql/qsql_symsql.cpp:243
+msgctxt "QSymSQLResult"
+msgid "Error retrieving column type"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1197
-#, qt-format
-msgid "%1 facet cannot be %2 if %3 facet of base type is %4."
+#: sql/drivers/symsql/qsql_symsql.cpp:279
+#: sql/drivers/symsql/qsql_symsql.cpp:287
+msgctxt "QSymSQLResult"
+msgid "Unable to fetch row"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1217
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1272
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1502
-#, qt-format
-msgid "%1 facet must be less than or equal to %2 facet."
+#: sql/drivers/symsql/qsql_symsql.cpp:331
+msgctxt "QSymSQLResult"
+msgid "Unable to execute statement"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1245
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1379
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1461
-#, qt-format
-msgid "%1 facet must be less than %2 facet of base type."
+#: sql/drivers/symsql/qsql_symsql.cpp:345
+msgctxt "QSymSQLResult"
+msgid "Statement is not prepared"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1260
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1339
-#, qt-format
-msgid "%1 facet and %2 facet cannot appear together."
+#: sql/drivers/symsql/qsql_symsql.cpp:359
+msgctxt "QSymSQLResult"
+msgid "Unable to reset statement"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1312
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1324
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1437
-#, qt-format
-msgid "%1 facet must be greater than %2 facet of base type."
+#: sql/drivers/symsql/qsql_symsql.cpp:407
+msgctxt "QSymSQLResult"
+msgid "Unable to bind parameters"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1351
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1409
-#, qt-format
-msgid "%1 facet must be less than %2 facet."
+#: sql/drivers/symsql/qsql_symsql.cpp:414
+msgctxt "QSymSQLResult"
+msgid "Parameter count mismatch"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1367
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1425
-#, qt-format
-msgid "%1 facet must be greater than or equal to %2 facet of base type."
+#: sql/drivers/symsql/qsql_symsql.cpp:975
+#: sql/drivers/symsql/qsql_symsql.cpp:991
+msgid "Invalid option: "
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1538
-#, qt-format
-msgid "Simple type contains not allowed facet %1."
+#: sql/drivers/symsql/qsql_symsql.cpp:985
+#: sql/drivers/symsql/qsql_symsql.cpp:1002
+#: sql/drivers/sqlite2/qsql_sqlite2.cpp:399
+#: sql/drivers/sqlite/qsql_sqlite.cpp:546
+msgid "Error opening database"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1550
-#, qt-format
+#: sql/drivers/symsql/qsql_symsql.cpp:1005
 msgid ""
-"%1, %2, %3, %4, %5 and %6 facets are not allowed when derived by list."
+"POLICY_DB_DEFAULT must be defined before any other POLICY definitions can be "
+"used"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1566
-#, qt-format
-msgid "Only %1 and %2 facets are allowed when derived by union."
+#: sql/drivers/symsql/qsql_symsql.cpp:1041
+#: sql/drivers/mysql/qsql_mysql.cpp:1452
+#: sql/drivers/sqlite2/qsql_sqlite2.cpp:440
+#: sql/drivers/sqlite/qsql_sqlite.cpp:577
+msgid "Unable to begin transaction"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1589
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1605
-#, qt-format
-msgid "%1 contains %2 facet with invalid data: %3."
+#: sql/drivers/mysql/qsql_mysql.cpp:506 sql/drivers/mysql/qsql_mysql.cpp:537
+msgctxt "QMYSQLResult"
+msgid "Unable to fetch data"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1629
-#, qt-format
-msgid "Attribute group %1 contains attribute %2 twice."
+#: sql/drivers/mysql/qsql_mysql.cpp:697
+msgctxt "QMYSQLResult"
+msgid "Unable to execute query"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1638
-#, qt-format
-msgid ""
-"Attribute group %1 contains two different attributes that both have types "
-"derived from %2."
+#: sql/drivers/mysql/qsql_mysql.cpp:703
+msgctxt "QMYSQLResult"
+msgid "Unable to store result"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1646
-#, qt-format
-msgid ""
-"Attribute group %1 contains attribute %2 that has value constraint but type "
-"that inherits from %3."
+#: sql/drivers/mysql/qsql_mysql.cpp:806
+msgctxt "QMYSQLResult"
+msgid "Unable to execute next query"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1669
-#, qt-format
-msgid "Complex type %1 contains attribute %2 twice."
+#: sql/drivers/mysql/qsql_mysql.cpp:816
+msgctxt "QMYSQLResult"
+msgid "Unable to store next result"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1678
-#, qt-format
-msgid ""
-"Complex type %1 contains two different attributes that both have types "
-"derived from %2."
+#: sql/drivers/mysql/qsql_mysql.cpp:894 sql/drivers/mysql/qsql_mysql.cpp:903
+msgctxt "QMYSQLResult"
+msgid "Unable to prepare statement"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1686
-#, qt-format
-msgid ""
-"Complex type %1 contains attribute %2 that has value constraint but type "
-"that inherits from %3."
+#: sql/drivers/mysql/qsql_mysql.cpp:940
+msgctxt "QMYSQLResult"
+msgid "Unable to reset statement"
+msgstr ""
+
+#: sql/drivers/mysql/qsql_mysql.cpp:1026
+msgctxt "QMYSQLResult"
+msgid "Unable to bind value"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1729
-#, qt-format
-msgid ""
-"Element %1 is not allowed to have a value constraint if its base type is "
-"complex."
+#: sql/drivers/mysql/qsql_mysql.cpp:1037
+msgctxt "QMYSQLResult"
+msgid "Unable to execute statement"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1736
-#, qt-format
-msgid ""
-"Element %1 is not allowed to have a value constraint if its type is derived "
-"from %2."
+#: sql/drivers/mysql/qsql_mysql.cpp:1051 sql/drivers/mysql/qsql_mysql.cpp:1072
+msgctxt "QMYSQLResult"
+msgid "Unable to bind outvalues"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1746
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1757
-#, qt-format
-msgid "Value constraint of element %1 is not of elements type: %2."
+#: sql/drivers/mysql/qsql_mysql.cpp:1060
+msgctxt "QMYSQLResult"
+msgid "Unable to store statement results"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1770
-#, qt-format
-msgid ""
-"Element %1 is not allowed to have substitution group affiliation as it is no "
-"global element."
+#: sql/drivers/mysql/qsql_mysql.cpp:1287
+msgid "Unable to open database '"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1798
-#, qt-format
-msgid ""
-"Type of element %1 cannot be derived from type of substitution group "
-"affiliation."
+#: sql/drivers/sqlite2/qsql_sqlite2.cpp:149
+msgctxt "QSQLite2Result"
+msgid "Unable to fetch results"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1839
-#, qt-format
-msgid "Value constraint of attribute %1 is not of attributes type: %2."
+#: sql/drivers/sqlite2/qsql_sqlite2.cpp:299
+msgctxt "QSQLite2Result"
+msgid "Unable to execute statement"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1848
-#, qt-format
-msgid "Attribute %1 has value constraint but has type derived from %2."
+#: sql/drivers/tds/qsql_tds.cpp:595
+msgid "Unable to open connection"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1904
-#, qt-format
-msgid "%1 attribute in derived complex type must be %2 like in base type."
+#: sql/drivers/tds/qsql_tds.cpp:600
+msgid "Unable to use database"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1915
-#, qt-format
+#: sql/drivers/odbc/qsql_odbc.cpp:945 sql/drivers/odbc/qsql_odbc.cpp:1296
+msgctxt "QODBCResult"
 msgid ""
-"Attribute %1 in derived complex type must have %2 value constraint like in "
-"base type."
+"QODBCResult::reset: Unable to set 'SQL_CURSOR_STATIC' as statement "
+"attribute. Please check your ODBC driver configuration"
 msgstr ""
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1924
-#, qt-format
-msgid ""
-"Attribute %1 in derived complex type must have the same %2 value constraint "
-"like in base type."
-msgstr ""
+#: sql/drivers/odbc/qsql_odbc.cpp:962 sql/drivers/odbc/qsql_odbc.cpp:1589
+msgctxt "QODBCResult"
+msgid "Unable to execute statement"
+msgstr "عاجز عن تنفيذ الجملة"
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1931
-#, qt-format
-msgid "Attribute %1 in derived complex type must have %2 value constraint."
-msgstr ""
+#: sql/drivers/odbc/qsql_odbc.cpp:1021
+msgctxt "QODBCResult"
+msgid "Unable to fetch"
+msgstr "عاجز عن الجلب"
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1949
-msgid "processContent of base wildcard must be weaker than derived wildcard."
-msgstr ""
+#: sql/drivers/odbc/qsql_odbc.cpp:1043
+msgctxt "QODBCResult"
+msgid "Unable to fetch next"
+msgstr "عاجز عن جلب التالي"
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:1988
-#: xmlpatterns/schema/qxsdschemachecker.cpp:2003
-#, qt-format
-msgid "Element %1 exists twice with different types."
-msgstr ""
+#: sql/drivers/odbc/qsql_odbc.cpp:1065
+msgctxt "QODBCResult"
+msgid "Unable to fetch first"
+msgstr "عاجز عن جلب الأول"
 
-#: xmlpatterns/schema/qxsdschemachecker.cpp:2031
-msgid "Particle contains non-deterministic wildcards."
+#: sql/drivers/odbc/qsql_odbc.cpp:1084
+msgctxt "QODBCResult"
+msgid "Unable to fetch previous"
+msgstr "عاجز عن جلب السابق"
+
+#: sql/drivers/odbc/qsql_odbc.cpp:1314
+msgctxt "QODBCResult"
+msgid "Unable to prepare statement"
+msgstr "عاجز عن تحضير الجملة"
+
+#: sql/drivers/odbc/qsql_odbc.cpp:1581
+msgctxt "QODBCResult"
+msgid "Unable to bind variable"
+msgstr "عاجز عن ربط متغير"
+
+#: sql/drivers/odbc/qsql_odbc.cpp:1885
+msgid "Unable to connect - Driver doesn't support all functionality required"
 msgstr ""
 
-#: xmlpatterns/type/qtypechecker.cpp:63
-#, qt-format
-msgid "Required type is %1, but %2 was found."
+#: sql/drivers/odbc/qsql_odbc.cpp:2148
+msgid "Unable to disable autocommit"
+msgstr "عاجز عن تعطيل التسليم التلقائي"
+
+#: sql/drivers/odbc/qsql_odbc.cpp:2197
+msgid "Unable to enable autocommit"
+msgstr "عاجز عن تمكين التسليم التلقائي"
+
+#: sql/drivers/oci/qsql_oci.cpp:1315 sql/drivers/oci/qsql_oci.cpp:1509
+#: sql/drivers/oci/qsql_oci.cpp:1524
+msgctxt "QOCIResult"
+msgid "Unable to bind column for batch execute"
 msgstr ""
 
-#: xmlpatterns/type/qtypechecker.cpp:107
-#, qt-format
-msgid "Promoting %1 to %2 may cause loss of precision."
+#: sql/drivers/oci/qsql_oci.cpp:1539
+msgctxt "QOCIResult"
+msgid "Unable to execute batch statement"
 msgstr ""
 
-#: xmlpatterns/type/qtypechecker.cpp:156
-msgid "The focus is undefined."
+#: sql/drivers/oci/qsql_oci.cpp:1858
+msgctxt "QOCIResult"
+msgid "Unable to goto next"
 msgstr ""
 
-#: xmlpatterns/type/qcardinality.cpp:55
-msgid "empty"
+#: sql/drivers/oci/qsql_oci.cpp:1917
+msgctxt "QOCIResult"
+msgid "Unable to alloc statement"
 msgstr ""
 
-#: xmlpatterns/type/qcardinality.cpp:57
-msgid "zero or one"
+#: sql/drivers/oci/qsql_oci.cpp:1932
+msgctxt "QOCIResult"
+msgid "Unable to prepare statement"
 msgstr ""
 
-#: xmlpatterns/type/qcardinality.cpp:59
-msgid "exactly one"
+#: sql/drivers/oci/qsql_oci.cpp:1958
+msgctxt "QOCIResult"
+msgid "Unable to get statement type"
 msgstr ""
 
-#: xmlpatterns/type/qcardinality.cpp:61
-msgid "one or more"
+#: sql/drivers/oci/qsql_oci.cpp:1977
+msgctxt "QOCIResult"
+msgid "Unable to bind value"
 msgstr ""
 
-#: xmlpatterns/type/qcardinality.cpp:63
-msgid "zero or more"
+#: sql/drivers/oci/qsql_oci.cpp:1997
+msgctxt "QOCIResult"
+msgid "Unable to execute statement"
 msgstr ""
 
-#: xmlpatterns/utils/qoutputvalidator.cpp:86
-msgid "It's not possible to add attributes after any other kind of node."
+#: sql/drivers/oci/qsql_oci.cpp:2081
+msgctxt "QOCIDriver"
+msgid "Unable to initialize"
 msgstr ""
 
-#: xmlpatterns/utils/qoutputvalidator.cpp:93
-#, qt-format
-msgid "An attribute by name %1 has already been created."
+#: sql/drivers/oci/qsql_oci.cpp:2225
+msgid "Unable to logon"
 msgstr ""
 
-#: xmlpatterns/data/qabstractfloatmathematician.cpp:64
-#, qt-format
-msgid "No operand in an integer division, %1, can be %2."
+#: sql/drivers/oci/qsql_oci.cpp:2297
+msgctxt "QOCIDriver"
+msgid "Unable to begin transaction"
 msgstr ""
 
-#: xmlpatterns/data/qabstractfloatmathematician.cpp:71
-#, qt-format
-msgid ""
-"The first operand in an integer division, %1, cannot be infinity (%2)."
+#: sql/drivers/oci/qsql_oci.cpp:2316
+msgctxt "QOCIDriver"
+msgid "Unable to commit transaction"
 msgstr ""
 
-#: xmlpatterns/data/qabstractfloatmathematician.cpp:77
-#, qt-format
-msgid "The second operand in a division, %1, cannot be zero (%2)."
+#: sql/drivers/oci/qsql_oci.cpp:2335
+msgctxt "QOCIDriver"
+msgid "Unable to rollback transaction"
 msgstr ""
 
-#: xmlpatterns/data/qatomicmathematicians.cpp:65
-#, qt-format
-msgid "Integer division (%1) by zero (%2) is undefined."
+#: sql/drivers/sqlite/qsql_sqlite.cpp:204
+#: sql/drivers/sqlite/qsql_sqlite.cpp:268
+#: sql/drivers/sqlite/qsql_sqlite.cpp:276
+msgctxt "QSQLiteResult"
+msgid "Unable to fetch row"
 msgstr ""
 
-#: xmlpatterns/data/qatomicmathematicians.cpp:72
-#, qt-format
-msgid "Division (%1) by zero (%2) is undefined."
+#: sql/drivers/sqlite/qsql_sqlite.cpp:205
+msgctxt "QSQLiteResult"
+msgid "No query"
 msgstr ""
 
-#: xmlpatterns/data/qatomicmathematicians.cpp:79
-#, qt-format
-msgid "Modulus division (%1) by zero (%2) is undefined."
+#: sql/drivers/sqlite/qsql_sqlite.cpp:337
+msgctxt "QSQLiteResult"
+msgid "Unable to execute statement"
 msgstr ""
 
-#: xmlpatterns/data/qatomicmathematicians.cpp:202
-#: xmlpatterns/data/qatomicmathematicians.cpp:234
-#, qt-format
-msgid "Dividing a value of type %1 by %2 (not-a-number) is not allowed."
+#: sql/drivers/sqlite/qsql_sqlite.cpp:342
+msgctxt "QSQLiteResult"
+msgid "Unable to execute multiple statements at a time"
 msgstr ""
 
-#: xmlpatterns/data/qatomicmathematicians.cpp:214
-#, qt-format
-msgid ""
-"Dividing a value of type %1 by %2 or %3 (plus or minus zero) is not allowed."
+#: sql/drivers/sqlite/qsql_sqlite.cpp:362
+msgctxt "QSQLiteResult"
+msgid "Unable to reset statement"
 msgstr ""
 
-#: xmlpatterns/data/qatomicmathematicians.cpp:246
-#, qt-format
-msgid ""
-"Multiplication of a value of type %1 by %2 or %3 (plus or minus infinity) is "
-"not allowed."
+#: sql/drivers/sqlite/qsql_sqlite.cpp:407
+msgctxt "QSQLiteResult"
+msgid "Unable to bind parameters"
 msgstr ""
 
-#: xmlpatterns/data/qabstractduration.cpp:99
-#: xmlpatterns/data/qabstractduration.cpp:114
-msgid "At least one component must be present."
+#: sql/drivers/sqlite/qsql_sqlite.cpp:414
+msgctxt "QSQLiteResult"
+msgid "Parameter count mismatch"
 msgstr ""
 
-#: xmlpatterns/data/qabstractduration.cpp:107
-#, qt-format
-msgid "At least one time component must appear after the %1-delimiter."
+#: sql/drivers/sqlite/qsql_sqlite.cpp:557
+msgid "Error closing database"
 msgstr ""
 
-#: xmlpatterns/data/qatomicvalue.cpp:79
+#: imports/gestures/qdeclarativegesturearea.cpp:183
+#: declarative/qml/qdeclarativecompiler.cpp:1542
+#: declarative/qml/qdeclarativecompiler.cpp:1898
+#: declarative/qml/qdeclarativecompiler.cpp:1901
+#: declarative/util/qdeclarativepropertychanges.cpp:424
+#: declarative/util/qdeclarativeconnections.cpp:207
+#: declarative/util/qdeclarativeconnections.cpp:271
 #, qt-format
-msgid "A value of type %1 cannot have an Effective Boolean Value."
+msgid "Cannot assign to non-existent property \"%1\""
 msgstr ""
 
-#: xmlpatterns/data/qabstractdatetime.cpp:80
-#, qt-format
-msgid "Year %1 is invalid because it begins with %2."
+#: imports/gestures/qdeclarativegesturearea.cpp:193
+msgid "GestureArea: nested objects not allowed"
 msgstr ""
 
-#: xmlpatterns/data/qabstractdatetime.cpp:99
-#, qt-format
-msgid "Day %1 is outside the range %2..%3."
+#: imports/gestures/qdeclarativegesturearea.cpp:196
+msgid "GestureArea: syntax error"
 msgstr ""
 
-#: xmlpatterns/data/qabstractdatetime.cpp:106
-#, qt-format
-msgid "Month %1 is outside the range %2..%3."
+#: imports/gestures/qdeclarativegesturearea.cpp:205
+msgid "GestureArea: script expected"
 msgstr ""
 
-#: xmlpatterns/data/qabstractdatetime.cpp:117
+#: declarative/debugger/qjsdebuggeragent.cpp:119
 #, qt-format
-msgid "Overflow: Can't represent date %1."
+msgctxt "Debugger::JSAgentWatchData"
+msgid "[Array of length %1]"
 msgstr ""
 
-#: xmlpatterns/data/qabstractdatetime.cpp:125
-#, qt-format
-msgid "Day %1 is invalid for month %2."
+#: declarative/debugger/qjsdebuggeragent.cpp:121
+msgctxt "Debugger::JSAgentWatchData"
+msgid "<undefined>"
 msgstr ""
 
-#: xmlpatterns/data/qabstractdatetime.cpp:174
-#, qt-format
-msgid ""
-"Time 24:%1:%2.%3 is invalid. Hour is 24, but minutes, seconds, and "
-"milliseconds are not all 0; "
+#: declarative/qml/parser/qdeclarativejslexer.cpp:545
+#: declarative/qml/parser/qdeclarativejslexer.cpp:668
+#: declarative/qml/parser/qdeclarativejslexer.cpp:722
+msgctxt "QDeclarativeParser"
+msgid "Illegal unicode escape sequence"
 msgstr ""
 
-#: xmlpatterns/data/qabstractdatetime.cpp:187
-#, qt-format
-msgid "Time %1:%2:%3.%4 is invalid."
+#: declarative/qml/parser/qdeclarativejslexer.cpp:582
+msgctxt "QDeclarativeParser"
+msgid "Illegal character"
 msgstr ""
 
-#: xmlpatterns/data/qabstractdatetime.cpp:302
-msgid "Overflow: Date can't be represented."
+#: declarative/qml/parser/qdeclarativejslexer.cpp:596
+msgctxt "QDeclarativeParser"
+msgid "Unclosed string at end of line"
 msgstr ""
 
-#: xmlpatterns/data/qhexbinary.cpp:92
-#, qt-format
-msgid ""
-"A value of type %1 must contain an even number of digits. The value %2 does "
-"not."
+#: declarative/qml/parser/qdeclarativejslexer.cpp:622
+msgctxt "QDeclarativeParser"
+msgid "Illegal escape sequence"
 msgstr ""
 
-#: xmlpatterns/data/qhexbinary.cpp:111
-#, qt-format
-msgid "%1 is not valid as a value of type %2."
+#: declarative/qml/parser/qdeclarativejslexer.cpp:694
+msgctxt "QDeclarativeParser"
+msgid "Unclosed comment at end of file"
 msgstr ""
 
-#: xmlpatterns/data/qboolean.cpp:78
-msgid ""
-"Effective Boolean Value cannot be calculated for a sequence containing two "
-"or more atomic values."
+#: declarative/qml/parser/qdeclarativejslexer.cpp:796
+msgctxt "QDeclarativeParser"
+msgid "Illegal syntax for exponential number"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/tests/qwebframe/tst_qwebframe.cpp:2321
-msgid "Fake error!"
+#: declarative/qml/parser/qdeclarativejslexer.cpp:822
+msgctxt "QDeclarativeParser"
+msgid "Identifier cannot start with numeric literal"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/tests/qwebframe/tst_qwebframe.cpp:2326
-#: 3rdparty/phonon/mmf/utils.cpp:134
-msgid "Invalid URL"
+#: declarative/qml/parser/qdeclarativejslexer.cpp:1160
+msgctxt "QDeclarativeParser"
+msgid "Unterminated regular expression literal"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/InspectorClientQt.cpp:372
+#: declarative/qml/parser/qdeclarativejslexer.cpp:1175
 #, qt-format
-msgctxt "QWebPage"
-msgid "Web Inspector - %2"
+msgctxt "QDeclarativeParser"
+msgid "Invalid regular expression flag '%0'"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:152
-msgctxt ""
-"Submit (input element) alt text for <input> elements with no alt, title, or "
-"value"
-msgid "Submit"
-msgstr "سلّم"
-
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:157
-msgctxt "default label for Reset buttons in forms on web pages"
-msgid "Reset"
-msgstr "أعد الضبط"
-
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:162
-msgctxt ""
-"text that appears at the start of nearly-obsolete web pages in the form of a "
-"'searchable index'"
-msgid "This is a searchable index. Enter search keywords: "
+#: declarative/qml/parser/qdeclarativejslexer.cpp:1191
+#: declarative/qml/parser/qdeclarativejslexer.cpp:1213
+msgctxt "QDeclarativeParser"
+msgid "Unterminated regular expression backslash sequence"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:167
-msgctxt "default label for Submit buttons in forms on web pages"
-msgid "Submit"
-msgstr "سلّم"
-
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:172
-msgctxt "title for file button used in HTML forms"
-msgid "Choose File"
-msgstr "اختر ملف"
-
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:177
-msgctxt ""
-"text to display in file button used in HTML forms when no file is selected"
-msgid "No file selected"
-msgstr "لم يختر ملف"
-
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:182
-msgctxt "text to display in <details> tag when it has no <summary> child"
-msgid "Details"
+#: declarative/qml/parser/qdeclarativejslexer.cpp:1226
+msgctxt "QDeclarativeParser"
+msgid "Unterminated regular expression class"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:187
-msgctxt "Open in New Window context menu item"
-msgid "Open in New Window"
-msgstr "افتح في نافذة جديدة"
-
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:192
-msgctxt "Download Linked File context menu item"
-msgid "Save Link..."
-msgstr "احفظ الوصلة..."
-
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:197
-msgctxt "Copy Link context menu item"
-msgid "Copy Link"
-msgstr "انسخ الوصلة"
+#: declarative/qml/parser/qdeclarativejsparser.cpp:1828
+#: declarative/qml/parser/qdeclarativejsparser.cpp:1895
+msgctxt "QDeclarativeParser"
+msgid "Syntax error"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:202
-msgctxt "Open Image in New Window context menu item"
-msgid "Open Image"
-msgstr "افتح الصورة"
+#: declarative/qml/parser/qdeclarativejsparser.cpp:1830
+#, qt-format
+msgctxt "QDeclarativeParser"
+msgid "Unexpected token `%1'"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:207
-msgctxt "Download Image context menu item"
-msgid "Save Image"
-msgstr "احفظ الصورة"
+#: declarative/qml/parser/qdeclarativejsparser.cpp:1858
+#: declarative/qml/parser/qdeclarativejsparser.cpp:1882
+#, qt-format
+msgctxt "QDeclarativeParser"
+msgid "Expected token `%1'"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:212
-msgctxt "Copy Link context menu item"
-msgid "Copy Image"
-msgstr "انسخ الصورة"
+#: declarative/qml/qdeclarativebinding.cpp:459
+#, qt-format
+msgid "Binding loop detected for property \"%1\""
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:217
-msgctxt "Copy Image Address menu item"
-msgid "Copy Image Address"
+#: declarative/qml/qdeclarativetypeloader.cpp:919
+#, qt-format
+msgid "Script %1 unavailable"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:222
-msgctxt "Open Video in New Window"
-msgid "Open Video"
+#: declarative/qml/qdeclarativetypeloader.cpp:937
+#, qt-format
+msgid "Type %1 unavailable"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:227
-msgctxt "Open Audio in New Window"
-msgid "Open Audio"
+#: declarative/qml/qdeclarativetypeloader.cpp:1113
+#, qt-format
+msgid "Namespace %1 cannot be used as a type"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:232
-msgctxt "Copy Video Link Location"
-msgid "Copy Video"
+#: declarative/qml/qdeclarativetypeloader.cpp:1115
+#, qt-format
+msgid "%1 %2"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:237
-msgctxt "Copy Audio Link Location"
-msgid "Copy Audio"
+#: declarative/qml/qdeclarativesqldatabase.cpp:211
+msgid "executeSql called outside transaction()"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:242
-msgctxt "Toggle Media Controls"
-msgid "Toggle Controls"
+#: declarative/qml/qdeclarativesqldatabase.cpp:269
+msgid "Read-only Transaction"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:247
-msgctxt "Toggle Media Loop Playback"
-msgid "Toggle Loop"
+#: declarative/qml/qdeclarativesqldatabase.cpp:289
+#, qt-format
+msgid "Version mismatch: expected %1, found %2"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:252
-msgctxt "Switch Video to Fullscreen"
-msgid "Enter Fullscreen"
+#: declarative/qml/qdeclarativesqldatabase.cpp:303
+msgid "SQL transaction failed"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:257
-msgctxt "Play"
-msgid "Play"
+#: declarative/qml/qdeclarativesqldatabase.cpp:326
+msgid "transaction: missing callback"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:262
-msgctxt "Pause"
-msgid "Pause"
+#: declarative/qml/qdeclarativesqldatabase.cpp:386
+#: declarative/qml/qdeclarativesqldatabase.cpp:401
+msgid "SQL: database version mismatch"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:267
-msgctxt "Mute"
-msgid "Mute"
+#: declarative/qml/qdeclarativecompiler.cpp:185
+#: declarative/qml/qdeclarativecompiler.cpp:1853
+#: declarative/qml/qdeclarativecompiler.cpp:2058
+#: declarative/qml/qdeclarativecompiler.cpp:2139
+#: declarative/qml/qdeclarativecompiler.cpp:2214
+#: declarative/qml/qdeclarativecompiler.cpp:2796
+#, qt-format
+msgid "Invalid property assignment: \"%1\" is a read-only property"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:272
-msgctxt "Open Frame in New Window context menu item"
-msgid "Open Frame"
-msgstr "افتح الإطار"
+#: declarative/qml/qdeclarativecompiler.cpp:194
+msgid "Invalid property assignment: unknown enumeration"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:277
-msgctxt "Copy context menu item"
-msgid "Copy"
-msgstr "انسخ"
+#: declarative/qml/qdeclarativecompiler.cpp:202
+msgid "Invalid property assignment: string expected"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:282
-msgctxt "Back context menu item"
-msgid "Go Back"
-msgstr "إرجع للخلف"
+#: declarative/qml/qdeclarativecompiler.cpp:205
+msgid "Invalid property assignment: url expected"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:287
-msgctxt "Forward context menu item"
-msgid "Go Forward"
-msgstr "إذهب للأمام"
+#: declarative/qml/qdeclarativecompiler.cpp:215
+msgid "Invalid property assignment: unsigned int expected"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:292
-msgctxt "Stop context menu item"
-msgid "Stop"
-msgstr "قف"
+#: declarative/qml/qdeclarativecompiler.cpp:226
+msgid "Invalid property assignment: int expected"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:297
-msgctxt "Reload context menu item"
-msgid "Reload"
-msgstr "أعد التحميل"
+#: declarative/qml/qdeclarativecompiler.cpp:230
+#: declarative/qml/qdeclarativecompiler.cpp:233
+msgid "Invalid property assignment: number expected"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:302
-msgctxt "Cut context menu item"
-msgid "Cut"
-msgstr "قص"
+#: declarative/qml/qdeclarativecompiler.cpp:239
+msgid "Invalid property assignment: color expected"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:307
-msgctxt "Paste context menu item"
-msgid "Paste"
-msgstr "الصق"
+#: declarative/qml/qdeclarativecompiler.cpp:247
+msgid "Invalid property assignment: date expected"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:312
-msgctxt "Select All context menu item"
-msgid "Select All"
+#: declarative/qml/qdeclarativecompiler.cpp:254
+msgid "Invalid property assignment: time expected"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:317
-msgctxt "No Guesses Found context menu item"
-msgid "No Guesses Found"
-msgstr "لم يجد تخمينات"
+#: declarative/qml/qdeclarativecompiler.cpp:261
+msgid "Invalid property assignment: datetime expected"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:322
-msgctxt "Ignore Spelling context menu item"
-msgid "Ignore"
-msgstr "تجاهل"
+#: declarative/qml/qdeclarativecompiler.cpp:270
+msgid "Invalid property assignment: point expected"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:327
-msgctxt "Learn Spelling context menu item"
-msgid "Add To Dictionary"
-msgstr "أضف إلى القاموس"
+#: declarative/qml/qdeclarativecompiler.cpp:278
+msgid "Invalid property assignment: size expected"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:332
-msgctxt "Search The Web context menu item"
-msgid "Search The Web"
-msgstr "ابحث في الويب"
+#: declarative/qml/qdeclarativecompiler.cpp:286
+msgid "Invalid property assignment: rect expected"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:337
-msgctxt "Look Up in Dictionary context menu item"
-msgid "Look Up In Dictionary"
-msgstr "ابحث في القاموس"
+#: declarative/qml/qdeclarativecompiler.cpp:291
+msgid "Invalid property assignment: boolean expected"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:342
-msgctxt "Open Link context menu item"
-msgid "Open Link"
-msgstr "افتح الوصلة"
+#: declarative/qml/qdeclarativecompiler.cpp:298
+msgid "Invalid property assignment: 3D vector expected"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:347
-msgctxt "Ignore Grammar context menu item"
-msgid "Ignore"
-msgstr "تجاهل"
+#: declarative/qml/qdeclarativecompiler.cpp:307
+#, qt-format
+msgid "Invalid property assignment: unsupported type \"%1\""
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:352
-msgctxt "Spelling and Grammar context sub-menu item"
-msgid "Spelling"
-msgstr "الإملاء"
+#: declarative/qml/qdeclarativecompiler.cpp:589
+msgid "Element is not creatable."
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:357
-msgctxt "menu item title"
-msgid "Show Spelling and Grammar"
-msgstr "أظهر الإملاء و القواعد"
+#: declarative/qml/qdeclarativecompiler.cpp:1239
+msgid "Component elements may not contain properties other than id"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:358
-msgctxt "menu item title"
-msgid "Hide Spelling and Grammar"
-msgstr "أخف الإملاء و القواعد"
+#: declarative/qml/qdeclarativecompiler.cpp:1246
+msgid "Invalid component id specification"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:363
-msgctxt "Check spelling context menu item"
-msgid "Check Spelling"
-msgstr "دقق إملائيا"
+#: declarative/qml/qdeclarativecompiler.cpp:1252
+#: declarative/qml/qdeclarativecompiler.cpp:1767
+msgid "id is not unique"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:368
-msgctxt "Check spelling while typing context menu item"
-msgid "Check Spelling While Typing"
-msgstr "دقق الإملاء أثناء الكتابة"
+#: declarative/qml/qdeclarativecompiler.cpp:1262
+msgid "Invalid component body specification"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:373
-msgctxt "Check grammar with spelling context menu item"
-msgid "Check Grammar With Spelling"
-msgstr "دقق القواعد مع الإملاء"
+#: declarative/qml/qdeclarativecompiler.cpp:1265
+msgid "Component objects cannot declare new properties."
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:378
-msgctxt "Font context sub-menu item"
-msgid "Fonts"
-msgstr "الخطوط"
+#: declarative/qml/qdeclarativecompiler.cpp:1267
+msgid "Component objects cannot declare new signals."
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:383
-msgctxt "Bold context menu item"
-msgid "Bold"
-msgstr "عريض"
+#: declarative/qml/qdeclarativecompiler.cpp:1269
+msgid "Component objects cannot declare new functions."
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:388
-msgctxt "Italic context menu item"
-msgid "Italic"
-msgstr "مائل"
+#: declarative/qml/qdeclarativecompiler.cpp:1276
+msgid "Cannot create empty component specification"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:393
-msgctxt "Underline context menu item"
-msgid "Underline"
-msgstr "مسطر"
+#: declarative/qml/qdeclarativecompiler.cpp:1364
+#: declarative/qml/qdeclarativecompiler.cpp:1485
+#, qt-format
+msgid "\"%1.%2\" is not available in %3 %4.%5."
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:398
-msgctxt "Outline context menu item"
-msgid "Outline"
-msgstr "مجسم"
+#: declarative/qml/qdeclarativecompiler.cpp:1366
+#: declarative/qml/qdeclarativecompiler.cpp:1487
+#, qt-format
+msgid "\"%1.%2\" is not available due to component versioning."
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:403
-msgctxt "Writing direction context sub-menu item"
-msgid "Direction"
-msgstr "الإتجاه"
+#: declarative/qml/qdeclarativecompiler.cpp:1377
+msgid "Incorrectly specified signal assignment"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:408
-msgctxt "Text direction context sub-menu item"
-msgid "Text Direction"
+#: declarative/qml/qdeclarativecompiler.cpp:1389
+msgid "Cannot assign a value to a signal (expecting a script to be run)"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:413
-msgctxt "Default writing direction context menu item"
-msgid "Default"
-msgstr "الافتراضي"
+#: declarative/qml/qdeclarativecompiler.cpp:1393
+msgid "Empty signal assignment"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:418
-msgctxt "Left to Right context menu item"
-msgid "Left to Right"
+#: declarative/qml/qdeclarativecompiler.cpp:1431
+msgid "Empty property assignment"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:423
-msgctxt "Right to Left context menu item"
-msgid "Right to Left"
+#: declarative/qml/qdeclarativecompiler.cpp:1443
+msgid "Attached properties cannot be used here"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:428
-msgctxt "Inspect Element context menu item"
-msgid "Inspect"
-msgstr "تحرى"
+#: declarative/qml/qdeclarativecompiler.cpp:1457
+#: declarative/qml/qdeclarativecompiler.cpp:1585
+msgid "Non-existent attached object"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:433
-msgctxt ""
-"Label for only item in menu that appears when clicking on the search field "
-"image, when no searches have been performed"
-msgid "No recent searches"
+#: declarative/qml/qdeclarativecompiler.cpp:1461
+#: declarative/qml/qdeclarativecompiler.cpp:1588
+msgid "Invalid attached object assignment"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:438
-msgctxt ""
-"label for first item in the menu that appears when clicking on the search "
-"field image, used as embedded menu title"
-msgid "Recent searches"
+#: declarative/qml/qdeclarativecompiler.cpp:1540
+msgid "Cannot assign to non-existent default property"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:443
-msgctxt "menu item in Recent Searches menu that empties menu's contents"
-msgid "Clear recent searches"
+#: declarative/qml/qdeclarativecompiler.cpp:1572
+msgid "Invalid use of namespace"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:538
-msgctxt "Label text to be used when a plug-in is missing"
-msgid "Missing Plug-in"
+#: declarative/qml/qdeclarativecompiler.cpp:1577
+msgid "Not an attached property name"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:555
-msgctxt "Unknown filesize FTP directory listing item"
-msgid "Unknown"
-msgstr "مجهول"
+#: declarative/qml/qdeclarativecompiler.cpp:1759
+msgid "Invalid use of id property"
+msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:560
-#, qt-format
-msgctxt "Title string for images"
-msgid "%1 (%2x%3 pixels)"
+#: declarative/qml/qdeclarativecompiler.cpp:1846
+#: declarative/qml/qdeclarativecompiler.cpp:1848
+msgid "Property has already been assigned a value"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:565
-msgctxt "Media controller status message when the media is loading"
-msgid "Loading..."
+#: declarative/qml/qdeclarativecompiler.cpp:1866
+#: declarative/qml/qdeclarativecompiler.cpp:1873
+msgid "Invalid grouped property access"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:570
-msgctxt "Media controller status message when watching a live broadcast"
-msgid "Live Broadcast"
+#: declarative/qml/qdeclarativecompiler.cpp:1876
+msgid "Cannot assign a value directly to a grouped property"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:578
-msgctxt "Media controller element"
-msgid "Audio Element"
+#: declarative/qml/qdeclarativecompiler.cpp:1892
+msgid "Invalid property use"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:580
-msgctxt "Media controller element"
-msgid "Video Element"
+#: declarative/qml/qdeclarativecompiler.cpp:1907
+msgid "Property assignment expected"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:582
-msgctxt "Media controller element"
-msgid "Mute Button"
+#: declarative/qml/qdeclarativecompiler.cpp:1910
+msgid "Single property assignment expected"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:584
-msgctxt "Media controller element"
-msgid "Unmute Button"
+#: declarative/qml/qdeclarativecompiler.cpp:1915
+msgid "Unexpected object assignment"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:586
-msgctxt "Media controller element"
-msgid "Play Button"
+#: declarative/qml/qdeclarativecompiler.cpp:1980
+msgid "Cannot assign object to list"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:588
-msgctxt "Media controller element"
-msgid "Pause Button"
+#: declarative/qml/qdeclarativecompiler.cpp:1986
+msgid "Can only assign one binding to lists"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:590
-msgctxt "Media controller element"
-msgid "Slider"
+#: declarative/qml/qdeclarativecompiler.cpp:1992
+msgid "Cannot assign primitives to lists"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:592
-msgctxt "Media controller element"
-msgid "Slider Thumb"
+#: declarative/qml/qdeclarativecompiler.cpp:2005
+msgid "Cannot assign multiple values to a script property"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:594
-msgctxt "Media controller element"
-msgid "Rewind Button"
+#: declarative/qml/qdeclarativecompiler.cpp:2008
+msgid "Invalid property assignment: script expected"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:596
-msgctxt "Media controller element"
-msgid "Return to Real-time Button"
+#: declarative/qml/qdeclarativecompiler.cpp:2023
+msgid "Cannot assign multiple values to a singular property"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:598
-msgctxt "Media controller element"
-msgid "Elapsed Time"
+#: declarative/qml/qdeclarativecompiler.cpp:2116
+msgid "Cannot assign object to property"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:600
-msgctxt "Media controller element"
-msgid "Remaining Time"
+#: declarative/qml/qdeclarativecompiler.cpp:2166
+#, qt-format
+msgid "\"%1\" cannot operate on \"%2\""
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:602
-msgctxt "Media controller element"
-msgid "Status Display"
+#: declarative/qml/qdeclarativecompiler.cpp:2330
+msgid "Duplicate default property"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:604
-msgctxt "Media controller element"
-msgid "Fullscreen Button"
+#: declarative/qml/qdeclarativecompiler.cpp:2335
+msgid "Duplicate property name"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:606
-msgctxt "Media controller element"
-msgid "Seek Forward Button"
+#: declarative/qml/qdeclarativecompiler.cpp:2339
+msgid "Property names cannot begin with an upper case letter"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:608
-msgctxt "Media controller element"
-msgid "Seek Back Button"
+#: declarative/qml/qdeclarativecompiler.cpp:2342
+msgid "Illegal property name"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:616
-msgctxt "Media controller element"
-msgid "Audio element playback controls and status display"
+#: declarative/qml/qdeclarativecompiler.cpp:2350
+msgid "Duplicate signal name"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:618
-msgctxt "Media controller element"
-msgid "Video element playback controls and status display"
+#: declarative/qml/qdeclarativecompiler.cpp:2353
+msgid "Signal names cannot begin with an upper case letter"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:620
-msgctxt "Media controller element"
-msgid "Mute audio tracks"
+#: declarative/qml/qdeclarativecompiler.cpp:2355
+msgid "Illegal signal name"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:622
-msgctxt "Media controller element"
-msgid "Unmute audio tracks"
+#: declarative/qml/qdeclarativecompiler.cpp:2361
+msgid "Duplicate method name"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:624
-msgctxt "Media controller element"
-msgid "Begin playback"
+#: declarative/qml/qdeclarativecompiler.cpp:2364
+msgid "Method names cannot begin with an upper case letter"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:626
-msgctxt "Media controller element"
-msgid "Pause playback"
+#: declarative/qml/qdeclarativecompiler.cpp:2366
+msgid "Illegal method name"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:628
-msgctxt "Media controller element"
-msgid "Movie time scrubber"
+#: declarative/qml/qdeclarativecompiler.cpp:2387
+msgid "Property value set multiple times"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:630
-msgctxt "Media controller element"
-msgid "Movie time scrubber thumb"
+#: declarative/qml/qdeclarativecompiler.cpp:2391
+msgid "Invalid property nesting"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:632
-msgctxt "Media controller element"
-msgid "Rewind movie"
+#: declarative/qml/qdeclarativecompiler.cpp:2443
+msgid "Cannot override FINAL property"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:634
-msgctxt "Media controller element"
-msgid "Return streaming movie to real-time"
+#: declarative/qml/qdeclarativecompiler.cpp:2466
+msgid "Invalid property type"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:636
-msgctxt "Media controller element"
-msgid "Current movie time"
+#: declarative/qml/qdeclarativecompiler.cpp:2643
+msgid "Invalid empty ID"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:638
-msgctxt "Media controller element"
-msgid "Remaining movie time"
+#: declarative/qml/qdeclarativecompiler.cpp:2646
+msgid "IDs cannot start with an uppercase letter"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:640
-msgctxt "Media controller element"
-msgid "Current movie status"
+#: declarative/qml/qdeclarativecompiler.cpp:2652
+msgid "IDs must start with a letter or underscore"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:642
-msgctxt "Media controller element"
-msgid "Play movie in full-screen mode"
+#: declarative/qml/qdeclarativecompiler.cpp:2654
+msgid "IDs must contain only letters, numbers, and underscores"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:644
-msgctxt "Media controller element"
-msgid "Seek quickly back"
+#: declarative/qml/qdeclarativecompiler.cpp:2660
+msgid "ID illegally masks global JavaScript property"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:646
-msgctxt "Media controller element"
-msgid "Seek quickly forward"
+#: declarative/qml/qdeclarativecompiler.cpp:2691
+#: declarative/qml/qdeclarativecompiler.cpp:2700
+msgid "No property alias location"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:655
-msgctxt "Media time description"
-msgid "Indefinite time"
+#: declarative/qml/qdeclarativecompiler.cpp:2696
+#: declarative/qml/qdeclarativecompiler.cpp:2721
+#: declarative/qml/qdeclarativecompiler.cpp:2728
+#: declarative/qml/qdeclarativecompiler.cpp:2735
+#: declarative/qml/qdeclarativecompiler.cpp:2741
+msgid "Invalid alias location"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:664
-#, qt-format
-msgctxt "Media time description"
-msgid "%1 days %2 hours %3 minutes %4 seconds"
+#: declarative/qml/qdeclarativecompiler.cpp:2705
+msgid ""
+"Invalid alias reference. An alias reference must be specified as <id>, "
+"<id>.<property> or <id>.<value property>.<property>"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:667
+#: declarative/qml/qdeclarativecompiler.cpp:2708
 #, qt-format
-msgctxt "Media time description"
-msgid "%1 hours %2 minutes %3 seconds"
+msgid "Invalid alias reference. Unable to find id \"%1\""
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:670
-#, qt-format
-msgctxt "Media time description"
-msgid "%1 minutes %2 seconds"
+#: declarative/qml/qdeclarativecompiler.cpp:2723
+msgid "Alias property exceeds alias bounds"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/WebPlatformStrategies.cpp:672
+#: declarative/qml/qdeclarativevme.cpp:231
 #, qt-format
-msgctxt "Media time description"
-msgid "%1 seconds"
+msgctxt "QDeclarativeVME"
+msgid "Unable to create object of type %1"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/QtMaemoWebPopup.cpp:129
-msgid "weba_ti_texlist_single"
+#: declarative/qml/qdeclarativevme.cpp:672
+#, qt-format
+msgctxt "QDeclarativeVME"
+msgid "Cannot assign value %1 to property %2"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/QtMaemoWebPopup.cpp:176
-msgid "weba_ti_textlist_multi"
+#: declarative/qml/qdeclarativevme.cpp:694
+#, qt-format
+msgctxt "QDeclarativeVME"
+msgid "Cannot assign object type %1 with no default method"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/WebCoreSupport/QtMaemoWebPopup.cpp:202
-msgid "wdgt_bd_done"
+#: declarative/qml/qdeclarativevme.cpp:697
+#, qt-format
+msgctxt "QDeclarativeVME"
+msgid "Cannot connect mismatched signal/slot %1 %vs. %2"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2114
+#: declarative/qml/qdeclarativevme.cpp:702
 #, qt-format
-msgid "JavaScript Alert - %1"
+msgctxt "QDeclarativeVME"
+msgid "Cannot assign an object to signal property %1"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2131
-#, qt-format
-msgid "JavaScript Confirm - %1"
+#: declarative/qml/qdeclarativevme.cpp:856
+msgctxt "QDeclarativeVME"
+msgid "Cannot assign object to list"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2151
-#, qt-format
-msgid "JavaScript Prompt - %1"
+#: declarative/qml/qdeclarativevme.cpp:899
+msgctxt "QDeclarativeVME"
+msgid "Cannot assign object to interface property"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2177
-#, qt-format
-msgid "JavaScript Problem - %1"
+#: declarative/qml/qdeclarativevme.cpp:910
+msgctxt "QDeclarativeVME"
+msgid "Unable to create attached object"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2177
-msgid ""
-"The script on this page appears to have a problem. Do you want to stop the "
-"script?"
+#: declarative/qml/qdeclarativevme.cpp:942
+#, qt-format
+msgctxt "QDeclarativeVME"
+msgid "Cannot set properties on %1 as it is null"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2826
-msgid "Move the cursor to the next character"
+#: declarative/qml/qdeclarativescriptparser.cpp:254
+#: declarative/qml/qdeclarativescriptparser.cpp:683
+#: declarative/qml/qdeclarativescriptparser.cpp:742
+msgctxt "QDeclarativeParser"
+msgid "Property value set multiple times"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2829
-msgid "Move the cursor to the previous character"
+#: declarative/qml/qdeclarativescriptparser.cpp:265
+msgctxt "QDeclarativeParser"
+msgid "Expected type name"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2832
-msgid "Move the cursor to the next word"
+#: declarative/qml/qdeclarativescriptparser.cpp:399
+msgctxt "QDeclarativeParser"
+msgid "Invalid import qualifier ID"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2835
-msgid "Move the cursor to the previous word"
+#: declarative/qml/qdeclarativescriptparser.cpp:407
+msgctxt "QDeclarativeParser"
+msgid "Reserved name \"Qt\" cannot be used as an qualifier"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2838
-msgid "Move the cursor to the next line"
+#: declarative/qml/qdeclarativescriptparser.cpp:422
+msgctxt "QDeclarativeParser"
+msgid "Script import qualifiers must be unique."
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2841
-msgid "Move the cursor to the previous line"
+#: declarative/qml/qdeclarativescriptparser.cpp:432
+msgctxt "QDeclarativeParser"
+msgid "Script import requires a qualifier"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2844
-msgid "Move the cursor to the start of the line"
+#: declarative/qml/qdeclarativescriptparser.cpp:443
+msgctxt "QDeclarativeParser"
+msgid "Library import requires a version"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2847
-msgid "Move the cursor to the end of the line"
+#: declarative/qml/qdeclarativescriptparser.cpp:502
+msgctxt "QDeclarativeParser"
+msgid "Expected parameter type"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2850
-msgid "Move the cursor to the start of the block"
+#: declarative/qml/qdeclarativescriptparser.cpp:544
+msgctxt "QDeclarativeParser"
+msgid "Invalid property type modifier"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2853
-msgid "Move the cursor to the end of the block"
+#: declarative/qml/qdeclarativescriptparser.cpp:553
+msgctxt "QDeclarativeParser"
+msgid "Unexpected property type modifier"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2856
-msgid "Move the cursor to the start of the document"
+#: declarative/qml/qdeclarativescriptparser.cpp:562
+msgctxt "QDeclarativeParser"
+msgid "Expected property type"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2859
-msgid "Move the cursor to the end of the document"
+#: declarative/qml/qdeclarativescriptparser.cpp:571
+msgctxt "QDeclarativeParser"
+msgid "Readonly not yet supported"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2862
-msgid "Select to the next character"
+#: declarative/qml/qdeclarativescriptparser.cpp:789
+msgctxt "QDeclarativeParser"
+msgid "JavaScript declaration outside Script element"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2865
-msgid "Select to the previous character"
+#: declarative/qml/qdeclarativeimport.cpp:390
+#, qt-format
+msgid "plugin cannot be loaded for module \"%1\": %2"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2868
-msgid "Select to the next word"
+#: declarative/qml/qdeclarativeimport.cpp:395
+#, qt-format
+msgid "module \"%1\" plugin \"%2\" not found"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2871
-msgid "Select to the previous word"
+#: declarative/qml/qdeclarativeimport.cpp:529
+#: declarative/qml/qdeclarativeimport.cpp:597
+#, qt-format
+msgid "module \"%1\" version %2.%3 is not installed"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2874
-msgid "Select to the next line"
+#: declarative/qml/qdeclarativeimport.cpp:531
+#, qt-format
+msgid "module \"%1\" is not installed"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2877
-msgid "Select to the previous line"
+#: declarative/qml/qdeclarativeimport.cpp:545
+#: declarative/qml/qdeclarativeimport.cpp:565
+#, qt-format
+msgid "\"%1\": no such directory"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2880
-msgid "Select to the start of the line"
+#: declarative/qml/qdeclarativeimport.cpp:563
+#, qt-format
+msgid "import \"%1\" has no qmldir and no namespace"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2883
-msgid "Select to the end of the line"
+#: declarative/qml/qdeclarativeimport.cpp:622
+#, qt-format
+msgid "- %1 is not a namespace"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2886
-msgid "Select to the start of the block"
+#: declarative/qml/qdeclarativeimport.cpp:628
+msgid "- nested namespaces not allowed"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2889
-msgid "Select to the end of the block"
+#: declarative/qml/qdeclarativeimport.cpp:675
+#: declarative/qml/qdeclarativeimport.cpp:679
+msgid "local directory"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2892
-msgid "Select to the start of the document"
+#: declarative/qml/qdeclarativeimport.cpp:685
+#, qt-format
+msgid "is ambiguous. Found in %1 and in %2"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2895
-msgid "Select to the end of the document"
+#: declarative/qml/qdeclarativeimport.cpp:689
+#, qt-format
+msgid "is ambiguous. Found in %1 in version %2.%3 and %4.%5"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2898
-msgid "Delete to the start of the word"
+#: declarative/qml/qdeclarativeimport.cpp:703
+msgid "is instantiated recursively"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2901
-msgid "Delete to the end of the word"
+#: declarative/qml/qdeclarativeimport.cpp:705
+msgid "is not a type"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2934
-msgid "Insert a new paragraph"
+#: declarative/qml/qdeclarativeimport.cpp:1041
+#, qt-format
+msgid "File name case mismatch for \"%1\""
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2937
-msgid "Insert a new line"
+#: declarative/qml/qdeclarativecompiledbindings.cpp:396
+#, qt-format
+msgctxt "QDeclarativeCompiledBindings"
+msgid "Binding loop detected for property \"%1\""
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2941
-msgid "Paste and Match Style"
+#: declarative/qml/qdeclarativecomponent.cpp:531
+msgid "Invalid empty URL"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2944
-msgid "Remove formatting"
+#: declarative/qml/qdeclarativecomponent.cpp:679
+msgid "createObject: value is not an object"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2948
-msgid "Strikethrough"
+#: declarative/util/qdeclarativepropertychanges.cpp:256
+msgid "PropertyChanges does not support creating state-specific objects."
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2952
-msgid "Subscript"
+#: declarative/util/qdeclarativepropertychanges.cpp:427
+#, qt-format
+msgid "Cannot assign to read-only property \"%1\""
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2956
-msgid "Superscript"
+#: declarative/util/qdeclarativeanimation.cpp:173
+#, qt-format
+msgid "Cannot animate non-existent property \"%1\""
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2960
-msgid "Insert Bulleted List"
+#: declarative/util/qdeclarativeanimation.cpp:176
+#, qt-format
+msgid "Cannot animate read-only property \"%1\""
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2964
-msgid "Insert Numbered List"
+#: declarative/util/qdeclarativeanimation.cpp:618
+#: declarative/util/qdeclarativeanimation.cpp:1856
+#: declarative/util/qdeclarativeanimation.cpp:2876
+msgid "Cannot set a duration of < 0"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2968
-msgid "Indent"
+#: declarative/util/qdeclarativeanimation.cpp:2708
+#: declarative/util/qdeclarativestateoperations.cpp:103
+msgid "Unable to preserve appearance under complex transform"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2971
-msgid "Outdent"
+#: declarative/util/qdeclarativeanimation.cpp:2719
+#: declarative/util/qdeclarativeanimation.cpp:2726
+#: declarative/util/qdeclarativestateoperations.cpp:114
+#: declarative/util/qdeclarativestateoperations.cpp:121
+msgid "Unable to preserve appearance under non-uniform scale"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2974
-msgid "Center"
+#: declarative/util/qdeclarativeanimation.cpp:2733
+#: declarative/util/qdeclarativestateoperations.cpp:128
+msgid "Unable to preserve appearance under scale of 0"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2977
-msgid "Justify"
+#: declarative/util/qdeclarativelistmodel.cpp:392
+#, qt-format
+msgid "remove: index %1 out of range"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2980
-msgid "Align Left"
+#: declarative/util/qdeclarativelistmodel.cpp:425
+msgid "insert: value is not an object"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebKit/qt/Api/qwebpage.cpp:2983
-msgid "Align Right"
+#: declarative/util/qdeclarativelistmodel.cpp:430
+#, qt-format
+msgid "insert: index %1 out of range"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebCore/platform/network/qt/QNetworkReplyHandler.cpp:540
-msgctxt "QWebPage"
-msgid "Redirection limit reached"
+#: declarative/util/qdeclarativelistmodel.cpp:460
+msgid "move: out of range"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:59
-msgctxt "QWebPage"
-msgid "Scroll here"
+#: declarative/util/qdeclarativelistmodel.cpp:500
+msgid "append: value is not an object"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:62
-msgctxt "QWebPage"
-msgid "Left edge"
+#: declarative/util/qdeclarativelistmodel.cpp:571
+msgid "set: value is not an object"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:62
-msgctxt "QWebPage"
-msgid "Top"
+#: declarative/util/qdeclarativelistmodel.cpp:575
+#: declarative/util/qdeclarativelistmodel.cpp:613
+#, qt-format
+msgid "set: index %1 out of range"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:63
-msgctxt "QWebPage"
-msgid "Right edge"
+#: declarative/util/qdeclarativelistmodel.cpp:650
+#: declarative/util/qdeclarativelistmodel.cpp:667
+msgid "ListElement: cannot contain nested elements"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:63
-msgctxt "QWebPage"
-msgid "Bottom"
+#: declarative/util/qdeclarativelistmodel.cpp:671
+msgid "ListElement: cannot use reserved \"id\" property"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:66
-msgctxt "QWebPage"
-msgid "Page left"
+#: declarative/util/qdeclarativelistmodel.cpp:724
+msgid "ListElement: cannot use script for property value"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:66
-msgctxt "QWebPage"
-msgid "Page up"
+#: declarative/util/qdeclarativelistmodel.cpp:755
+#, qt-format
+msgid "ListModel: undefined property '%1'"
+msgstr ""
+
+#: declarative/util/qdeclarativepixmapcache.cpp:311
+#, qt-format
+msgid "Error decoding: %1: %2"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:67
-msgctxt "QWebPage"
-msgid "Page right"
+#: declarative/util/qdeclarativepixmapcache.cpp:478
+#: declarative/util/qdeclarativepixmapcache.cpp:838
+#, qt-format
+msgid "Failed to get image from provider: %1"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:67
-msgctxt "QWebPage"
-msgid "Page down"
+#: declarative/util/qdeclarativepixmapcache.cpp:496
+#: declarative/util/qdeclarativepixmapcache.cpp:856
+#, qt-format
+msgid "Cannot open: %1"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:70
-msgctxt "QWebPage"
-msgid "Scroll left"
+#: declarative/util/qdeclarativeconnections.cpp:217
+msgid "Connections: nested objects not allowed"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:70
-msgctxt "QWebPage"
-msgid "Scroll up"
+#: declarative/util/qdeclarativeconnections.cpp:220
+msgid "Connections: syntax error"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:71
-msgctxt "QWebPage"
-msgid "Scroll right"
+#: declarative/util/qdeclarativeconnections.cpp:228
+msgid "Connections: script expected"
 msgstr ""
 
-#: 3rdparty/webkit/Source/WebCore/platform/qt/ScrollbarQt.cpp:71
-msgctxt "QWebPage"
-msgid "Scroll down"
+#: declarative/util/qdeclarativeutilmodule.cpp:79
+msgid "Application is an abstract class"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/audioequalizer.cpp:92
-#, qt-format
-msgid "%1 Hz"
+#: declarative/util/qdeclarativeutilmodule.cpp:111
+#: declarative/util/qdeclarativeutilmodule.cpp:113
+#: declarative/util/qdeclarativeutilmodule.cpp:160
+#: declarative/util/qdeclarativeutilmodule.cpp:162
+msgctxt "QDeclarativeXmlListModel"
+msgid "Qt was built without support for xmlpatterns"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/abstractvideoplayer.cpp:111
-msgid "Pause failed"
+#: declarative/util/qdeclarativeutilmodule.cpp:123
+#: declarative/util/qdeclarativeutilmodule.cpp:168
+msgid "Animation is an abstract class"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/abstractvideoplayer.cpp:127
-msgid "Seek failed"
+#: declarative/util/qdeclarativexmllistmodel.cpp:581
+#, qt-format
+msgid "\"%1\" duplicates a previous role name and will be disabled."
 msgstr ""
 
-#: 3rdparty/phonon/mmf/abstractvideoplayer.cpp:194
-#: 3rdparty/phonon/mmf/audioplayer.cpp:187
-msgid "Getting position failed"
+#: declarative/util/qdeclarativexmllistmodel.cpp:826
+msgctxt "QDeclarativeXmlRoleList"
+msgid "An XmlListModel query must start with '/' or \"//\""
 msgstr ""
 
-#: 3rdparty/phonon/mmf/abstractvideoplayer.cpp:264
-msgid "Opening clip failed"
+#: declarative/util/qdeclarativexmllistmodel.cpp:1105
+#: declarative/util/qdeclarativexmllistmodel.cpp:1109
+#, qt-format
+msgid "invalid query: \"%1\""
 msgstr ""
 
-#: 3rdparty/phonon/mmf/audiooutput.cpp:106
-msgctxt "Phonon::MMF"
-msgid "Audio Output"
+#: declarative/util/qdeclarativebehavior.cpp:128
+msgid "Cannot change the animation assigned to a Behavior."
 msgstr ""
 
-#: 3rdparty/phonon/mmf/audiooutput.cpp:107
-msgctxt "Phonon::MMF"
-msgid "The audio output device"
+#: declarative/graphicsitems/qdeclarativevisualitemmodel.cpp:1099
+msgid "Delegate component must be Item type."
 msgstr ""
 
-#: 3rdparty/phonon/mmf/environmentalreverb.cpp:146
-msgid "Decay HF ratio (%)"
+#: declarative/graphicsitems/qdeclarativeanchors.cpp:198
+msgid "Possible anchor loop detected on fill."
 msgstr ""
 
-#: 3rdparty/phonon/mmf/environmentalreverb.cpp:152
-msgid "Decay time (ms)"
+#: declarative/graphicsitems/qdeclarativeanchors.cpp:227
+msgid "Possible anchor loop detected on centerIn."
 msgstr ""
 
-#: 3rdparty/phonon/mmf/environmentalreverb.cpp:159
-msgid "Density (%)"
+#: declarative/graphicsitems/qdeclarativeanchors.cpp:435
+#: declarative/graphicsitems/qdeclarativeanchors.cpp:469
+#: declarative/graphicsitems/qdeclarativeanchors.cpp:1115
+#: declarative/graphicsitems/qdeclarativeanchors.cpp:1152
+msgid "Cannot anchor to an item that isn't a parent or sibling."
 msgstr ""
 
-#: 3rdparty/phonon/mmf/environmentalreverb.cpp:165
-msgid "Diffusion (%)"
+#: declarative/graphicsitems/qdeclarativeanchors.cpp:582
+msgid "Possible anchor loop detected on vertical anchor."
 msgstr ""
 
-#: 3rdparty/phonon/mmf/environmentalreverb.cpp:170
-msgid "Reflections delay (ms)"
+#: declarative/graphicsitems/qdeclarativeanchors.cpp:677
+msgid "Possible anchor loop detected on horizontal anchor."
 msgstr ""
 
-#: 3rdparty/phonon/mmf/environmentalreverb.cpp:177
-msgid "Reflections level (mB)"
+#: declarative/graphicsitems/qdeclarativeanchors.cpp:1099
+msgid "Cannot specify left, right, and hcenter anchors."
 msgstr ""
 
-#: 3rdparty/phonon/mmf/environmentalreverb.cpp:184
-msgid "Reverb delay (ms)"
+#: declarative/graphicsitems/qdeclarativeanchors.cpp:1109
+#: declarative/graphicsitems/qdeclarativeanchors.cpp:1146
+msgid "Cannot anchor to a null item."
 msgstr ""
 
-#: 3rdparty/phonon/mmf/environmentalreverb.cpp:192
-msgid "Reverb level (mB)"
+#: declarative/graphicsitems/qdeclarativeanchors.cpp:1112
+msgid "Cannot anchor a horizontal edge to a vertical edge."
 msgstr ""
 
-#: 3rdparty/phonon/mmf/environmentalreverb.cpp:199
-msgid "Room HF level"
+#: declarative/graphicsitems/qdeclarativeanchors.cpp:1118
+#: declarative/graphicsitems/qdeclarativeanchors.cpp:1155
+msgid "Cannot anchor item to self."
 msgstr ""
 
-#: 3rdparty/phonon/mmf/environmentalreverb.cpp:205
-msgid "Room level (mB)"
+#: declarative/graphicsitems/qdeclarativeanchors.cpp:1130
+msgid "Cannot specify top, bottom, and vcenter anchors."
 msgstr ""
 
-#: 3rdparty/phonon/mmf/videoplayer_surface.cpp:139
-#: 3rdparty/phonon/mmf/videoplayer_surface.cpp:165
-#: 3rdparty/phonon/mmf/videoplayer_dsa.cpp:241
-#: 3rdparty/phonon/mmf/videoplayer_dsa.cpp:256
-#: 3rdparty/phonon/mmf/videoplayer_dsa.cpp:264
-#: 3rdparty/phonon/mmf/videoplayer_dsa.cpp:286
-#: 3rdparty/phonon/mmf/videoplayer_dsa.cpp:308
-msgid "Video display error"
+#: declarative/graphicsitems/qdeclarativeanchors.cpp:1136
+msgid ""
+"Baseline anchor cannot be used in conjunction with top, bottom, or vcenter "
+"anchors."
 msgstr ""
 
-#: 3rdparty/phonon/mmf/effectfactory.cpp:181
-msgid "Enabled"
+#: declarative/graphicsitems/qdeclarativeanchors.cpp:1149
+msgid "Cannot anchor a vertical edge to a horizontal edge."
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:91
-msgid "Not found"
+#: declarative/graphicsitems/qdeclarativetextinput.cpp:962
+#: declarative/graphicsitems/qdeclarativetextinput.cpp:970
+msgid "Could not load cursor delegate"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:93
-msgid "Out of memory"
+#: declarative/graphicsitems/qdeclarativetextinput.cpp:981
+msgid "Could not instantiate cursor delegate"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:95
-msgid "Not supported"
+#: declarative/graphicsitems/qdeclarativeitem.cpp:818
+msgid "LayoutDirection attached property only works with Items"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:97
-msgid "Overflow"
+#: declarative/graphicsitems/qdeclarativeflipable.cpp:138
+msgid "front is a write-once property"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:99
-msgid "Underflow"
+#: declarative/graphicsitems/qdeclarativeflipable.cpp:158
+msgid "back is a write-once property"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:101
-msgid "Already exists"
+#: declarative/graphicsitems/qdeclarativeloader.cpp:407
+msgid "Loader does not support loading non-visual elements."
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:103
-msgid "Path not found"
+#: declarative/graphicsitems/qdeclarativeitemsmodule.cpp:104
+#: declarative/graphicsitems/qdeclarativeitemsmodule.cpp:211
+msgctxt "QDeclarativeAnimatedImage"
+msgid "Qt was built without support for QMovie"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:105
-msgid "In use"
+#: declarative/graphicsitems/qdeclarativeitemsmodule.cpp:176
+#: declarative/graphicsitems/qdeclarativeitemsmodule.cpp:263
+msgid "KeyNavigation is only available via attached properties"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:107
-msgid "Not ready"
+#: declarative/graphicsitems/qdeclarativeitemsmodule.cpp:177
+#: declarative/graphicsitems/qdeclarativeitemsmodule.cpp:264
+msgid "Keys is only available via attached properties"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:109
-msgid "Access denied"
+#: declarative/graphicsitems/qdeclarativeitemsmodule.cpp:179
+#: declarative/graphicsitems/qdeclarativeitemsmodule.cpp:180
+msgid "Accessible is only available via attached properties"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:111
-msgid "Could not connect"
+#: declarative/graphicsitems/qdeclarativeitemsmodule.cpp:206
+msgid "LayoutMirroring is only available via attached properties"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:113
-msgid "Disconnected"
+#: plugins/imageformats/tga/qtgafile.cpp:136
+msgid "Could not read image data"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:119
-msgid "Insufficient bandwidth"
+#: plugins/imageformats/tga/qtgafile.cpp:141
+msgid "Sequential device (eg socket) for image read not supported"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:122
-msgid "Network unavailable"
+#: plugins/imageformats/tga/qtgafile.cpp:146
+msgid "Seek file/device for image read failed"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:126
-msgid "Network communication error"
+#: plugins/imageformats/tga/qtgafile.cpp:152
+msgid "Image mHeader read failed"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:128
-msgid "Streaming not supported"
+#: plugins/imageformats/tga/qtgafile.cpp:158
+msgid "Image type not supported"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:130
-msgid "Server alert"
+#: plugins/imageformats/tga/qtgafile.cpp:165
+msgid "Image dpeth not valid"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:132
-msgid "Invalid protocol"
+#: plugins/imageformats/tga/qtgafile.cpp:171
+msgid "Could not seek to image read footer"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:136
-msgid "Multicast error"
+#: plugins/imageformats/tga/qtgafile.cpp:178
+msgid "Could not read footer"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:139
-msgid "Proxy server error"
+#: plugins/imageformats/tga/qtgafile.cpp:182
+msgid "Image type (non-TrueVision 2.0) not supported"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:141
-msgid "Proxy server not supported"
+#: plugins/imageformats/tga/qtgafile.cpp:186
+msgid "Could not reset to read data"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:143
-msgid "Audio output error"
+#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:65
+msgid "Inspector Mode"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:145
-msgid "Video output error"
+#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:66
+msgid "Play/Pause Animations"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:147
-msgid "Decoder error"
+#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:69
+msgid "Select (Marquee)"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:149
-msgid "Audio or video components could not be played"
+#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:70
+msgid "Zoom"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:151
-msgid "DRM error"
+#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:72
+msgid "Color Picker"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/utils.cpp:166
-#, qt-format
-msgid "Unknown error (%1)"
+#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:74
+msgid "Apply Changes to QML Viewer"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/mediaobject.cpp:321
-#: 3rdparty/phonon/mmf/mediaobject.cpp:339
-msgid "Error opening source: type not supported"
+#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:76
+msgid "Apply Changes to Document"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/mediaobject.cpp:332
-msgid "Error opening source: resource is compressed"
+#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:86
+msgid "Tools"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/mediaobject.cpp:336
-msgid "Error opening source: resource not valid"
+#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:112
+msgid "1x"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/mediaobject.cpp:362
-msgid "Error opening source: media type could not be determined"
+#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:118
+msgid "0.5x"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/mediaobject.cpp:520
-msgid "Failed to set requested IAP"
+#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:123
+msgid "0.25x"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/stereowidening.cpp:79
-msgid "Level (%)"
+#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:128
+msgid "0.125x"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:82
-msgid "Not ready to play"
+#: plugins/qmltooling/qmldbg_inspector/editor/qmltoolbar.cpp:133
+msgid "0.1x"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:252
-#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:263
-#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:609
-#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:630
-msgid "Error opening file"
+#: plugins/qmltooling/qmldbg_inspector/editor/liveselectiontool.cpp:143
+msgid "Items"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:283
-msgid "Error opening URL"
+#: plugins/qmltooling/qmldbg_inspector/editor/zoomtool.cpp:63
+msgid "Zoom to &100%"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:295
-msgid "Error opening resource"
+#: plugins/qmltooling/qmldbg_inspector/editor/zoomtool.cpp:64
+msgid "Zoom In"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:297
-msgid "Error opening source: resource not opened"
+#: plugins/qmltooling/qmldbg_inspector/editor/zoomtool.cpp:65
+msgid "Zoom Out"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:389
-msgid "Setting volume failed"
+#: plugins/qmltooling/qmldbg_inspector/editor/toolbarcolorbox.cpp:65
+msgid "Copy Color"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:450
-msgid "Loading clip failed"
+#: plugins/inputmethods/imsw-multi/qmultiinputcontext.cpp:88
+msgid "Select IM"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:479
-msgid "Playback complete"
+#: plugins/inputmethods/imsw-multi/qmultiinputcontextplugin.cpp:95
+msgid "Multiple input method switcher"
 msgstr ""
 
-#: 3rdparty/phonon/mmf/abstractmediaplayer.cpp:636
-msgid "Download error"
+#: plugins/inputmethods/imsw-multi/qmultiinputcontextplugin.cpp:102
+msgid ""
+"Multiple input method switcher that uses the context menu of the text widgets"
 msgstr ""
 
-#: 3rdparty/phonon/phonon/phononnamespace.cpp:55
-msgctxt "Phonon::"
-msgid "Notifications"
-msgstr "التنبيهات"
-
-#: 3rdparty/phonon/phonon/phononnamespace.cpp:57
-msgctxt "Phonon::"
-msgid "Music"
-msgstr "الموسيقى"
+#: plugins/accessible/compat/q3complexwidgets.cpp:246
+msgid "System"
+msgstr "النظام"
 
-#: 3rdparty/phonon/phonon/phononnamespace.cpp:59
-msgctxt "Phonon::"
-msgid "Video"
-msgstr "الفيديو"
+#: plugins/accessible/compat/q3complexwidgets.cpp:249
+msgid "Restore up"
+msgstr ""
 
-#: 3rdparty/phonon/phonon/phononnamespace.cpp:61
-msgctxt "Phonon::"
-msgid "Communication"
-msgstr "الاتصالات"
+#: plugins/accessible/compat/q3complexwidgets.cpp:253
+msgid "Restore down"
+msgstr ""
 
-#: 3rdparty/phonon/phonon/phononnamespace.cpp:63
-msgctxt "Phonon::"
-msgid "Games"
-msgstr "الألعاب"
+#: plugins/accessible/compat/q3complexwidgets.cpp:274
+msgid "Contains commands to manipulate the window"
+msgstr ""
 
-#: 3rdparty/phonon/phonon/phononnamespace.cpp:65
-msgctxt "Phonon::"
-msgid "Accessibility"
-msgstr "تسهيل الوصول"
+#: plugins/accessible/compat/q3complexwidgets.cpp:277
+msgid "Puts a minimized window back to normal"
+msgstr ""
 
-#: 3rdparty/phonon/phonon/volumeslider.cpp:42
-#: 3rdparty/phonon/phonon/volumeslider.cpp:60
-#: 3rdparty/phonon/phonon/volumeslider.cpp:189
-#: 3rdparty/phonon/phonon/volumeslider.cpp:204
-#, qt-format
-msgid "Volume: %1%"
-msgstr "الصوت: %1%"
+#: plugins/accessible/compat/q3complexwidgets.cpp:278
+msgid "Moves the window out of the way"
+msgstr ""
 
-#: 3rdparty/phonon/phonon/volumeslider.cpp:45
-#: 3rdparty/phonon/phonon/volumeslider.cpp:63
-#: 3rdparty/phonon/phonon/volumeslider.cpp:117
-#, qt-format
-msgid ""
-"Use this slider to adjust the volume. The leftmost position is 0%. The "
-"rightmost is %1%"
+#: plugins/accessible/compat/q3complexwidgets.cpp:281
+msgid "Puts a maximized window back to normal"
 msgstr ""
 
-#: 3rdparty/phonon/phonon/volumeslider.cpp:184
-msgid "Muted"
-msgstr "صامت"
+#: plugins/accessible/compat/q3complexwidgets.cpp:282
+msgid "Makes the window full screen"
+msgstr ""
 
-#: 3rdparty/phonon/phonon/audiooutput.cpp:444
-#: 3rdparty/phonon/phonon/audiooutput.cpp:478
-#, qt-format
-msgid ""
-"<html>The audio playback device <b>%1</b> does not work.<br/>Falling back to "
-"<b>%2</b>.</html>"
+#: plugins/accessible/compat/q3complexwidgets.cpp:284
+msgid "Closes the window"
 msgstr ""
-"<html>جهاز تشغيل الصوت <b>%1</b>لا يعمل.<br/> رجع إلى <b>%2</b>.</html>"
 
-#: 3rdparty/phonon/phonon/audiooutput.cpp:457
-#, qt-format
+#: plugins/accessible/compat/q3complexwidgets.cpp:286
 msgid ""
-"<html>Switching to the audio playback device <b>%1</b><br/>which just became "
-"available and has higher preference.</html>"
+"Displays the name of the window and contains controls to manipulate it"
 msgstr ""
-"<html>بدل إلى جهاز الصوت <b>%1</b><br/>الذي أصبح متاحا و يملك تفضيلا "
-"أعلى.</html>"
 
-#: 3rdparty/phonon/phonon/audiooutput.cpp:460
-#: 3rdparty/phonon/phonon/audiooutput.cpp:474
-#, qt-format
-msgid "Revert back to device '%1'"
-msgstr "رجع إلى جهاز '%1'"
+#: plugins/accessible/widgets/rangecontrols.cpp:149
+#: plugins/accessible/widgets/rangecontrols.cpp:412
+msgid "More"
+msgstr "المزيد"
 
-#: 3rdparty/phonon/phonon/audiooutput.cpp:471
-#, qt-format
-msgid ""
-"<html>Switching to the audio playback device <b>%1</b><br/>which has higher "
-"preference or is specifically configured for this stream.</html>"
-msgstr ""
+#: plugins/accessible/widgets/rangecontrols.cpp:151
+#: plugins/accessible/widgets/rangecontrols.cpp:414
+msgid "Less"
+msgstr "أقل"
 
-#: 3rdparty/phonon/phonon/pulsesupport.cpp:162
-#: 3rdparty/phonon/phonon/pulsesupport.cpp:173
-msgid "PulseAudio Sound Server"
-msgstr ""
+#: plugins/accessible/widgets/rangecontrols.cpp:555
+#: plugins/accessible/widgets/rangecontrols.cpp:708
+msgid "Position"
+msgstr "الموضع"
 
-#: 3rdparty/phonon/gstreamer/backend.cpp:188
-msgid ""
-"Warning: You do not seem to have the package gstreamer0.10-plugins-good "
-"installed.\n"
-"          Some video features have been disabled."
-msgstr ""
-"تحذير: يبدو أنك لم تثبت حزمة gstreamer0.10-plugins-good .\n"
-"          بعض مزايا الفيديو عطلت."
+#: plugins/accessible/widgets/rangecontrols.cpp:559
+msgid "Line down"
+msgstr "خط أسفل"
 
-#: 3rdparty/phonon/gstreamer/backend.cpp:193
-msgid ""
-"Warning: You do not seem to have the base GStreamer plugins installed.\n"
-"          All audio and video support has been disabled"
-msgstr ""
-"تحذير: يبدو أنك لم تثبت ملحقات GStreamer  الأساسية.\n"
-"          تم تعطيل دعم الصوت و الفيديو."
+#: plugins/accessible/widgets/rangecontrols.cpp:933
+msgid "QDial"
+msgstr "QDial"
 
-#: 3rdparty/phonon/gstreamer/mediaobject.cpp:93
-msgid ""
-"Cannot start playback. \n"
-"\n"
-"Check your GStreamer installation and make sure you \n"
-"have libgstreamer-plugins-base installed."
-msgstr ""
+#: plugins/accessible/widgets/rangecontrols.cpp:935
+msgid "SpeedoMeter"
+msgstr "SpeedoMeter"
 
-#: 3rdparty/phonon/gstreamer/mediaobject.cpp:222
-msgid "Missing codec helper script assistant."
-msgstr ""
+#: plugins/accessible/widgets/rangecontrols.cpp:937
+msgid "SliderHandle"
+msgstr "SliderHandle"
 
-#: 3rdparty/phonon/gstreamer/mediaobject.cpp:224
-#, qt-format
-msgid "Plugin codec installation failed for codec: %0"
-msgstr ""
+#: plugins/accessible/widgets/simplewidgets.cpp:117
+#: plugins/accessible/widgets/simplewidgets.cpp:452
+#: plugins/accessible/widgets/simplewidgets.cpp:460
+#: plugins/accessible/widgets/complexwidgets.cpp:1781
+#: plugins/accessible/widgets/complexwidgets.cpp:1847
+#: plugins/accessible/widgets/qaccessiblemenu.cpp:158
+#: plugins/accessible/widgets/qaccessiblemenu.cpp:383
+#: plugins/accessible/widgets/qaccessiblemenu.cpp:437
+msgid "Open"
+msgstr "افتح"
 
-#: 3rdparty/phonon/gstreamer/mediaobject.cpp:235
-#, qt-format
-msgid ""
-"A required codec is missing. You need to install the following codec(s) to "
-"play this content: %0"
-msgstr ""
+#: plugins/accessible/widgets/simplewidgets.cpp:121
+#: plugins/accessible/widgets/simplewidgets.cpp:266
+msgid "Uncheck"
+msgstr "أزل الاختيار"
 
-#: 3rdparty/phonon/gstreamer/mediaobject.cpp:965
-#: 3rdparty/phonon/gstreamer/mediaobject.cpp:971
-#: 3rdparty/phonon/gstreamer/mediaobject.cpp:984
-#: 3rdparty/phonon/gstreamer/mediaobject.cpp:1008
-#: 3rdparty/phonon/gstreamer/mediaobject.cpp:1014
-#: 3rdparty/phonon/gstreamer/mediaobject.cpp:1032
-#: 3rdparty/phonon/gstreamer/mediaobject.cpp:1466
-#: 3rdparty/phonon/gstreamer/mediaobject.cpp:1490
-msgid "Could not open media source."
-msgstr "لا يمكن فتح مصدر الوسيط"
+#: plugins/accessible/widgets/simplewidgets.cpp:124
+#: plugins/accessible/widgets/simplewidgets.cpp:129
+#: plugins/accessible/widgets/simplewidgets.cpp:268
+msgid "Check"
+msgstr "اختر"
 
-#: 3rdparty/phonon/gstreamer/mediaobject.cpp:976
-msgid "Invalid source type."
-msgstr "نوع المصدر غير صالح."
+#: plugins/accessible/widgets/simplewidgets.cpp:125
+msgid "Toggle"
+msgstr "بدل"
+
+#: plugins/accessible/widgets/simplewidgets.cpp:271
+#: plugins/accessible/widgets/simplewidgets.cpp:450
+#: plugins/accessible/widgets/simplewidgets.cpp:456
+msgid "Press"
+msgstr "اضغط"
 
-#: 3rdparty/phonon/gstreamer/mediaobject.cpp:1464
-msgid "Could not locate media source."
-msgstr "لا يمكن تحديد مصدر الوسيط."
+#: plugins/accessible/widgets/complexwidgets.cpp:1515
+msgid "Scroll Left"
+msgstr "اللف اليساري"
 
-#: 3rdparty/phonon/gstreamer/mediaobject.cpp:1474
-msgid "Could not open audio device. The device is already in use."
-msgstr "لا يمكن فتح جهاز الصوت. الجهاز مستخدم بالفعل."
+#: plugins/accessible/widgets/complexwidgets.cpp:1515
+msgid "Scroll Right"
+msgstr "اللف اليميني"
 
-#: 3rdparty/phonon/gstreamer/mediaobject.cpp:1487
-msgid "Could not decode media source."
-msgstr "لا يمكن فك تشفير مصدر الوسيط"
+#: plugins/accessible/widgets/qaccessiblemenu.cpp:160
+#: plugins/accessible/widgets/qaccessiblemenu.cpp:385
+#: plugins/accessible/widgets/qaccessiblemenu.cpp:438
+msgid "Execute"
+msgstr "نفّذ"
 
-#: imports/gestures/qdeclarativegesturearea.cpp:183
-#: declarative/util/qdeclarativeconnections.cpp:207
-#: declarative/util/qdeclarativeconnections.cpp:271
-#: declarative/util/qdeclarativepropertychanges.cpp:424
-#: declarative/qml/qdeclarativecompiler.cpp:1542
-#: declarative/qml/qdeclarativecompiler.cpp:1898
-#: declarative/qml/qdeclarativecompiler.cpp:1901
-#, qt-format
-msgid "Cannot assign to non-existent property \"%1\""
-msgstr ""
+#: plugins/accessible/widgets/qaccessiblewidgets.cpp:1251
+msgid "Dock"
+msgstr "إرساء"
 
-#: imports/gestures/qdeclarativegesturearea.cpp:193
-msgid "GestureArea: nested objects not allowed"
-msgstr ""
+#: plugins/accessible/widgets/qaccessiblewidgets.cpp:1252
+msgid "Float"
+msgstr "عشري"
 
-#: imports/gestures/qdeclarativegesturearea.cpp:196
-msgid "GestureArea: syntax error"
+#: plugins/bearer/icd/qnetworksession_impl.cpp:1030
+msgid "Roaming error"
 msgstr ""
 
-#: imports/gestures/qdeclarativegesturearea.cpp:205
-msgid "GestureArea: script expected"
+#: plugins/bearer/icd/qnetworksession_impl.cpp:1033
+msgid "Session aborted by user or system"
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativeitem.cpp:818
-msgid "LayoutDirection attached property only works with Items"
+#: plugins/bearer/icd/qnetworksession_impl.cpp:1036
+#: plugins/bearer/symbian/qnetworksession_impl.cpp:307
+#: plugins/bearer/qnetworksession_impl.cpp:260
+msgid "The specified configuration cannot be used."
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativeloader.cpp:407
-msgid "Loader does not support loading non-visual elements."
+#: plugins/bearer/icd/qnetworksession_impl.cpp:1040
+msgid "Unidentified Error"
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativeanchors.cpp:198
-msgid "Possible anchor loop detected on fill."
+#: plugins/bearer/symbian/qnetworksession_impl.cpp:301
+#: plugins/bearer/qnetworksession_impl.cpp:254
+msgid "Unknown session error."
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativeanchors.cpp:227
-msgid "Possible anchor loop detected on centerIn."
+#: plugins/bearer/symbian/qnetworksession_impl.cpp:303
+#: plugins/bearer/qnetworksession_impl.cpp:256
+msgid "The session was aborted by the user or system."
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativeanchors.cpp:435
-#: declarative/graphicsitems/qdeclarativeanchors.cpp:469
-#: declarative/graphicsitems/qdeclarativeanchors.cpp:1115
-#: declarative/graphicsitems/qdeclarativeanchors.cpp:1152
-msgid "Cannot anchor to an item that isn't a parent or sibling."
+#: plugins/bearer/symbian/qnetworksession_impl.cpp:305
+#: plugins/bearer/qnetworksession_impl.cpp:258
+msgid "The requested operation is not supported by the system."
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativeanchors.cpp:582
-msgid "Possible anchor loop detected on vertical anchor."
+#: plugins/bearer/symbian/qnetworksession_impl.cpp:309
+#: plugins/bearer/qnetworksession_impl.cpp:262
+msgid "Roaming was aborted or is not possible."
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativeanchors.cpp:677
-msgid "Possible anchor loop detected on horizontal anchor."
+#: scripttools/debugging/qscriptdebuggerstackmodel.cpp:161
+msgctxt "QScriptDebuggerStackModel"
+msgid "Level"
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativeanchors.cpp:1099
-msgid "Cannot specify left, right, and hcenter anchors."
+#: scripttools/debugging/qscriptdebuggerstackmodel.cpp:163
+msgctxt "QScriptDebuggerStackModel"
+msgid "Name"
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativeanchors.cpp:1109
-#: declarative/graphicsitems/qdeclarativeanchors.cpp:1146
-msgid "Cannot anchor to a null item."
+#: scripttools/debugging/qscriptdebuggerstackmodel.cpp:165
+msgctxt "QScriptDebuggerStackModel"
+msgid "Location"
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativeanchors.cpp:1112
-msgid "Cannot anchor a horizontal edge to a vertical edge."
+#: scripttools/debugging/qscriptenginedebugger.cpp:523
+msgid "Loaded Scripts"
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativeanchors.cpp:1118
-#: declarative/graphicsitems/qdeclarativeanchors.cpp:1155
-msgid "Cannot anchor item to self."
+#: scripttools/debugging/qscriptenginedebugger.cpp:529
+msgid "Breakpoints"
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativeanchors.cpp:1130
-msgid "Cannot specify top, bottom, and vcenter anchors."
+#: scripttools/debugging/qscriptenginedebugger.cpp:535
+msgid "Stack"
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativeanchors.cpp:1136
-msgid ""
-"Baseline anchor cannot be used in conjunction with top, bottom, or vcenter "
-"anchors."
+#: scripttools/debugging/qscriptenginedebugger.cpp:541
+msgid "Locals"
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativeanchors.cpp:1149
-msgid "Cannot anchor a vertical edge to a horizontal edge."
+#: scripttools/debugging/qscriptenginedebugger.cpp:547
+msgid "Console"
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativeflipable.cpp:138
-msgid "front is a write-once property"
+#: scripttools/debugging/qscriptenginedebugger.cpp:553
+msgid "Debug Output"
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativeflipable.cpp:158
-msgid "back is a write-once property"
+#: scripttools/debugging/qscriptenginedebugger.cpp:559
+msgid "Error Log"
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativevisualitemmodel.cpp:1099
-msgid "Delegate component must be Item type."
+#: scripttools/debugging/qscriptenginedebugger.cpp:571
+msgid "Search"
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativetextinput.cpp:962
-#: declarative/graphicsitems/qdeclarativetextinput.cpp:970
-msgid "Could not load cursor delegate"
+#: scripttools/debugging/qscriptenginedebugger.cpp:578
+msgid "View"
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativetextinput.cpp:981
-msgid "Could not instantiate cursor delegate"
+#: scripttools/debugging/qscriptenginedebugger.cpp:596
+msgid "Qt Script Debugger"
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativeitemsmodule.cpp:104
-#: declarative/graphicsitems/qdeclarativeitemsmodule.cpp:211
-msgctxt "QDeclarativeAnimatedImage"
-msgid "Qt was built without support for QMovie"
+#: scripttools/debugging/qscriptedit.cpp:411
+#: scripttools/debugging/qscriptdebugger.cpp:1795
+msgid "Toggle Breakpoint"
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativeitemsmodule.cpp:176
-#: declarative/graphicsitems/qdeclarativeitemsmodule.cpp:263
-msgid "KeyNavigation is only available via attached properties"
+#: scripttools/debugging/qscriptedit.cpp:413
+msgid "Disable Breakpoint"
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativeitemsmodule.cpp:177
-#: declarative/graphicsitems/qdeclarativeitemsmodule.cpp:264
-msgid "Keys is only available via attached properties"
+#: scripttools/debugging/qscriptedit.cpp:414
+msgid "Enable Breakpoint"
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativeitemsmodule.cpp:179
-#: declarative/graphicsitems/qdeclarativeitemsmodule.cpp:180
-msgid "Accessible is only available via attached properties"
+#: scripttools/debugging/qscriptedit.cpp:418
+msgid "Breakpoint Condition:"
 msgstr ""
 
-#: declarative/graphicsitems/qdeclarativeitemsmodule.cpp:206
-msgid "LayoutMirroring is only available via attached properties"
+#: scripttools/debugging/qscriptbreakpointswidget.cpp:298
+msgid "New"
 msgstr ""
 
-#: declarative/debugger/qjsdebuggeragent.cpp:119
-#, qt-format
-msgctxt "Debugger::JSAgentWatchData"
-msgid "[Array of length %1]"
+#: scripttools/debugging/qscriptbreakpointsmodel.cpp:455
+msgctxt "QScriptBreakpointsModel"
+msgid "ID"
 msgstr ""
 
-#: declarative/debugger/qjsdebuggeragent.cpp:121
-msgctxt "Debugger::JSAgentWatchData"
-msgid "<undefined>"
+#: scripttools/debugging/qscriptbreakpointsmodel.cpp:457
+msgctxt "QScriptBreakpointsModel"
+msgid "Location"
 msgstr ""
 
-#: declarative/util/qdeclarativeanimation.cpp:173
-#, qt-format
-msgid "Cannot animate non-existent property \"%1\""
+#: scripttools/debugging/qscriptbreakpointsmodel.cpp:459
+msgctxt "QScriptBreakpointsModel"
+msgid "Condition"
 msgstr ""
 
-#: declarative/util/qdeclarativeanimation.cpp:176
-#, qt-format
-msgid "Cannot animate read-only property \"%1\""
+#: scripttools/debugging/qscriptbreakpointsmodel.cpp:461
+msgctxt "QScriptBreakpointsModel"
+msgid "Ignore-count"
 msgstr ""
 
-#: declarative/util/qdeclarativeanimation.cpp:618
-#: declarative/util/qdeclarativeanimation.cpp:1856
-#: declarative/util/qdeclarativeanimation.cpp:2876
-msgid "Cannot set a duration of < 0"
+#: scripttools/debugging/qscriptbreakpointsmodel.cpp:463
+msgctxt "QScriptBreakpointsModel"
+msgid "Single-shot"
 msgstr ""
 
-#: declarative/util/qdeclarativeanimation.cpp:2708
-#: declarative/util/qdeclarativestateoperations.cpp:103
-msgid "Unable to preserve appearance under complex transform"
+#: scripttools/debugging/qscriptbreakpointsmodel.cpp:465
+msgctxt "QScriptBreakpointsModel"
+msgid "Hit-count"
 msgstr ""
 
-#: declarative/util/qdeclarativeanimation.cpp:2719
-#: declarative/util/qdeclarativeanimation.cpp:2726
-#: declarative/util/qdeclarativestateoperations.cpp:114
-#: declarative/util/qdeclarativestateoperations.cpp:121
-msgid "Unable to preserve appearance under non-uniform scale"
+#: scripttools/debugging/qscriptdebuggercodefinderwidget.cpp:154
+msgid "Previous"
 msgstr ""
 
-#: declarative/util/qdeclarativeanimation.cpp:2733
-#: declarative/util/qdeclarativestateoperations.cpp:128
-msgid "Unable to preserve appearance under scale of 0"
+#: scripttools/debugging/qscriptdebuggercodefinderwidget.cpp:161
+msgid "Next"
 msgstr ""
 
-#: declarative/util/qdeclarativeconnections.cpp:217
-msgid "Connections: nested objects not allowed"
+#: scripttools/debugging/qscriptdebuggercodefinderwidget.cpp:166
+msgid "Case Sensitive"
 msgstr ""
 
-#: declarative/util/qdeclarativeconnections.cpp:220
-msgid "Connections: syntax error"
+#: scripttools/debugging/qscriptdebuggercodefinderwidget.cpp:169
+msgid "Whole words"
 msgstr ""
 
-#: declarative/util/qdeclarativeconnections.cpp:228
-msgid "Connections: script expected"
+#: scripttools/debugging/qscriptdebuggercodefinderwidget.cpp:178
+msgid ""
+"<img src=\":/qt/scripttools/debugging/images/wrap.png\">&nbsp;Search wrapped"
 msgstr ""
 
-#: declarative/util/qdeclarativepropertychanges.cpp:256
-msgid "PropertyChanges does not support creating state-specific objects."
+#: scripttools/debugging/qscriptdebugger.cpp:885
+#: scripttools/debugging/qscriptdebugger.cpp:1898
+msgid "Go to Line"
 msgstr ""
 
-#: declarative/util/qdeclarativepropertychanges.cpp:427
-#, qt-format
-msgid "Cannot assign to read-only property \"%1\""
+#: scripttools/debugging/qscriptdebugger.cpp:886
+msgid "Line:"
 msgstr ""
 
-#: declarative/util/qdeclarativepixmapcache.cpp:311
-#, qt-format
-msgid "Error decoding: %1: %2"
+#: scripttools/debugging/qscriptdebugger.cpp:1677
+msgid "Interrupt"
 msgstr ""
 
-#: declarative/util/qdeclarativepixmapcache.cpp:478
-#: declarative/util/qdeclarativepixmapcache.cpp:838
-#, qt-format
-msgid "Failed to get image from provider: %1"
+#: scripttools/debugging/qscriptdebugger.cpp:1679
+msgid "Shift+F5"
 msgstr ""
 
-#: declarative/util/qdeclarativepixmapcache.cpp:496
-#: declarative/util/qdeclarativepixmapcache.cpp:856
-#, qt-format
-msgid "Cannot open: %1"
+#: scripttools/debugging/qscriptdebugger.cpp:1696
+msgid "F5"
 msgstr ""
 
-#: declarative/util/qdeclarativelistmodel.cpp:392
-#, qt-format
-msgid "remove: index %1 out of range"
+#: scripttools/debugging/qscriptdebugger.cpp:1711
+msgid "Step Into"
 msgstr ""
 
-#: declarative/util/qdeclarativelistmodel.cpp:425
-msgid "insert: value is not an object"
+#: scripttools/debugging/qscriptdebugger.cpp:1713
+msgid "F11"
 msgstr ""
 
-#: declarative/util/qdeclarativelistmodel.cpp:430
-#, qt-format
-msgid "insert: index %1 out of range"
+#: scripttools/debugging/qscriptdebugger.cpp:1728
+msgid "Step Over"
 msgstr ""
 
-#: declarative/util/qdeclarativelistmodel.cpp:460
-msgid "move: out of range"
+#: scripttools/debugging/qscriptdebugger.cpp:1730
+msgid "F10"
 msgstr ""
 
-#: declarative/util/qdeclarativelistmodel.cpp:500
-msgid "append: value is not an object"
+#: scripttools/debugging/qscriptdebugger.cpp:1745
+msgid "Step Out"
 msgstr ""
 
-#: declarative/util/qdeclarativelistmodel.cpp:571
-msgid "set: value is not an object"
+#: scripttools/debugging/qscriptdebugger.cpp:1747
+msgid "Shift+F11"
 msgstr ""
 
-#: declarative/util/qdeclarativelistmodel.cpp:575
-#: declarative/util/qdeclarativelistmodel.cpp:613
-#, qt-format
-msgid "set: index %1 out of range"
+#: scripttools/debugging/qscriptdebugger.cpp:1762
+msgid "Run to Cursor"
 msgstr ""
 
-#: declarative/util/qdeclarativelistmodel.cpp:650
-#: declarative/util/qdeclarativelistmodel.cpp:667
-msgid "ListElement: cannot contain nested elements"
+#: scripttools/debugging/qscriptdebugger.cpp:1764
+msgid "Ctrl+F10"
 msgstr ""
 
-#: declarative/util/qdeclarativelistmodel.cpp:671
-msgid "ListElement: cannot use reserved \"id\" property"
+#: scripttools/debugging/qscriptdebugger.cpp:1780
+msgid "Run to New Script"
 msgstr ""
 
-#: declarative/util/qdeclarativelistmodel.cpp:724
-msgid "ListElement: cannot use script for property value"
+#: scripttools/debugging/qscriptdebugger.cpp:1796
+msgid "F9"
 msgstr ""
 
-#: declarative/util/qdeclarativelistmodel.cpp:755
-#, qt-format
-msgid "ListModel: undefined property '%1'"
+#: scripttools/debugging/qscriptdebugger.cpp:1810
+msgid "Clear Debug Output"
 msgstr ""
 
-#: declarative/util/qdeclarativeutilmodule.cpp:79
-msgid "Application is an abstract class"
+#: scripttools/debugging/qscriptdebugger.cpp:1823
+msgid "Clear Error Log"
 msgstr ""
 
-#: declarative/util/qdeclarativeutilmodule.cpp:111
-#: declarative/util/qdeclarativeutilmodule.cpp:113
-#: declarative/util/qdeclarativeutilmodule.cpp:160
-#: declarative/util/qdeclarativeutilmodule.cpp:162
-msgctxt "QDeclarativeXmlListModel"
-msgid "Qt was built without support for xmlpatterns"
+#: scripttools/debugging/qscriptdebugger.cpp:1836
+msgid "Clear Console"
 msgstr ""
 
-#: declarative/util/qdeclarativeutilmodule.cpp:123
-#: declarative/util/qdeclarativeutilmodule.cpp:168
-msgid "Animation is an abstract class"
+#: scripttools/debugging/qscriptdebugger.cpp:1850
+msgid "&Find in Script..."
 msgstr ""
 
-#: declarative/util/qdeclarativexmllistmodel.cpp:581
-#, qt-format
-msgid "\"%1\" duplicates a previous role name and will be disabled."
+#: scripttools/debugging/qscriptdebugger.cpp:1851
+msgid "Ctrl+F"
 msgstr ""
 
-#: declarative/util/qdeclarativexmllistmodel.cpp:826
-msgctxt "QDeclarativeXmlRoleList"
-msgid "An XmlListModel query must start with '/' or \"//\""
+#: scripttools/debugging/qscriptdebugger.cpp:1868
+msgid "Find &Next"
 msgstr ""
 
-#: declarative/util/qdeclarativexmllistmodel.cpp:1105
-#: declarative/util/qdeclarativexmllistmodel.cpp:1109
-#, qt-format
-msgid "invalid query: \"%1\""
+#: scripttools/debugging/qscriptdebugger.cpp:1870
+msgid "F3"
 msgstr ""
 
-#: declarative/util/qdeclarativebehavior.cpp:128
-msgid "Cannot change the animation assigned to a Behavior."
+#: scripttools/debugging/qscriptdebugger.cpp:1883
+msgid "Find &Previous"
 msgstr ""
 
-#: declarative/qml/qdeclarativebinding.cpp:459
-#, qt-format
-msgid "Binding loop detected for property \"%1\""
+#: scripttools/debugging/qscriptdebugger.cpp:1885
+msgid "Shift+F3"
 msgstr ""
 
-#: declarative/qml/qdeclarativescriptparser.cpp:254
-#: declarative/qml/qdeclarativescriptparser.cpp:683
-#: declarative/qml/qdeclarativescriptparser.cpp:742
-msgctxt "QDeclarativeParser"
-msgid "Property value set multiple times"
+#: scripttools/debugging/qscriptdebugger.cpp:1899
+msgid "Ctrl+G"
 msgstr ""
 
-#: declarative/qml/qdeclarativescriptparser.cpp:265
-msgctxt "QDeclarativeParser"
-msgid "Expected type name"
+#: scripttools/debugging/qscriptdebugger.cpp:1910
+msgid "Debug"
 msgstr ""
 
-#: declarative/qml/qdeclarativescriptparser.cpp:399
-msgctxt "QDeclarativeParser"
-msgid "Invalid import qualifier ID"
+#: scripttools/debugging/qscriptdebuggerlocalsmodel.cpp:897
+msgctxt "QScriptDebuggerLocalsModel"
+msgid "Name"
 msgstr ""
 
-#: declarative/qml/qdeclarativescriptparser.cpp:407
-msgctxt "QDeclarativeParser"
-msgid "Reserved name \"Qt\" cannot be used as an qualifier"
+#: scripttools/debugging/qscriptdebuggerlocalsmodel.cpp:899
+msgctxt "QScriptDebuggerLocalsModel"
+msgid "Value"
 msgstr ""
 
-#: declarative/qml/qdeclarativescriptparser.cpp:422
-msgctxt "QDeclarativeParser"
-msgid "Script import qualifiers must be unique."
+#: network/ssl/qsslerror.cpp:217
+msgid "The issuer certificate could not be found"
 msgstr ""
 
-#: declarative/qml/qdeclarativescriptparser.cpp:432
-msgctxt "QDeclarativeParser"
-msgid "Script import requires a qualifier"
+#: network/ssl/qsslerror.cpp:220
+msgid "The certificate signature could not be decrypted"
 msgstr ""
 
-#: declarative/qml/qdeclarativescriptparser.cpp:443
-msgctxt "QDeclarativeParser"
-msgid "Library import requires a version"
+#: network/ssl/qsslerror.cpp:223
+msgid "The public key in the certificate could not be read"
 msgstr ""
 
-#: declarative/qml/qdeclarativescriptparser.cpp:502
-msgctxt "QDeclarativeParser"
-msgid "Expected parameter type"
+#: network/ssl/qsslerror.cpp:226
+msgid "The signature of the certificate is invalid"
 msgstr ""
 
-#: declarative/qml/qdeclarativescriptparser.cpp:544
-msgctxt "QDeclarativeParser"
-msgid "Invalid property type modifier"
+#: network/ssl/qsslerror.cpp:229
+msgid "The certificate is not yet valid"
 msgstr ""
 
-#: declarative/qml/qdeclarativescriptparser.cpp:553
-msgctxt "QDeclarativeParser"
-msgid "Unexpected property type modifier"
+#: network/ssl/qsslerror.cpp:232
+msgid "The certificate has expired"
 msgstr ""
 
-#: declarative/qml/qdeclarativescriptparser.cpp:562
-msgctxt "QDeclarativeParser"
-msgid "Expected property type"
+#: network/ssl/qsslerror.cpp:235
+msgid "The certificate's notBefore field contains an invalid time"
 msgstr ""
 
-#: declarative/qml/qdeclarativescriptparser.cpp:571
-msgctxt "QDeclarativeParser"
-msgid "Readonly not yet supported"
+#: network/ssl/qsslerror.cpp:238
+msgid "The certificate's notAfter field contains an invalid time"
 msgstr ""
 
-#: declarative/qml/qdeclarativescriptparser.cpp:789
-msgctxt "QDeclarativeParser"
-msgid "JavaScript declaration outside Script element"
+#: network/ssl/qsslerror.cpp:241
+msgid "The certificate is self-signed, and untrusted"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiledbindings.cpp:396
-#, qt-format
-msgctxt "QDeclarativeCompiledBindings"
-msgid "Binding loop detected for property \"%1\""
+#: network/ssl/qsslerror.cpp:244
+msgid ""
+"The root certificate of the certificate chain is self-signed, and untrusted"
 msgstr ""
 
-#: declarative/qml/parser/qdeclarativejslexer.cpp:545
-#: declarative/qml/parser/qdeclarativejslexer.cpp:668
-#: declarative/qml/parser/qdeclarativejslexer.cpp:722
-msgctxt "QDeclarativeParser"
-msgid "Illegal unicode escape sequence"
+#: network/ssl/qsslerror.cpp:247
+msgid ""
+"The issuer certificate of a locally looked up certificate could not be found"
 msgstr ""
 
-#: declarative/qml/parser/qdeclarativejslexer.cpp:582
-msgctxt "QDeclarativeParser"
-msgid "Illegal character"
+#: network/ssl/qsslerror.cpp:250
+msgid "No certificates could be verified"
 msgstr ""
 
-#: declarative/qml/parser/qdeclarativejslexer.cpp:596
-msgctxt "QDeclarativeParser"
-msgid "Unclosed string at end of line"
+#: network/ssl/qsslerror.cpp:253
+msgid "One of the CA certificates is invalid"
 msgstr ""
 
-#: declarative/qml/parser/qdeclarativejslexer.cpp:622
-msgctxt "QDeclarativeParser"
-msgid "Illegal escape sequence"
+#: network/ssl/qsslerror.cpp:256
+msgid "The basicConstraints path length parameter has been exceeded"
 msgstr ""
 
-#: declarative/qml/parser/qdeclarativejslexer.cpp:694
-msgctxt "QDeclarativeParser"
-msgid "Unclosed comment at end of file"
+#: network/ssl/qsslerror.cpp:259
+msgid "The supplied certificate is unsuitable for this purpose"
 msgstr ""
 
-#: declarative/qml/parser/qdeclarativejslexer.cpp:796
-msgctxt "QDeclarativeParser"
-msgid "Illegal syntax for exponential number"
+#: network/ssl/qsslerror.cpp:262
+msgid "The root CA certificate is not trusted for this purpose"
 msgstr ""
 
-#: declarative/qml/parser/qdeclarativejslexer.cpp:822
-msgctxt "QDeclarativeParser"
-msgid "Identifier cannot start with numeric literal"
+#: network/ssl/qsslerror.cpp:265
+msgid "The root CA certificate is marked to reject the specified purpose"
 msgstr ""
 
-#: declarative/qml/parser/qdeclarativejslexer.cpp:1160
-msgctxt "QDeclarativeParser"
-msgid "Unterminated regular expression literal"
+#: network/ssl/qsslerror.cpp:268
+msgid ""
+"The current candidate issuer certificate was rejected because its subject "
+"name did not match the issuer name of the current certificate"
 msgstr ""
 
-#: declarative/qml/parser/qdeclarativejslexer.cpp:1175
-#, qt-format
-msgctxt "QDeclarativeParser"
-msgid "Invalid regular expression flag '%0'"
+#: network/ssl/qsslerror.cpp:272
+msgid ""
+"The current candidate issuer certificate was rejected because its issuer "
+"name and serial number was present and did not match the authority key "
+"identifier of the current certificate"
 msgstr ""
 
-#: declarative/qml/parser/qdeclarativejslexer.cpp:1191
-#: declarative/qml/parser/qdeclarativejslexer.cpp:1213
-msgctxt "QDeclarativeParser"
-msgid "Unterminated regular expression backslash sequence"
+#: network/ssl/qsslerror.cpp:277
+msgid "The peer did not present any certificate"
 msgstr ""
 
-#: declarative/qml/parser/qdeclarativejslexer.cpp:1226
-msgctxt "QDeclarativeParser"
-msgid "Unterminated regular expression class"
+#: network/ssl/qsslerror.cpp:280
+msgid ""
+"The host name did not match any of the valid hosts for this certificate"
 msgstr ""
 
-#: declarative/qml/parser/qdeclarativejsparser.cpp:1828
-#: declarative/qml/parser/qdeclarativejsparser.cpp:1895
-msgctxt "QDeclarativeParser"
-msgid "Syntax error"
+#: network/ssl/qsslerror.cpp:286
+msgid "The peer certificate is blacklisted"
 msgstr ""
 
-#: declarative/qml/parser/qdeclarativejsparser.cpp:1830
-#, qt-format
-msgctxt "QDeclarativeParser"
-msgid "Unexpected token `%1'"
-msgstr ""
+#: network/ssl/qsslerror.cpp:289 network/socket/qnativesocketengine.cpp:276
+#: network/socket/qsymbiansocketengine.cpp:1435
+#: network/kernel/qhostinfo_unix.cpp:300 network/kernel/qhostinfo_win.cpp:209
+#: network/kernel/qhostinfo_win.cpp:236 corelib/io/qiodevice.cpp:1629
+#: corelib/plugin/qpluginloader.cpp:367 corelib/plugin/qlibrary.cpp:1233
+#: corelib/statemachine/qstatemachine.cpp:1046
+msgid "Unknown error"
+msgstr "خطأ عير معروف"
 
-#: declarative/qml/parser/qdeclarativejsparser.cpp:1858
-#: declarative/qml/parser/qdeclarativejsparser.cpp:1882
-#, qt-format
-msgctxt "QDeclarativeParser"
-msgid "Expected token `%1'"
+#: network/ssl/qsslsocket_openssl.cpp:286
+#, qt-format
+msgid "Error creating SSL context (%1)"
 msgstr ""
 
-#: declarative/qml/qdeclarativecomponent.cpp:531
-msgid "Invalid empty URL"
+#: network/ssl/qsslsocket_openssl.cpp:340
+#, qt-format
+msgid "Invalid or empty cipher list (%1)"
 msgstr ""
 
-#: declarative/qml/qdeclarativecomponent.cpp:679
-msgid "createObject: value is not an object"
+#: network/ssl/qsslsocket_openssl.cpp:384
+#, qt-format
+msgid "Cannot provide a certificate with no key, %1"
 msgstr ""
 
-#: declarative/qml/qdeclarativevme.cpp:231
+#: network/ssl/qsslsocket_openssl.cpp:391
 #, qt-format
-msgctxt "QDeclarativeVME"
-msgid "Unable to create object of type %1"
+msgid "Error loading local certificate, %1"
 msgstr ""
 
-#: declarative/qml/qdeclarativevme.cpp:672
+#: network/ssl/qsslsocket_openssl.cpp:406
 #, qt-format
-msgctxt "QDeclarativeVME"
-msgid "Cannot assign value %1 to property %2"
+msgid "Error loading private key, %1"
 msgstr ""
 
-#: declarative/qml/qdeclarativevme.cpp:694
+#: network/ssl/qsslsocket_openssl.cpp:413
 #, qt-format
-msgctxt "QDeclarativeVME"
-msgid "Cannot assign object type %1 with no default method"
+msgid "Private key does not certify public key, %1"
 msgstr ""
 
-#: declarative/qml/qdeclarativevme.cpp:697
+#: network/ssl/qsslsocket_openssl.cpp:433
 #, qt-format
-msgctxt "QDeclarativeVME"
-msgid "Cannot connect mismatched signal/slot %1 %vs. %2"
+msgid "Error creating SSL session, %1"
 msgstr ""
 
-#: declarative/qml/qdeclarativevme.cpp:702
+#: network/ssl/qsslsocket_openssl.cpp:473
 #, qt-format
-msgctxt "QDeclarativeVME"
-msgid "Cannot assign an object to signal property %1"
+msgid "Error creating SSL session: %1"
 msgstr ""
 
-#: declarative/qml/qdeclarativevme.cpp:856
-msgctxt "QDeclarativeVME"
-msgid "Cannot assign object to list"
+#: network/ssl/qsslsocket_openssl.cpp:1010
+#, qt-format
+msgid "Unable to write data: %1"
 msgstr ""
 
-#: declarative/qml/qdeclarativevme.cpp:899
-msgctxt "QDeclarativeVME"
-msgid "Cannot assign object to interface property"
+#: network/ssl/qsslsocket_openssl.cpp:1073
+#, qt-format
+msgid "Unable to decrypt data: %1"
 msgstr ""
 
-#: declarative/qml/qdeclarativevme.cpp:910
-msgctxt "QDeclarativeVME"
-msgid "Unable to create attached object"
+#: network/ssl/qsslsocket_openssl.cpp:1151
+#: network/ssl/qsslsocket_openssl.cpp:1161
+#, qt-format
+msgid "Error while reading: %1"
 msgstr ""
 
-#: declarative/qml/qdeclarativevme.cpp:942
+#: network/ssl/qsslsocket_openssl.cpp:1256
 #, qt-format
-msgctxt "QDeclarativeVME"
-msgid "Cannot set properties on %1 as it is null"
+msgid "Error during SSL handshake: %1"
 msgstr ""
 
-#: declarative/qml/qdeclarativetypeloader.cpp:919
+#: network/access/qnetworkaccesscachebackend.cpp:66
 #, qt-format
-msgid "Script %1 unavailable"
+msgctxt "QNetworkAccessCacheBackend"
+msgid "Error opening %1"
 msgstr ""
 
-#: declarative/qml/qdeclarativetypeloader.cpp:937
+#: network/access/qnetworkaccessdebugpipebackend.cpp:195
 #, qt-format
-msgid "Type %1 unavailable"
+msgctxt "QNetworkAccessDebugPipeBackend"
+msgid "Write error writing to %1: %2"
 msgstr ""
 
-#: declarative/qml/qdeclarativetypeloader.cpp:1113
+#: network/access/qnetworkaccessdebugpipebackend.cpp:255
 #, qt-format
-msgid "Namespace %1 cannot be used as a type"
+msgid "Socket error on %1: %2"
 msgstr ""
 
-#: declarative/qml/qdeclarativetypeloader.cpp:1115
+#: network/access/qnetworkaccessdebugpipebackend.cpp:270
 #, qt-format
-msgid "%1 %2"
+msgid "Remote host closed the connection prematurely on %1"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:185
-#: declarative/qml/qdeclarativecompiler.cpp:1853
-#: declarative/qml/qdeclarativecompiler.cpp:2058
-#: declarative/qml/qdeclarativecompiler.cpp:2139
-#: declarative/qml/qdeclarativecompiler.cpp:2214
-#: declarative/qml/qdeclarativecompiler.cpp:2796
-#, qt-format
-msgid "Invalid property assignment: \"%1\" is a read-only property"
+#: network/access/qnetworkaccesshttpbackend.cpp:429
+#: network/access/qnetworkaccessftpbackend.cpp:131
+msgid "No suitable proxy found"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:194
-msgid "Invalid property assignment: unknown enumeration"
+#: network/access/qnetworkreplydataimpl.cpp:95
+#, qt-format
+msgctxt "QNetworkAccessDataBackend"
+msgid "Invalid URI: %1"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:202
-msgid "Invalid property assignment: string expected"
+#: network/access/qnetworkreplyimpl.cpp:88
+#, qt-format
+msgctxt "QNetworkReply"
+msgid "Protocol \"%1\" is unknown"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:205
-msgid "Invalid property assignment: url expected"
+#: network/access/qnetworkreplyimpl.cpp:114
+#: network/access/qnetworkreplyimpl.cpp:305
+msgctxt "QNetworkReply"
+msgid "Network session error."
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:215
-msgid "Invalid property assignment: unsigned int expected"
+#: network/access/qnetworkreplyimpl.cpp:121
+msgctxt "QNetworkReply"
+msgid "backend start error."
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:226
-msgid "Invalid property assignment: int expected"
+#: network/access/qnetworkreplyimpl.cpp:763
+msgid "Temporary network failure."
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:230
-#: declarative/qml/qdeclarativecompiler.cpp:233
-msgid "Invalid property assignment: number expected"
+#: network/access/qnetworkreplyimpl.cpp:882
+#: network/access/qnetworkreplyimpl.cpp:912
+msgid "Operation canceled"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:239
-msgid "Invalid property assignment: color expected"
+#: network/access/qnetworkreplyimpl.cpp:1102
+msgctxt "QNetworkAccessManager"
+msgid "Network access is disabled."
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:247
-msgid "Invalid property assignment: date expected"
+#: network/access/qnetworkaccessfilebackend.cpp:108
+#: network/access/qnetworkreplyfileimpl.cpp:79
+#, qt-format
+msgctxt "QNetworkAccessFileBackend"
+msgid "Request for opening non-local file %1"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:254
-msgid "Invalid property assignment: time expected"
+#: network/access/qnetworkaccessfilebackend.cpp:153
+#: network/access/qnetworkreplyfileimpl.cpp:115
+#, qt-format
+msgctxt "QNetworkAccessFileBackend"
+msgid "Error opening %1: %2"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:261
-msgid "Invalid property assignment: datetime expected"
+#: network/access/qnetworkaccessfilebackend.cpp:191
+#, qt-format
+msgctxt "QNetworkAccessFileBackend"
+msgid "Write error writing to %1: %2"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:270
-msgid "Invalid property assignment: point expected"
+#: network/access/qnetworkaccessfilebackend.cpp:233
+#: network/access/qnetworkreplyfileimpl.cpp:102
+#, qt-format
+msgctxt "QNetworkAccessFileBackend"
+msgid "Cannot open %1: Path is a directory"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:278
-msgid "Invalid property assignment: size expected"
+#: network/access/qnetworkaccessfilebackend.cpp:254
+#, qt-format
+msgctxt "QNetworkAccessFileBackend"
+msgid "Read error reading from %1: %2"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:286
-msgid "Invalid property assignment: rect expected"
+#: network/access/qnetworkaccessftpbackend.cpp:145
+#, qt-format
+msgid "Cannot open %1: is a directory"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:291
-msgid "Invalid property assignment: boolean expected"
+#: network/access/qnetworkaccessftpbackend.cpp:244
+#, qt-format
+msgid "Logging in to %1 failed: authentication required"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:298
-msgid "Invalid property assignment: 3D vector expected"
+#: network/access/qnetworkaccessftpbackend.cpp:283
+#, qt-format
+msgid "Error while downloading %1: %2"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:307
+#: network/access/qnetworkaccessftpbackend.cpp:285
 #, qt-format
-msgid "Invalid property assignment: unsupported type \"%1\""
+msgid "Error while uploading %1: %2"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:589
-msgid "Element is not creatable."
+#: network/socket/qudpsocket.cpp:199
+msgid "This platform does not support IPv6"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1239
-msgid "Component elements may not contain properties other than id"
+#: network/socket/qabstractsocket.cpp:552
+#: network/socket/qabstractsocket.cpp:1389
+#: network/socket/qabstractsocket.cpp:1614 network/socket/qtcpserver.cpp:292
+#: network/socket/qtcpserver.cpp:421
+msgid "Operation on socket is not supported"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1246
-msgid "Invalid component id specification"
+#: network/socket/qabstractsocket.cpp:925
+#: network/socket/qsocks5socketengine.cpp:668
+#: network/socket/qsocks5socketengine.cpp:694
+#: network/kernel/qhostinfo_unix.cpp:264 network/kernel/qhostinfo_unix.cpp:296
+#: network/kernel/qhostinfo_win.cpp:206 network/kernel/qhostinfo_win.cpp:233
+#: network/kernel/qhostinfo_symbian.cpp:73
+msgid "Host not found"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1252
-#: declarative/qml/qdeclarativecompiler.cpp:1767
-msgid "id is not unique"
+#: network/socket/qabstractsocket.cpp:975
+#: network/socket/qnativesocketengine.cpp:240
+#: network/socket/qsocks5socketengine.cpp:698
+#: network/socket/qsymbiansocketengine.cpp:1393
+msgid "Connection refused"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1262
-msgid "Invalid component body specification"
+#: network/socket/qabstractsocket.cpp:1117
+#: network/socket/qnativesocketengine.cpp:237
+#: network/socket/qsymbiansocketengine.cpp:1390
+msgid "Connection timed out"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1265
-msgid "Component objects cannot declare new properties."
+#: network/socket/qabstractsocket.cpp:1833
+msgid "Socket operation timed out"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1267
-msgid "Component objects cannot declare new signals."
+#: network/socket/qabstractsocket.cpp:2270
+msgid "Socket is not connected"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1269
-msgid "Component objects cannot declare new functions."
+#: network/socket/qnativesocketengine.cpp:201
+#: network/socket/qsymbiansocketengine.cpp:1354
+msgid "Unable to initialize non-blocking socket"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1276
-msgid "Cannot create empty component specification"
+#: network/socket/qnativesocketengine.cpp:204
+#: network/socket/qsymbiansocketengine.cpp:1357
+msgid "Unable to initialize broadcast socket"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1364
-#: declarative/qml/qdeclarativecompiler.cpp:1485
-#, qt-format
-msgid "\"%1.%2\" is not available in %3 %4.%5."
+#: network/socket/qnativesocketengine.cpp:207
+#: network/socket/qsymbiansocketengine.cpp:1360
+msgid "Attempt to use IPv6 socket on a platform with no IPv6 support"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1366
-#: declarative/qml/qdeclarativecompiler.cpp:1487
-#, qt-format
-msgid "\"%1.%2\" is not available due to component versioning."
+#: network/socket/qnativesocketengine.cpp:210
+#: network/socket/qsymbiansocketengine.cpp:1363
+msgid "The remote host closed the connection"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1377
-msgid "Incorrectly specified signal assignment"
+#: network/socket/qnativesocketengine.cpp:213
+#: network/socket/qsymbiansocketengine.cpp:1366
+msgid "Network operation timed out"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1389
-msgid "Cannot assign a value to a signal (expecting a script to be run)"
+#: network/socket/qnativesocketengine.cpp:216
+#: network/socket/qsymbiansocketengine.cpp:1369
+msgid "Out of resources"
+msgstr ""
+
+#: network/socket/qnativesocketengine.cpp:219
+#: network/socket/qsymbiansocketengine.cpp:1372
+msgid "Unsupported socket operation"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1393
-msgid "Empty signal assignment"
+#: network/socket/qnativesocketengine.cpp:222
+#: network/socket/qsymbiansocketengine.cpp:1375
+msgid "Protocol type not supported"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1431
-msgid "Empty property assignment"
+#: network/socket/qnativesocketengine.cpp:225
+#: network/socket/qsymbiansocketengine.cpp:1378
+msgid "Invalid socket descriptor"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1443
-msgid "Attached properties cannot be used here"
+#: network/socket/qnativesocketengine.cpp:228
+#: network/socket/qsymbiansocketengine.cpp:1381
+msgid "Host unreachable"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1457
-#: declarative/qml/qdeclarativecompiler.cpp:1585
-msgid "Non-existent attached object"
+#: network/socket/qnativesocketengine.cpp:231
+#: network/socket/qsocks5socketengine.cpp:690
+#: network/socket/qsymbiansocketengine.cpp:1384
+msgid "Network unreachable"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1461
-#: declarative/qml/qdeclarativecompiler.cpp:1588
-msgid "Invalid attached object assignment"
+#: network/socket/qnativesocketengine.cpp:243
+#: network/socket/qsymbiansocketengine.cpp:1396
+msgid "The bound address is already in use"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1540
-msgid "Cannot assign to non-existent default property"
+#: network/socket/qnativesocketengine.cpp:246
+#: network/socket/qsymbiansocketengine.cpp:1399
+msgid "The address is not available"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1572
-msgid "Invalid use of namespace"
+#: network/socket/qnativesocketengine.cpp:249
+#: network/socket/qsymbiansocketengine.cpp:1402
+msgid "The address is protected"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1577
-msgid "Not an attached property name"
+#: network/socket/qnativesocketengine.cpp:252
+#: network/socket/qsymbiansocketengine.cpp:1405
+msgid "Datagram was too large to send"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1759
-msgid "Invalid use of id property"
+#: network/socket/qnativesocketengine.cpp:255
+#: network/socket/qsymbiansocketengine.cpp:1408
+msgid "Unable to send a message"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1846
-#: declarative/qml/qdeclarativecompiler.cpp:1848
-msgid "Property has already been assigned a value"
+#: network/socket/qnativesocketengine.cpp:258
+#: network/socket/qsymbiansocketengine.cpp:1411
+msgid "Unable to receive a message"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1866
-#: declarative/qml/qdeclarativecompiler.cpp:1873
-msgid "Invalid grouped property access"
+#: network/socket/qnativesocketengine.cpp:261
+#: network/socket/qsymbiansocketengine.cpp:1414
+msgid "Unable to write"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1876
-msgid "Cannot assign a value directly to a grouped property"
+#: network/socket/qnativesocketengine.cpp:264
+#: network/socket/qsymbiansocketengine.cpp:1417
+msgid "Network error"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1892
-msgid "Invalid property use"
+#: network/socket/qnativesocketengine.cpp:267
+#: network/socket/qsymbiansocketengine.cpp:1420
+msgid "Another socket is already listening on the same port"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1907
-msgid "Property assignment expected"
+#: network/socket/qnativesocketengine.cpp:270
+#: network/socket/qsymbiansocketengine.cpp:1423
+msgid "Operation on non-socket"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1910
-msgid "Single property assignment expected"
+#: network/socket/qnativesocketengine.cpp:273
+#: network/socket/qsymbiansocketengine.cpp:1426
+msgid "The proxy type is invalid for this operation"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1915
-msgid "Unexpected object assignment"
+#: network/socket/qsocks5socketengine.cpp:623
+msgid "Connection to proxy refused"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1980
-msgid "Cannot assign object to list"
+#: network/socket/qsocks5socketengine.cpp:627
+msgid "Connection to proxy closed prematurely"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1986
-msgid "Can only assign one binding to lists"
+#: network/socket/qsocks5socketengine.cpp:631
+msgid "Proxy host not found"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:1992
-msgid "Cannot assign primitives to lists"
+#: network/socket/qsocks5socketengine.cpp:636
+msgid "Connection to proxy timed out"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2005
-msgid "Cannot assign multiple values to a script property"
+#: network/socket/qsocks5socketengine.cpp:653
+msgid "Proxy authentication failed"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2008
-msgid "Invalid property assignment: script expected"
+#: network/socket/qsocks5socketengine.cpp:654
+#, qt-format
+msgid "Proxy authentication failed: %1"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2023
-msgid "Cannot assign multiple values to a singular property"
+#: network/socket/qsocks5socketengine.cpp:663
+msgid "SOCKS version 5 protocol error"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2116
-msgid "Cannot assign object to property"
+#: network/socket/qsocks5socketengine.cpp:682
+msgid "General SOCKSv5 server failure"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2166
-#, qt-format
-msgid "\"%1\" cannot operate on \"%2\""
+#: network/socket/qsocks5socketengine.cpp:686
+msgid "Connection not allowed by SOCKSv5 server"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2330
-msgid "Duplicate default property"
+#: network/socket/qsocks5socketengine.cpp:702
+msgid "TTL expired"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2335
-msgid "Duplicate property name"
+#: network/socket/qsocks5socketengine.cpp:706
+msgid "SOCKSv5 command not supported"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2339
-msgid "Property names cannot begin with an upper case letter"
+#: network/socket/qsocks5socketengine.cpp:710
+msgid "Address type not supported"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2342
-msgid "Illegal property name"
+#: network/socket/qsocks5socketengine.cpp:715
+#, qt-format
+msgid "Unknown SOCKSv5 proxy error code 0x%1"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2350
-msgid "Duplicate signal name"
+#: network/socket/qsocks5socketengine.cpp:1409
+msgctxt "QSocks5SocketEngine"
+msgid "Network operation timed out"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2353
-msgid "Signal names cannot begin with an upper case letter"
+#: network/socket/qsymbiansocketengine.cpp:1429
+msgid "The address is invalid for this operation"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2355
-msgid "Illegal signal name"
+#: network/socket/qsymbiansocketengine.cpp:1432
+msgid "The specified network session is not opened"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2361
-msgid "Duplicate method name"
+#: network/bearer/qnetworksession.cpp:456
+msgid "Invalid configuration."
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2364
-msgid "Method names cannot begin with an upper case letter"
+#: network/kernel/qhostinfo_unix.cpp:196
+#: network/kernel/qhostinfo_symbian.cpp:137
+#: network/kernel/qhostinfo_symbian.cpp:287
+msgctxt "QHostInfoAgent"
+msgid "No host name given"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2366
-msgid "Illegal method name"
+#: network/kernel/qhostinfo_unix.cpp:197
+#: network/kernel/qhostinfo_symbian.cpp:138
+#: network/kernel/qhostinfo_symbian.cpp:288
+msgctxt "QHostInfoAgent"
+msgid "Invalid hostname"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2387
-msgid "Property value set multiple times"
+#: network/kernel/qhostinfo_unix.cpp:251 network/kernel/qhostinfo_unix.cpp:290
+#: network/kernel/qhostinfo_win.cpp:199 network/kernel/qhostinfo_win.cpp:228
+msgid "Unknown address type"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2391
-msgid "Invalid property nesting"
+#: network/kernel/qhostinfo_win.cpp:169
+msgid "No host name given"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2443
-msgid "Cannot override FINAL property"
+#: network/kernel/qhostinfo_win.cpp:169
+msgid "Invalid hostname"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2466
-msgid "Invalid property type"
+#: network/kernel/qhostinfo.cpp:173
+msgctxt "QHostInfo"
+msgid "No host name given"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2643
-msgid "Invalid empty ID"
+#: corelib/io/qprocess_unix.cpp:401 corelib/io/qprocess_win.cpp:138
+msgid "Could not open input redirection for reading"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2646
-msgid "IDs cannot start with an uppercase letter"
+#: corelib/io/qprocess_unix.cpp:413 corelib/io/qprocess_win.cpp:158
+msgid "Could not open output redirection for writing"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2652
-msgid "IDs must start with a letter or underscore"
+#: corelib/io/qprocess_unix.cpp:685
+#, qt-format
+msgid "Resource error (fork failure): %1"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2654
-msgid "IDs must contain only letters, numbers, and underscores"
+#: corelib/io/qprocess_unix.cpp:1035 corelib/io/qprocess_unix.cpp:1090
+#: corelib/io/qprocess_unix.cpp:1168 corelib/io/qprocess_unix.cpp:1238
+#: corelib/io/qprocess_win.cpp:591 corelib/io/qprocess_win.cpp:641
+#: corelib/io/qprocess_win.cpp:716 corelib/io/qprocess_win.cpp:758
+#: corelib/io/qprocess_win.cpp:812
+msgid "Process operation timed out"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2660
-msgid "ID illegally masks global JavaScript property"
+#: corelib/io/qprocess.cpp:887 corelib/io/qprocess.cpp:939
+#: corelib/io/qprocess_win.cpp:601 corelib/io/qprocess_win.cpp:651
+msgid "Error reading from process"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2691
-#: declarative/qml/qdeclarativecompiler.cpp:2700
-msgid "No property alias location"
+#: corelib/io/qprocess.cpp:986 corelib/io/qprocess.cpp:1854
+#: corelib/io/qprocess_win.cpp:791
+msgid "Error writing to process"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2696
-#: declarative/qml/qdeclarativecompiler.cpp:2721
-#: declarative/qml/qdeclarativecompiler.cpp:2728
-#: declarative/qml/qdeclarativecompiler.cpp:2735
-#: declarative/qml/qdeclarativecompiler.cpp:2741
-msgid "Invalid alias location"
+#: corelib/io/qprocess.cpp:1055
+msgid "Process crashed"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2705
-msgid ""
-"Invalid alias reference. An alias reference must be specified as <id>, "
-"<id>.<property> or <id>.<value property>.<property>"
+#: corelib/io/qprocess.cpp:2056
+msgid "No program defined"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2708
-#, qt-format
-msgid "Invalid alias reference. Unable to find id \"%1\""
+#: corelib/io/qfile.cpp:736 corelib/io/qfile.cpp:890
+msgid "Destination file exists"
 msgstr ""
 
-#: declarative/qml/qdeclarativecompiler.cpp:2723
-msgid "Alias property exceeds alias bounds"
+#: corelib/io/qfile.cpp:751
+msgid "Will not rename sequential file using block copy"
 msgstr ""
 
-#: declarative/qml/qdeclarativeimport.cpp:390
-#, qt-format
-msgid "plugin cannot be loaded for module \"%1\": %2"
+#: corelib/io/qfile.cpp:774
+msgid "Cannot remove source file"
 msgstr ""
 
-#: declarative/qml/qdeclarativeimport.cpp:395
+#: corelib/io/qfile.cpp:903
 #, qt-format
-msgid "module \"%1\" plugin \"%2\" not found"
+msgid "Cannot open %1 for input"
 msgstr ""
 
-#: declarative/qml/qdeclarativeimport.cpp:529
-#: declarative/qml/qdeclarativeimport.cpp:597
-#, qt-format
-msgid "module \"%1\" version %2.%3 is not installed"
+#: corelib/io/qfile.cpp:921
+msgid "Cannot open for output"
 msgstr ""
 
-#: declarative/qml/qdeclarativeimport.cpp:531
-#, qt-format
-msgid "module \"%1\" is not installed"
+#: corelib/io/qfile.cpp:932
+msgid "Failure to write block"
 msgstr ""
 
-#: declarative/qml/qdeclarativeimport.cpp:545
-#: declarative/qml/qdeclarativeimport.cpp:565
+#: corelib/io/qfile.cpp:946
 #, qt-format
-msgid "\"%1\": no such directory"
+msgid "Cannot create %1 for output"
 msgstr ""
 
-#: declarative/qml/qdeclarativeimport.cpp:563
-#, qt-format
-msgid "import \"%1\" has no qmldir and no namespace"
+#: corelib/io/qfile.cpp:1416
+msgid "No file engine available or engine does not support UnMapExtension"
 msgstr ""
 
-#: declarative/qml/qdeclarativeimport.cpp:622
+#: corelib/io/qprocess_win.cpp:431
 #, qt-format
-msgid "- %1 is not a namespace"
-msgstr ""
-
-#: declarative/qml/qdeclarativeimport.cpp:628
-msgid "- nested namespaces not allowed"
+msgid "Process failed to start: %1"
 msgstr ""
 
-#: declarative/qml/qdeclarativeimport.cpp:675
-#: declarative/qml/qdeclarativeimport.cpp:679
-msgid "local directory"
+#: corelib/tools/qregexp.cpp:65
+msgctxt "QRegExp"
+msgid "no error occurred"
 msgstr ""
 
-#: declarative/qml/qdeclarativeimport.cpp:685
-#, qt-format
-msgid "is ambiguous. Found in %1 and in %2"
+#: corelib/tools/qregexp.cpp:66
+msgctxt "QRegExp"
+msgid "disabled feature used"
 msgstr ""
 
-#: declarative/qml/qdeclarativeimport.cpp:689
-#, qt-format
-msgid "is ambiguous. Found in %1 in version %2.%3 and %4.%5"
+#: corelib/tools/qregexp.cpp:67
+msgctxt "QRegExp"
+msgid "bad char class syntax"
 msgstr ""
 
-#: declarative/qml/qdeclarativeimport.cpp:703
-msgid "is instantiated recursively"
+#: corelib/tools/qregexp.cpp:68
+msgctxt "QRegExp"
+msgid "bad lookahead syntax"
 msgstr ""
 
-#: declarative/qml/qdeclarativeimport.cpp:705
-msgid "is not a type"
+#: corelib/tools/qregexp.cpp:69
+msgctxt "QRegExp"
+msgid "lookbehinds not supported, see QTBUG-2371"
 msgstr ""
 
-#: declarative/qml/qdeclarativeimport.cpp:1041
-#, qt-format
-msgid "File name case mismatch for \"%1\""
+#: corelib/tools/qregexp.cpp:70
+msgctxt "QRegExp"
+msgid "bad repetition syntax"
 msgstr ""
 
-#: declarative/qml/qdeclarativesqldatabase.cpp:211
-msgid "executeSql called outside transaction()"
+#: corelib/tools/qregexp.cpp:71
+msgctxt "QRegExp"
+msgid "invalid octal value"
 msgstr ""
 
-#: declarative/qml/qdeclarativesqldatabase.cpp:269
-msgid "Read-only Transaction"
+#: corelib/tools/qregexp.cpp:72
+msgctxt "QRegExp"
+msgid "missing left delim"
 msgstr ""
 
-#: declarative/qml/qdeclarativesqldatabase.cpp:289
-#, qt-format
-msgid "Version mismatch: expected %1, found %2"
+#: corelib/tools/qregexp.cpp:73
+msgctxt "QRegExp"
+msgid "unexpected end"
 msgstr ""
 
-#: declarative/qml/qdeclarativesqldatabase.cpp:303
-msgid "SQL transaction failed"
+#: corelib/tools/qregexp.cpp:74
+msgctxt "QRegExp"
+msgid "met internal limit"
 msgstr ""
 
-#: declarative/qml/qdeclarativesqldatabase.cpp:326
-msgid "transaction: missing callback"
+#: corelib/tools/qregexp.cpp:75
+msgctxt "QRegExp"
+msgid "invalid interval"
 msgstr ""
 
-#: declarative/qml/qdeclarativesqldatabase.cpp:386
-#: declarative/qml/qdeclarativesqldatabase.cpp:401
-msgid "SQL: database version mismatch"
+#: corelib/tools/qregexp.cpp:76
+msgctxt "QRegExp"
+msgid "invalid category"
 msgstr ""
 
 #: corelib/xml/qxmlstream.cpp:611
@@ -9508,198 +9646,77 @@
 msgid "Expected character data."
 msgstr ""
 
-#: corelib/kernel/qsharedmemory_win.cpp:71
-#: corelib/kernel/qsharedmemory_symbian.cpp:70
-#: corelib/kernel/qsharedmemory_unix.cpp:95
-#, qt-format
-msgid "%1: already exists"
-msgstr ""
-
-#: corelib/kernel/qsharedmemory_win.cpp:80
-#: corelib/kernel/qsharedmemory_unix.cpp:99
-#, qt-format
-msgid "%1: doesn't exist"
-msgstr ""
-
-#: corelib/kernel/qsharedmemory_win.cpp:84
-#: corelib/kernel/qsharedmemory_symbian.cpp:78
-#: corelib/kernel/qsharedmemory_unix.cpp:111
-#, qt-format
-msgid "%1: invalid size"
-msgstr ""
-
-#: corelib/kernel/qsharedmemory_win.cpp:89
-#: corelib/kernel/qsharedmemory_symbian.cpp:82
-#: corelib/kernel/qsharedmemory_unix.cpp:107
-#, qt-format
-msgid "%1: out of resources"
-msgstr ""
-
-#: corelib/kernel/qsharedmemory_win.cpp:93
-#: corelib/kernel/qsharedmemory_symbian.cpp:86
-#: corelib/kernel/qsharedmemory_unix.cpp:91
-#, qt-format
-msgid "%1: permission denied"
-msgstr ""
-
-#: corelib/kernel/qsharedmemory_win.cpp:96
-#: corelib/kernel/qsharedmemory_symbian.cpp:89
-#: corelib/kernel/qsharedmemory_unix.cpp:115
-#, qt-format
-msgid "%1: unknown error %2"
-msgstr ""
-
-#: corelib/kernel/qsharedmemory_win.cpp:111
-#: corelib/kernel/qsharedmemory_win.cpp:139
-#: corelib/kernel/qsharedmemory_symbian.cpp:103
-#: corelib/kernel/qsharedmemory_unix.cpp:138
-#: corelib/kernel/qsharedmemory_unix.cpp:164
-#, qt-format
-msgid "%1: key is empty"
-msgstr ""
-
-#: corelib/kernel/qsharedmemory_win.cpp:168
-#, qt-format
-msgid "%1: size query failed"
-msgstr ""
-
-#: corelib/kernel/qsystemsemaphore_win.cpp:68
-#: corelib/kernel/qsystemsemaphore_symbian.cpp:77
-#: corelib/kernel/qsystemsemaphore_unix.cpp:104
-#, qt-format
-msgctxt "QSystemSemaphore"
-msgid "%1: out of resources"
-msgstr ""
-
-#: corelib/kernel/qsystemsemaphore_win.cpp:72
-#: corelib/kernel/qsystemsemaphore_symbian.cpp:81
-#: corelib/kernel/qsystemsemaphore_unix.cpp:87
-#, qt-format
-msgctxt "QSystemSemaphore"
-msgid "%1: permission denied"
-msgstr ""
-
-#: corelib/kernel/qsystemsemaphore_win.cpp:75
-#: corelib/kernel/qsystemsemaphore_symbian.cpp:85
-#: corelib/kernel/qsystemsemaphore_unix.cpp:112
-#, qt-format
-msgctxt "QSystemSemaphore"
-msgid "%1: unknown error %2"
-msgstr ""
-
-#: corelib/kernel/qsystemsemaphore_symbian.cpp:68
-#: corelib/kernel/qsystemsemaphore_unix.cpp:91
-#, qt-format
-msgctxt "QSystemSemaphore"
-msgid "%1: already exists"
-msgstr ""
-
-#: corelib/kernel/qsystemsemaphore_symbian.cpp:72
-#: corelib/kernel/qsystemsemaphore_unix.cpp:95
-#, qt-format
-msgctxt "QSystemSemaphore"
-msgid "%1: does not exist"
-msgstr ""
-
-#: corelib/kernel/qsystemerror.cpp:87 corelib/global/qglobal.cpp:2106
-msgctxt "QIODevice"
-msgid "Permission denied"
-msgstr ""
-
-#: corelib/kernel/qsystemerror.cpp:90 corelib/global/qglobal.cpp:2109
-msgctxt "QIODevice"
-msgid "Too many open files"
-msgstr ""
-
-#: corelib/kernel/qsystemerror.cpp:93 corelib/global/qglobal.cpp:2112
-msgctxt "QIODevice"
-msgid "No such file or directory"
-msgstr ""
-
-#: corelib/kernel/qsystemerror.cpp:96 corelib/global/qglobal.cpp:2115
-msgctxt "QIODevice"
-msgid "No space left on device"
-msgstr ""
-
-#: corelib/kernel/qsharedmemory_symbian.cpp:74
-#, qt-format
-msgid "%1: doesn't exists"
-msgstr ""
-
-#: corelib/kernel/qsharedmemory_unix.cpp:145
-#, qt-format
-msgid "%1: UNIX key file doesn't exist"
-msgstr ""
-
-#: corelib/kernel/qsharedmemory_unix.cpp:152
-#, qt-format
-msgid "%1: ftok failed"
+#: corelib/plugin/qpluginloader.cpp:254
+msgid "The plugin was not loaded."
 msgstr ""
 
-#: corelib/kernel/qsharedmemory_unix.cpp:227
-#, qt-format
-msgid "%1: unable to make key"
+#: corelib/plugin/qpluginloader.cpp:343 corelib/plugin/qlibrary.cpp:679
+#: corelib/plugin/qlibrary.cpp:825
+msgid "The shared library was not found."
 msgstr ""
 
-#: corelib/kernel/qsharedmemory_unix.cpp:245
+#: corelib/plugin/qlibrary.cpp:402
 #, qt-format
-msgid "%1: system-imposed size restrictions"
+msgid "Plugin verification data mismatch in '%1'"
 msgstr ""
 
-#: corelib/kernel/qsharedmemory_unix.cpp:268
-#: corelib/kernel/qsharedmemory_unix.cpp:330
+#: corelib/plugin/qlibrary.cpp:827
 #, qt-format
-msgid "%1: bad name"
+msgid "The file '%1' is not a valid Qt plugin."
 msgstr ""
 
-#: corelib/kernel/qsharedmemory_unix.cpp:372
+#: corelib/plugin/qlibrary.cpp:842
 #, qt-format
-msgid "%1: not attached"
+msgid "The plugin '%1' uses incompatible Qt library. (%2.%3.%4) [%5]"
 msgstr ""
 
-#: corelib/kernel/qsystemsemaphore_unix.cpp:108
+#: corelib/plugin/qlibrary.cpp:868
 #, qt-format
-msgctxt "QSystemSemaphore"
-msgid "%1: name error"
+msgid ""
+"The plugin '%1' uses incompatible Qt library. Expected build key \"%2\", got "
+"\"%3\""
 msgstr ""
 
-#: corelib/kernel/qsystemsemaphore_unix.cpp:133
-#: corelib/kernel/qsystemsemaphore_unix.cpp:195
+#: corelib/plugin/qlibrary.cpp:876
 #, qt-format
-msgctxt "QSystemSemaphore"
-msgid "%1: key is empty"
+msgid ""
+"The plugin '%1' uses incompatible Qt library. (Cannot mix debug and release "
+"libraries.)"
 msgstr ""
 
-#: corelib/kernel/qsystemsemaphore_unix.cpp:141
+#: corelib/plugin/qlibrary_unix.cpp:244 corelib/plugin/qlibrary_win.cpp:87
 #, qt-format
-msgctxt "QSystemSemaphore"
-msgid "%1: unable to make key"
+msgid "Cannot load library %1: %2"
 msgstr ""
 
-#: corelib/kernel/qsystemsemaphore_unix.cpp:150
+#: corelib/plugin/qlibrary_unix.cpp:261 corelib/plugin/qlibrary_win.cpp:109
 #, qt-format
-msgctxt "QSystemSemaphore"
-msgid "%1: ftok failed"
+msgid "Cannot unload library %1: %2"
 msgstr ""
 
-#: corelib/kernel/qsharedmemory.cpp:268
+#: corelib/plugin/qlibrary_unix.cpp:295 corelib/plugin/qlibrary_win.cpp:124
 #, qt-format
-msgid "%1: unable to set key on lock"
+msgid "Cannot resolve symbol \"%1\" in %2: %3"
 msgstr ""
 
-#: corelib/kernel/qsharedmemory.cpp:352
+#: corelib/plugin/qelfparser_p.cpp:77
 #, qt-format
-msgid "%1: create size is less then 0"
+msgid "'%1' is not an ELF object (%2)"
 msgstr ""
 
-#: corelib/kernel/qsharedmemory.cpp:528
+#: corelib/plugin/qelfparser_p.cpp:83
 #, qt-format
-msgid "%1: unable to lock"
+msgid "'%1' is not an ELF object"
 msgstr ""
 
-#: corelib/kernel/qsharedmemory.cpp:550
+#: corelib/plugin/qelfparser_p.cpp:89 corelib/plugin/qelfparser_p.cpp:99
+#: corelib/plugin/qelfparser_p.cpp:105 corelib/plugin/qelfparser_p.cpp:125
+#: corelib/plugin/qelfparser_p.cpp:137 corelib/plugin/qelfparser_p.cpp:148
+#: corelib/plugin/qelfparser_p.cpp:163 corelib/plugin/qelfparser_p.cpp:174
+#: corelib/plugin/qelfparser_p.cpp:196 corelib/plugin/qelfparser_p.cpp:210
+#: corelib/plugin/qelfparser_p.cpp:223
 #, qt-format
-msgid "%1: unable to unlock"
+msgid "'%1' is an invalid ELF object (%2)"
 msgstr ""
 
 #: corelib/statemachine/qstatemachine.cpp:1028
@@ -9718,213 +9735,196 @@
 "No common ancestor for targets and source of transition from state '%1'"
 msgstr ""
 
-#: corelib/io/qprocess.cpp:887 corelib/io/qprocess.cpp:939
-#: corelib/io/qprocess_win.cpp:601 corelib/io/qprocess_win.cpp:651
-msgid "Error reading from process"
-msgstr ""
-
-#: corelib/io/qprocess.cpp:986 corelib/io/qprocess.cpp:1854
-#: corelib/io/qprocess_win.cpp:791
-msgid "Error writing to process"
-msgstr ""
-
-#: corelib/io/qprocess.cpp:1055
-msgid "Process crashed"
+#: corelib/global/qglobal.cpp:2106 corelib/kernel/qsystemerror.cpp:87
+msgctxt "QIODevice"
+msgid "Permission denied"
 msgstr ""
 
-#: corelib/io/qprocess.cpp:2056
-msgid "No program defined"
+#: corelib/global/qglobal.cpp:2109 corelib/kernel/qsystemerror.cpp:90
+msgctxt "QIODevice"
+msgid "Too many open files"
 msgstr ""
 
-#: corelib/io/qprocess_unix.cpp:401 corelib/io/qprocess_win.cpp:138
-msgid "Could not open input redirection for reading"
+#: corelib/global/qglobal.cpp:2112 corelib/kernel/qsystemerror.cpp:93
+msgctxt "QIODevice"
+msgid "No such file or directory"
 msgstr ""
 
-#: corelib/io/qprocess_unix.cpp:413 corelib/io/qprocess_win.cpp:158
-msgid "Could not open output redirection for writing"
+#: corelib/global/qglobal.cpp:2115 corelib/kernel/qsystemerror.cpp:96
+msgctxt "QIODevice"
+msgid "No space left on device"
 msgstr ""
 
-#: corelib/io/qprocess_unix.cpp:685
+#: corelib/kernel/qsharedmemory_symbian.cpp:70
+#: corelib/kernel/qsharedmemory_unix.cpp:95
+#: corelib/kernel/qsharedmemory_win.cpp:71
 #, qt-format
-msgid "Resource error (fork failure): %1"
-msgstr ""
-
-#: corelib/io/qprocess_unix.cpp:1035 corelib/io/qprocess_unix.cpp:1090
-#: corelib/io/qprocess_unix.cpp:1168 corelib/io/qprocess_unix.cpp:1238
-#: corelib/io/qprocess_win.cpp:591 corelib/io/qprocess_win.cpp:641
-#: corelib/io/qprocess_win.cpp:716 corelib/io/qprocess_win.cpp:758
-#: corelib/io/qprocess_win.cpp:812
-msgid "Process operation timed out"
-msgstr ""
-
-#: corelib/io/qfile.cpp:736 corelib/io/qfile.cpp:890
-msgid "Destination file exists"
-msgstr ""
-
-#: corelib/io/qfile.cpp:751
-msgid "Will not rename sequential file using block copy"
-msgstr ""
-
-#: corelib/io/qfile.cpp:774
-msgid "Cannot remove source file"
+msgid "%1: already exists"
 msgstr ""
 
-#: corelib/io/qfile.cpp:903
+#: corelib/kernel/qsharedmemory_symbian.cpp:74
 #, qt-format
-msgid "Cannot open %1 for input"
-msgstr ""
-
-#: corelib/io/qfile.cpp:921
-msgid "Cannot open for output"
-msgstr ""
-
-#: corelib/io/qfile.cpp:932
-msgid "Failure to write block"
+msgid "%1: doesn't exists"
 msgstr ""
 
-#: corelib/io/qfile.cpp:946
+#: corelib/kernel/qsharedmemory_symbian.cpp:78
+#: corelib/kernel/qsharedmemory_unix.cpp:111
+#: corelib/kernel/qsharedmemory_win.cpp:84
 #, qt-format
-msgid "Cannot create %1 for output"
-msgstr ""
-
-#: corelib/io/qfile.cpp:1416
-msgid "No file engine available or engine does not support UnMapExtension"
+msgid "%1: invalid size"
 msgstr ""
 
-#: corelib/io/qprocess_win.cpp:431
+#: corelib/kernel/qsharedmemory_symbian.cpp:82
+#: corelib/kernel/qsharedmemory_unix.cpp:107
+#: corelib/kernel/qsharedmemory_win.cpp:89
 #, qt-format
-msgid "Process failed to start: %1"
+msgid "%1: out of resources"
 msgstr ""
 
-#: corelib/plugin/qelfparser_p.cpp:77
+#: corelib/kernel/qsharedmemory_symbian.cpp:86
+#: corelib/kernel/qsharedmemory_unix.cpp:91
+#: corelib/kernel/qsharedmemory_win.cpp:93
 #, qt-format
-msgid "'%1' is not an ELF object (%2)"
+msgid "%1: permission denied"
 msgstr ""
 
-#: corelib/plugin/qelfparser_p.cpp:83
+#: corelib/kernel/qsharedmemory_symbian.cpp:89
+#: corelib/kernel/qsharedmemory_unix.cpp:115
+#: corelib/kernel/qsharedmemory_win.cpp:96
 #, qt-format
-msgid "'%1' is not an ELF object"
+msgid "%1: unknown error %2"
 msgstr ""
 
-#: corelib/plugin/qelfparser_p.cpp:89 corelib/plugin/qelfparser_p.cpp:99
-#: corelib/plugin/qelfparser_p.cpp:105 corelib/plugin/qelfparser_p.cpp:125
-#: corelib/plugin/qelfparser_p.cpp:137 corelib/plugin/qelfparser_p.cpp:148
-#: corelib/plugin/qelfparser_p.cpp:163 corelib/plugin/qelfparser_p.cpp:174
-#: corelib/plugin/qelfparser_p.cpp:196 corelib/plugin/qelfparser_p.cpp:210
-#: corelib/plugin/qelfparser_p.cpp:223
+#: corelib/kernel/qsharedmemory_symbian.cpp:103
+#: corelib/kernel/qsharedmemory_unix.cpp:138
+#: corelib/kernel/qsharedmemory_unix.cpp:164
+#: corelib/kernel/qsharedmemory_win.cpp:111
+#: corelib/kernel/qsharedmemory_win.cpp:139
 #, qt-format
-msgid "'%1' is an invalid ELF object (%2)"
+msgid "%1: key is empty"
 msgstr ""
 
-#: corelib/plugin/qlibrary.cpp:402
+#: corelib/kernel/qsharedmemory_unix.cpp:99
+#: corelib/kernel/qsharedmemory_win.cpp:80
 #, qt-format
-msgid "Plugin verification data mismatch in '%1'"
-msgstr ""
-
-#: corelib/plugin/qlibrary.cpp:679 corelib/plugin/qlibrary.cpp:825
-#: corelib/plugin/qpluginloader.cpp:343
-msgid "The shared library was not found."
+msgid "%1: doesn't exist"
 msgstr ""
 
-#: corelib/plugin/qlibrary.cpp:827
+#: corelib/kernel/qsharedmemory_unix.cpp:145
 #, qt-format
-msgid "The file '%1' is not a valid Qt plugin."
+msgid "%1: UNIX key file doesn't exist"
 msgstr ""
 
-#: corelib/plugin/qlibrary.cpp:842
+#: corelib/kernel/qsharedmemory_unix.cpp:152
 #, qt-format
-msgid "The plugin '%1' uses incompatible Qt library. (%2.%3.%4) [%5]"
+msgid "%1: ftok failed"
 msgstr ""
 
-#: corelib/plugin/qlibrary.cpp:868
+#: corelib/kernel/qsharedmemory_unix.cpp:227
 #, qt-format
-msgid ""
-"The plugin '%1' uses incompatible Qt library. Expected build key \"%2\", got "
-"\"%3\""
+msgid "%1: unable to make key"
 msgstr ""
 
-#: corelib/plugin/qlibrary.cpp:876
+#: corelib/kernel/qsharedmemory_unix.cpp:245
 #, qt-format
-msgid ""
-"The plugin '%1' uses incompatible Qt library. (Cannot mix debug and release "
-"libraries.)"
+msgid "%1: system-imposed size restrictions"
 msgstr ""
 
-#: corelib/plugin/qlibrary_win.cpp:87 corelib/plugin/qlibrary_unix.cpp:244
+#: corelib/kernel/qsharedmemory_unix.cpp:268
+#: corelib/kernel/qsharedmemory_unix.cpp:330
 #, qt-format
-msgid "Cannot load library %1: %2"
+msgid "%1: bad name"
 msgstr ""
 
-#: corelib/plugin/qlibrary_win.cpp:109 corelib/plugin/qlibrary_unix.cpp:261
+#: corelib/kernel/qsharedmemory_unix.cpp:372
 #, qt-format
-msgid "Cannot unload library %1: %2"
+msgid "%1: not attached"
 msgstr ""
 
-#: corelib/plugin/qlibrary_win.cpp:124 corelib/plugin/qlibrary_unix.cpp:295
+#: corelib/kernel/qsystemsemaphore_win.cpp:68
+#: corelib/kernel/qsystemsemaphore_unix.cpp:104
+#: corelib/kernel/qsystemsemaphore_symbian.cpp:77
 #, qt-format
-msgid "Cannot resolve symbol \"%1\" in %2: %3"
+msgctxt "QSystemSemaphore"
+msgid "%1: out of resources"
 msgstr ""
 
-#: corelib/plugin/qpluginloader.cpp:254
-msgid "The plugin was not loaded."
+#: corelib/kernel/qsystemsemaphore_win.cpp:72
+#: corelib/kernel/qsystemsemaphore_unix.cpp:87
+#: corelib/kernel/qsystemsemaphore_symbian.cpp:81
+#, qt-format
+msgctxt "QSystemSemaphore"
+msgid "%1: permission denied"
 msgstr ""
 
-#: corelib/tools/qregexp.cpp:65
-msgctxt "QRegExp"
-msgid "no error occurred"
+#: corelib/kernel/qsystemsemaphore_win.cpp:75
+#: corelib/kernel/qsystemsemaphore_unix.cpp:112
+#: corelib/kernel/qsystemsemaphore_symbian.cpp:85
+#, qt-format
+msgctxt "QSystemSemaphore"
+msgid "%1: unknown error %2"
 msgstr ""
 
-#: corelib/tools/qregexp.cpp:66
-msgctxt "QRegExp"
-msgid "disabled feature used"
+#: corelib/kernel/qsystemsemaphore_unix.cpp:91
+#: corelib/kernel/qsystemsemaphore_symbian.cpp:68
+#, qt-format
+msgctxt "QSystemSemaphore"
+msgid "%1: already exists"
 msgstr ""
 
-#: corelib/tools/qregexp.cpp:67
-msgctxt "QRegExp"
-msgid "bad char class syntax"
+#: corelib/kernel/qsystemsemaphore_unix.cpp:95
+#: corelib/kernel/qsystemsemaphore_symbian.cpp:72
+#, qt-format
+msgctxt "QSystemSemaphore"
+msgid "%1: does not exist"
 msgstr ""
 
-#: corelib/tools/qregexp.cpp:68
-msgctxt "QRegExp"
-msgid "bad lookahead syntax"
+#: corelib/kernel/qsystemsemaphore_unix.cpp:108
+#, qt-format
+msgctxt "QSystemSemaphore"
+msgid "%1: name error"
 msgstr ""
 
-#: corelib/tools/qregexp.cpp:69
-msgctxt "QRegExp"
-msgid "lookbehinds not supported, see QTBUG-2371"
+#: corelib/kernel/qsystemsemaphore_unix.cpp:133
+#: corelib/kernel/qsystemsemaphore_unix.cpp:195
+#, qt-format
+msgctxt "QSystemSemaphore"
+msgid "%1: key is empty"
 msgstr ""
 
-#: corelib/tools/qregexp.cpp:70
-msgctxt "QRegExp"
-msgid "bad repetition syntax"
+#: corelib/kernel/qsystemsemaphore_unix.cpp:141
+#, qt-format
+msgctxt "QSystemSemaphore"
+msgid "%1: unable to make key"
 msgstr ""
 
-#: corelib/tools/qregexp.cpp:71
-msgctxt "QRegExp"
-msgid "invalid octal value"
+#: corelib/kernel/qsystemsemaphore_unix.cpp:150
+#, qt-format
+msgctxt "QSystemSemaphore"
+msgid "%1: ftok failed"
 msgstr ""
 
-#: corelib/tools/qregexp.cpp:72
-msgctxt "QRegExp"
-msgid "missing left delim"
+#: corelib/kernel/qsharedmemory.cpp:268
+#, qt-format
+msgid "%1: unable to set key on lock"
 msgstr ""
 
-#: corelib/tools/qregexp.cpp:73
-msgctxt "QRegExp"
-msgid "unexpected end"
+#: corelib/kernel/qsharedmemory.cpp:352
+#, qt-format
+msgid "%1: create size is less then 0"
 msgstr ""
 
-#: corelib/tools/qregexp.cpp:74
-msgctxt "QRegExp"
-msgid "met internal limit"
+#: corelib/kernel/qsharedmemory.cpp:528
+#, qt-format
+msgid "%1: unable to lock"
 msgstr ""
 
-#: corelib/tools/qregexp.cpp:75
-msgctxt "QRegExp"
-msgid "invalid interval"
+#: corelib/kernel/qsharedmemory.cpp:550
+#, qt-format
+msgid "%1: unable to unlock"
 msgstr ""
 
-#: corelib/tools/qregexp.cpp:76
-msgctxt "QRegExp"
-msgid "invalid category"
+#: corelib/kernel/qsharedmemory_win.cpp:168
+#, qt-format
+msgid "%1: size query failed"
 msgstr ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdesudo.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdesudo.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdesudo.po	2012-02-23 06:20:19.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdesudo.po	2012-03-23 06:41:50.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:56+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:53+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: kdesudo/main.cpp:42
 msgid "KdeSudo"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdesud.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdesud.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdesud.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdesud.po	2012-03-23 06:41:57.000000000 +0000
@@ -12,16 +12,15 @@
 "Project-Id-Version: kdesud\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2011-12-12 19:27+0000\n"
+"PO-Revision-Date: 2012-03-14 17:33+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:49+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:51+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kdesud.cpp:263
 msgid "KDE su daemon"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdesu.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdesu.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdesu.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdesu.po	2012-03-23 06:41:57.000000000 +0000
@@ -9,21 +9,21 @@
 # AbdulAziz AlSharif <a.a-a.s@hotmail.com>, 2007.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kdesu\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:44+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
+"PO-Revision-Date: 2012-03-14 17:33+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
+"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:49+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Poedit-Language: Arabic\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:51+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: kdesu.cpp:85
 msgid "KDE su"
@@ -55,11 +55,11 @@
 
 #: kdesu.cpp:101
 msgid "Specifies the command to run as separate arguments"
-msgstr ""
+msgstr "يحدد الأمر المطلوب تنفيذه كمعامل منفصل"
 
 #: kdesu.cpp:102
 msgid "Specifies the command to run as one string"
-msgstr ""
+msgstr "يحدد الأمر المطلوب تنفيذه كنصّ واحد"
 
 #: kdesu.cpp:102
 msgid "Run command under target uid if <file> is not writable"
@@ -112,7 +112,7 @@
 #: kdesu.cpp:143
 #, kde-format
 msgid "Cannot execute command '%1'."
-msgstr ""
+msgstr "لا يمكن تنفيذ الأمر '%1'."
 
 #: kdesu.cpp:215
 #, kde-format
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdevcustommake.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdevcustommake.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdevcustommake.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdevcustommake.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,43 +0,0 @@
-# Arabic translation for kdevelop
-# Copyright (c) 2011 Rosetta Contributors and Canonical Ltd 2011
-# This file is distributed under the same license as the kdevelop package.
-# FIRST AUTHOR <EMAIL@ADDRESS>, 2011.
-#
-msgid ""
-msgstr ""
-"Project-Id-Version: kdevelop\n"
-"Report-Msgid-Bugs-To: FULL NAME <EMAIL@ADDRESS>\n"
-"POT-Creation-Date: 2011-07-30 13:47+0000\n"
-"PO-Revision-Date: 2011-06-27 12:29+0000\n"
-"Last-Translator: FULL NAME <EMAIL@ADDRESS>\n"
-"Language-Team: Arabic <ar@li.org>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:15+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-
-#: custommakemanager.cpp:38
-msgid "Custom Makefile Manager"
-msgstr ""
-
-#: custommakemanager.cpp:38
-msgid "Support for managing custom makefile projects"
-msgstr ""
-
-#: rc.cpp:1
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr " ,Launchpad Contributions:,ahmad mustafa"
-
-#: rc.cpp:2
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr ",,"
-
-#. i18n: file: kdevcustommakemanager.rc:5
-#. i18n: ectx: Menu (run)
-#: rc.cpp:5
-msgctxt "@title:menu"
-msgid "Run"
-msgstr ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdevfilemanager.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdevfilemanager.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdevfilemanager.po	2012-02-23 06:20:22.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdevfilemanager.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,65 +0,0 @@
-# Arabic translation for kdevplatform
-# Copyright (c) 2011 Rosetta Contributors and Canonical Ltd 2011
-# This file is distributed under the same license as the kdevplatform package.
-# FIRST AUTHOR <EMAIL@ADDRESS>, 2011.
-#
-msgid ""
-msgstr ""
-"Project-Id-Version: kdevplatform\n"
-"Report-Msgid-Bugs-To: FULL NAME <EMAIL@ADDRESS>\n"
-"POT-Creation-Date: 2011-07-30 11:53+0000\n"
-"PO-Revision-Date: 2011-03-17 00:28+0000\n"
-"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: Arabic <ar@li.org>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 01:00+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-
-#: filemanager.cpp:59 kdevfilemanagerplugin.cpp:82
-msgid "Filesystem"
-msgstr ""
-
-#: filemanager.cpp:60
-msgid "Filesystem Browser"
-msgstr ""
-
-#: filemanager.cpp:123
-msgid "Current Document Directory"
-msgstr ""
-
-#: filemanager.cpp:136
-msgid "New File..."
-msgstr ""
-
-#: filemanager.cpp:147
-msgid "Create New File"
-msgstr ""
-
-#: filemanager.cpp:148
-msgid "Filename:"
-msgstr ""
-
-#: filemanager.cpp:163
-#, kde-format
-msgid "Unable to create file '%1'"
-msgstr ""
-
-#: kdevfilemanagerplugin.cpp:37
-msgid "File Manager"
-msgstr ""
-
-#: kdevfilemanagerplugin.cpp:37
-msgid "Browse the filesystem"
-msgstr ""
-
-#: rc.cpp:1
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr " ,Launchpad Contributions:,mohskikda"
-
-#: rc.cpp:2
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr ",,"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdevgenericprojectmanager.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdevgenericprojectmanager.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdevgenericprojectmanager.po	2012-02-23 06:20:22.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdevgenericprojectmanager.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,48 +0,0 @@
-# Arabic translation for kdevplatform
-# Copyright (c) 2011 Rosetta Contributors and Canonical Ltd 2011
-# This file is distributed under the same license as the kdevplatform package.
-# FIRST AUTHOR <EMAIL@ADDRESS>, 2011.
-#
-msgid ""
-msgstr ""
-"Project-Id-Version: kdevplatform\n"
-"Report-Msgid-Bugs-To: FULL NAME <EMAIL@ADDRESS>\n"
-"POT-Creation-Date: 2011-07-30 11:53+0000\n"
-"PO-Revision-Date: 2011-03-17 00:21+0000\n"
-"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: Arabic <ar@li.org>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 01:01+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-
-#: genericmanager.cpp:34
-msgid "Generic Project Manager"
-msgstr ""
-
-#: genericmanager.cpp:35
-msgid "A plugin to support basic project management on a filesystem level"
-msgstr ""
-
-#: rc.cpp:1
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr " ,Launchpad Contributions:,mohskikda"
-
-#: rc.cpp:2
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr ",,"
-
-#. i18n: file: genericprojectmanagersettings.ui:17
-#. i18n: ectx: property (text), widget (QLabel, label)
-#: rc.cpp:5
-msgid "Include files match the following patterns into the project:"
-msgstr ""
-
-#. i18n: file: genericprojectmanagersettings.ui:27
-#. i18n: ectx: property (text), widget (QLabel, label_2)
-#: rc.cpp:8
-msgid "Exclude files that match the following patterns from the project:"
-msgstr ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdf.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdf.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdf.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdf.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,368 +0,0 @@
-# translation of kdf.po to
-# Copyright (C) 2002, 2004, 2006, 2007 Free Software Foundation, Inc.
-# Mohammed Gamal <f2c2001@yahoo.com>, 2002.
-# Ahmad M. Zawawi <azawawi@emirates.net.ae>, 2004.
-# Munzir Taha <munzir@kacst.edu.sa>, 2004.
-# Khaled Hosny <dr.khaled.hosny@gmail.com>, 2006.
-# Fahad Al-Saidi <fahad.alsaidi@gmail.com>, 2007.
-# Youssef Chahibi <chahibi@gmail.com>, 2007.
-# Youness BOUTYOUR <niceboy@linuxac.org>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-#
-msgid ""
-msgstr ""
-"Project-Id-Version: kdf\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 13:31+0000\n"
-"PO-Revision-Date: 2012-01-25 08:09+0000\n"
-"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:07+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"Language: ar\n"
-
-#: disklist.cpp:342
-#, kde-format
-msgid "could not execute [%1]"
-msgstr "تعذّر تنفيذ [%1]"
-
-#: disks.cpp:278
-#, kde-format
-msgid ""
-"Called: %1\n"
-"\n"
-msgstr ""
-"نودي: %1\n"
-"\n"
-
-#: disks.cpp:299
-#, kde-format
-msgid "could not execute %1"
-msgstr "تعذّر تنفيذ %1"
-
-#: kcmdf.cpp:56
-msgid ""
-"A right mouse button click opens a context menu to mount/unmount a device or "
-"to open it in the file manager."
-msgstr ""
-"النقر بالزر الأيمن للفأرة يفتح قائمة منسدلة لتضم/تلغي الضم جهاز أو تفتحه في "
-"مدير الملفات."
-
-#: kconftest.cpp:43
-msgid "A test application"
-msgstr "تطبيق اختباري"
-
-#: kdf.cpp:38
-msgid "KDE free disk space utility"
-msgstr "أداة كدى لمساحةالقرص الخالية"
-
-#: kdf.cpp:50
-msgctxt "Update action"
-msgid "&Update"
-msgstr "&حدث"
-
-#: kdf.cpp:74
-msgid "KDiskFree"
-msgstr "KDiskFree"
-
-#: kdf.cpp:76
-msgid "(c) 1998-2001, Michael Kropfberger"
-msgstr "حقوق الملكية(c) 1998-2001, Michael Kropfberger"
-
-#: kdf.cpp:78 kwikdisk.cpp:322
-msgid "Michael Kropfberger"
-msgstr "Michael Kropfberger"
-
-#: kdfconfig.cpp:56
-msgctxt "TODO"
-msgid "Icon"
-msgstr "الأيقونة"
-
-#: kdfconfig.cpp:57 kdfwidget.cpp:72
-msgctxt "Device of the storage"
-msgid "Device"
-msgstr "الجهاز"
-
-#: kdfconfig.cpp:58 kdfwidget.cpp:73
-msgctxt "Filesystem on storage"
-msgid "Type"
-msgstr "النوع"
-
-#: kdfconfig.cpp:59 kdfwidget.cpp:74
-msgctxt "Total size of the storage"
-msgid "Size"
-msgstr "الحجم"
-
-#: kdfconfig.cpp:60
-msgctxt "Mount point of the storage"
-msgid "Mount Point"
-msgstr "نقطة الضم"
-
-#: kdfconfig.cpp:61 kdfwidget.cpp:76
-msgctxt "Free space in storage"
-msgid "Free"
-msgstr "متفرّغ"
-
-#: kdfconfig.cpp:62 kdfwidget.cpp:77
-msgctxt "Used storage space in %"
-msgid "Full %"
-msgstr "ملئ بنسبة %"
-
-#: kdfconfig.cpp:63 kdfwidget.cpp:78
-msgctxt "Usage graphical bar"
-msgid "Usage"
-msgstr "الإستخدام"
-
-#: kdfconfig.cpp:88 kdfconfig.cpp:191
-msgctxt "Visible items on device information columns (enable|disable)"
-msgid "visible"
-msgstr "مرئي"
-
-#: kdfconfig.cpp:171
-msgctxt "Are items on device information columns visible?"
-msgid "visible"
-msgstr "مرئي"
-
-#: kdfconfig.cpp:172
-msgctxt "Are items on device information columns hidden?"
-msgid "hidden"
-msgstr "مخفي"
-
-#: kdfconfig.cpp:208
-msgctxt "Device information item is hidden"
-msgid "hidden"
-msgstr "مخفي"
-
-#: kdfconfig.cpp:209
-msgctxt "Device information item is visible"
-msgid "visible"
-msgstr "مرئي"
-
-#: kdfwidget.cpp:75
-msgctxt "Mount point of storage"
-msgid "Mount Point"
-msgstr "نقطة الضم"
-
-#: kdfwidget.cpp:285 kdfwidget.cpp:286
-msgid "N/A"
-msgstr "غير متوفر"
-
-#: kdfwidget.cpp:342 kwikdisk.cpp:281
-#, kde-format
-msgid "Device [%1] on [%2] is critically full."
-msgstr "الجهاز [%1] من [%2] ممتلئ بالكامل"
-
-#: kdfwidget.cpp:344
-msgctxt "Warning device getting critically full"
-msgid "Warning"
-msgstr "تحذير"
-
-#: kdfwidget.cpp:392
-msgid "Mount Device"
-msgstr "ضم الجهاز"
-
-#: kdfwidget.cpp:393
-msgid "Unmount Device"
-msgstr "إلغاء ضم الجهاز"
-
-#: kdfwidget.cpp:395
-msgid "Open in File Manager"
-msgstr "الفتح في مدير الملفات"
-
-#: kdfwidget.cpp:412 kdfwidget.cpp:415
-msgid "MOUNTING"
-msgstr "الضم"
-
-#: kwikdisk.cpp:55
-msgid "KDE Free disk space utility"
-msgstr "أداة كدى لمساحة القرص الخالية"
-
-#: kwikdisk.cpp:70 kwikdisk.cpp:318
-msgid "KwikDisk"
-msgstr "KwikDisk"
-
-#: kwikdisk.cpp:88
-msgid "&Start KDiskFree"
-msgstr "ا&بدأ KDiskFree"
-
-#: kwikdisk.cpp:92
-msgid "&Configure KwikDisk..."
-msgstr "&إعداد KwikDisk..."
-
-#: kwikdisk.cpp:196
-msgctxt "Unmount the storage device"
-msgid "Unmount"
-msgstr "إلغاء الضم"
-
-#: kwikdisk.cpp:196
-msgctxt "Mount the storage device"
-msgid "Mount"
-msgstr "ضم"
-
-#: kwikdisk.cpp:218
-msgid "You must login as root to mount this disk"
-msgstr "يجب أن تدخل كمستخدم جذري كي تضُم هذا القرص"
-
-#: kwikdisk.cpp:283
-msgctxt "Device is getting critically full"
-msgid "Warning"
-msgstr "تحذير"
-
-#: kwikdisk.cpp:319
-msgid "(C) 2004 Stanislav Karchebny"
-msgstr "حقوق الملكية(C) 2004 Stanislav Karchebny"
-
-#: kwikdisk.cpp:322
-msgid "Original author"
-msgstr "المؤلف الأصلي"
-
-#: kwikdisk.cpp:324
-msgid "Espen Sand"
-msgstr "Espen Sand"
-
-#: kwikdisk.cpp:324
-msgid "KDE 2 changes"
-msgstr "تغييرات كدى 2"
-
-#: kwikdisk.cpp:325
-msgid "Stanislav Karchebny"
-msgstr "Stanislav Karchebny"
-
-#: kwikdisk.cpp:325
-msgid "KDE 3 changes"
-msgstr "تغييرات كدى 3"
-
-#: mntconfig.cpp:70 mntconfig.cpp:75
-msgid "Device"
-msgstr "الجهاز"
-
-#: mntconfig.cpp:71 mntconfig.cpp:77
-msgid "Mount Point"
-msgstr "نقطة الضم"
-
-#: mntconfig.cpp:71
-msgid "Mount Command"
-msgstr "أمر الضم"
-
-#: mntconfig.cpp:71
-msgid "Unmount Command"
-msgstr "أمر الغاء الضم"
-
-#: mntconfig.cpp:76
-msgctxt "No device is selected"
-msgid "None"
-msgstr "ولا واحد"
-
-#: mntconfig.cpp:78
-msgctxt "No mount point is selected"
-msgid "None"
-msgstr "ولا واحد"
-
-#: mntconfig.cpp:262
-msgid "Only local files supported."
-msgstr "لا يتوفر الدعم سوى للملفات المحلية."
-
-#: mntconfig.cpp:278
-msgid "Only local files are currently supported."
-msgstr "لا يتوفر الدعم حاليا سوى للملفات المحلية."
-
-#: optiondialog.cpp:31
-msgid "Configure"
-msgstr "إعداد"
-
-#: optiondialog.cpp:39
-msgid "General Settings"
-msgstr "الإعدادات العامة"
-
-#: optiondialog.cpp:43
-msgid "Mount Commands"
-msgstr "أوامر الضم"
-
-#: rc.cpp:39
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr ""
-",يونس بوطيور ,محمد جمال, عصام بيازيدى, منذر طه, خالد حسنى, فهد السعيدي, "
-",Launchpad Contributions:,Khaled Hosny,Munzir Taha,Youness BOUTYOUR,Youssef "
-"Chahibi,Zayed Amer Al-Saidi"
-
-#: rc.cpp:40
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr ""
-"f2c2001@yahoo.com, bayazidi@arabeyes.org, munzir@kacst.edu.sa, "
-"dr.khaled.hosny@gmail.com,Fahad.alsaidi@gmail.com, "
-"niceboy120@gmail.com,,,khaledhosny@eglug.org,,niceboy@linuxac.org,,zayed.alsa"
-"idi@gmail.com"
-
-#. i18n: file: kdfui.rc:5
-#. i18n: ectx: Menu (file)
-#: rc.cpp:20
-msgid "&File"
-msgstr "&الملف"
-
-#. i18n: file: kdfconfig.ui:35
-#. i18n: ectx: property (text), widget (QLabel, updateLabel)
-#: rc.cpp:4
-msgid "Update frequency:"
-msgstr "تكرار التحديث:"
-
-#. i18n: file: kdfconfig.ui:42
-#. i18n: ectx: property (suffix), widget (QSpinBox, m_updateSpinBox)
-#: rc.cpp:7
-msgid " sec"
-msgstr " ث"
-
-#. i18n: file: kdfconfig.ui:55
-#. i18n: ectx: property (text), widget (QCheckBox, mOpenMountCheck)
-#: rc.cpp:10
-msgid "Open file manager automatically on mount"
-msgstr "افتح مدير الملفات تلقائيا عند الضم"
-
-#. i18n: file: kdfconfig.ui:62
-#. i18n: ectx: property (text), widget (QCheckBox, mPopupFullCheck)
-#: rc.cpp:13
-msgid "Pop up a window when a disk gets critically full"
-msgstr "إظهار نافذة عندما يمتلئ قرص بشكل حرج"
-
-#. i18n: file: kdfconfig.ui:69
-#. i18n: ectx: property (text), widget (QLabel, fileManagerEdit)
-#: rc.cpp:17
-#, no-c-format
-msgid "File manager (e.g. konsole -e mc %m):"
-msgstr "مدير الملفات ( مثلاً konsole -e mc %m):"
-
-#. i18n: file: mntconfig.ui:20
-#. i18n: ectx: property (text), widget (QLabel, iconNameLabel)
-#: rc.cpp:23
-msgid "Icon name:"
-msgstr "اسم الأيقونة:"
-
-#. i18n: file: mntconfig.ui:30
-#. i18n: ectx: property (text), widget (QLabel, mountLabel)
-#: rc.cpp:26
-msgid "Mount Command:"
-msgstr "أمر الضم:"
-
-#. i18n: file: mntconfig.ui:40
-#. i18n: ectx: property (text), widget (QLabel, umountLabel)
-#: rc.cpp:29
-msgid "Unmount Command:"
-msgstr "أمر الغاء الضم:"
-
-#. i18n: file: mntconfig.ui:50
-#. i18n: ectx: property (text), widget (QPushButton, mDefaultIconButton)
-#: rc.cpp:32
-msgid "Default Icon"
-msgstr "الأيقونة الإفتراضية"
-
-#. i18n: file: mntconfig.ui:57
-#. i18n: ectx: property (text), widget (QPushButton, mMountButton)
-#. i18n: file: mntconfig.ui:64
-#. i18n: ectx: property (text), widget (QPushButton, mUmountButton)
-#: rc.cpp:35 rc.cpp:38
-msgid "Get Command..."
-msgstr "احصل على  أمر ..."
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdialog.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdialog.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdialog.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdialog.po	2012-03-23 06:42:00.000000000 +0000
@@ -7,37 +7,36 @@
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # AbdulAziz AlSharif <a.a-a.s@hotmail.com>, 2007.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kdialog\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2011-12-12 19:33+0000\n"
+"PO-Revision-Date: 2012-03-14 17:21+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:42+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Poedit-Language: Arabic\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:21+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: kdialog.cpp:563 kdialog.cpp:675
 msgctxt "@title:window"
 msgid "Open"
-msgstr ""
+msgstr "افتح"
 
 #: kdialog.cpp:604
 msgctxt "@title:window"
 msgid "Save As"
-msgstr ""
+msgstr "احفظ كـ"
 
 #: kdialog.cpp:776
 msgctxt "@title:window"
 msgid "Choose Color"
-msgstr ""
+msgstr "اختر لون"
 
 #: kdialog.cpp:757
 msgid "KDialog"
@@ -86,7 +85,7 @@
 
 #: kdialog.cpp:838
 msgid "Kai Uwe Broulik"
-msgstr ""
+msgstr "Kai Uwe Broulik"
 
 #: kdialog.cpp:774
 msgid "Question message box with yes/no buttons"
@@ -110,19 +109,19 @@
 
 #: kdialog.cpp:824
 msgid "Use text as Yes button label"
-msgstr ""
+msgstr "استخدام نص كتسمية لزر نعم"
 
 #: kdialog.cpp:825
 msgid "Use text as No button label"
-msgstr ""
+msgstr "استخدام نص كتسمية لزر لا"
 
 #: kdialog.cpp:826
 msgid "Use text as Cancel button label"
-msgstr ""
+msgstr "استخدام نص كتسمية لزر ألغ"
 
 #: kdialog.cpp:827
 msgid "Use text as Continue button label"
-msgstr ""
+msgstr "استخدام نص كتسمية لزر استمر"
 
 #: kdialog.cpp:779
 msgid "'Sorry' message box"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdiamond.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdiamond.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdiamond.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdiamond.po	2012-03-23 06:41:38.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:44+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:47+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: game-state.cpp:117
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdmconfig.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdmconfig.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdmconfig.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdmconfig.po	2012-03-23 06:42:03.000000000 +0000
@@ -16,14 +16,14 @@
 "Project-Id-Version: kdmconfig\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:17+0000\n"
+"PO-Revision-Date: 2012-03-12 22:23+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:55+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:04+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: background.cpp:39
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdmgreet.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdmgreet.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdmgreet.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdmgreet.po	2012-03-23 06:42:03.000000000 +0000
@@ -10,23 +10,23 @@
 # AbdulAziz AlSharif <a.a-a.s@hotmail.com>, 2007.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008, 2009.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kdmgreet\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:13+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-12 22:26+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:56+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:05+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: utils.cpp:87
 #, kde-format
@@ -173,7 +173,7 @@
 
 #: kgdialog.cpp:72
 msgid "Canc&el Session"
-msgstr ""
+msgstr "ال&غِ الجلسة"
 
 #: kgdialog.cpp:73
 msgid "R&estart X Server"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdontchangethehostname.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdontchangethehostname.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kdontchangethehostname.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kdontchangethehostname.po	2012-03-23 06:41:57.000000000 +0000
@@ -13,9 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:51+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:52+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: khostname.cpp:72
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/keditbookmarks.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/keditbookmarks.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/keditbookmarks.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/keditbookmarks.po	2012-03-23 06:42:00.000000000 +0000
@@ -5,109 +5,108 @@
 #
 # AbdulAziz AlSharif <a.a-a.s@hotmail.com>, 2007.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: keditbookmarks\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2012-01-25 10:58+0000\n"
+"PO-Revision-Date: 2012-03-12 22:31+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:43+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:21+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kbookmarkmodel/commands.cpp:68
 msgctxt "(qtundo-format)"
 msgid "Insert Separator"
-msgstr ""
+msgstr "أدرج فاصلا"
 
 #: kbookmarkmodel/commands.cpp:77
 msgctxt "(qtundo-format)"
 msgid "Create Bookmark"
-msgstr ""
+msgstr "أنشئ علامة"
 
 #: kbookmarkmodel/commands.cpp:86
 msgctxt "(qtundo-format)"
 msgid "Create Folder"
-msgstr ""
+msgstr "أنشئ مجلد"
 
 #: kbookmarkmodel/commands.cpp:95
 #, kde-format
 msgctxt "(qtundo-format)"
 msgid "Copy %1"
-msgstr ""
+msgstr "انسخ %1"
 
 #: kbookmarkmodel/commands.cpp:183
 msgctxt "(qtundo-format)"
 msgid "Icon Change"
-msgstr ""
+msgstr "تغيير الأيقونة"
 
 #: kbookmarkmodel/commands.cpp:185
 msgctxt "(qtundo-format)"
 msgid "Title Change"
-msgstr ""
+msgstr "تغيير العنوان"
 
 #: kbookmarkmodel/commands.cpp:187
 msgctxt "(qtundo-format)"
 msgid "URL Change"
-msgstr ""
+msgstr "تغيير الرابط"
 
 #: kbookmarkmodel/commands.cpp:189
 msgctxt "(qtundo-format)"
 msgid "Comment Change"
-msgstr ""
+msgstr "تغيير التعليق"
 
 #: kbookmarkmodel/commands.cpp:364
 #, kde-format
 msgctxt "(qtundo-format)"
 msgid "Move %1"
-msgstr ""
+msgstr "انقل %1"
 
 #: kbookmarkmodel/commands.cpp:481
 msgctxt "(qtundo-format)"
 msgid "Set as Bookmark Toolbar"
-msgstr ""
+msgstr "اجعله شريط علامات"
 
 #: kbookmarkmodel/commands.cpp:517
 msgctxt "(qtundo-format)"
 msgid "Copy Items"
-msgstr ""
+msgstr "انسخ العناصر"
 
 #: kbookmarkmodel/commands.cpp:518
 msgctxt "(qtundo-format)"
 msgid "Move Items"
-msgstr ""
+msgstr "انقل العناصر"
 
 #: kbookmarkmodel/model.cpp:116
 msgctxt "name of the container of all browser bookmarks"
 msgid "Bookmarks"
-msgstr ""
+msgstr "علامات المواقع"
 
 #: kbookmarkmodel/model.cpp:220
 msgctxt "@title:column name of a bookmark"
 msgid "Name"
-msgstr ""
+msgstr "الاسم"
 
 #: kbookmarkmodel/model.cpp:224
 msgctxt "@title:column name of a bookmark"
 msgid "Location"
-msgstr ""
+msgstr "الموقع"
 
 #: kbookmarkmodel/model.cpp:228
 msgctxt "@title:column comment for a bookmark"
 msgid "Comment"
-msgstr ""
+msgstr "التعليق"
 
 #: kbookmarkmodel/model.cpp:232
 msgctxt "@title:column status of a bookmark"
 msgid "Status"
-msgstr ""
+msgstr "الحالة"
 
 #: importers.h:101
 msgid "Galeon"
@@ -203,7 +202,7 @@
 #: main.cpp:71
 msgctxt "@title:window"
 msgid "Warning"
-msgstr ""
+msgstr "إنذار"
 
 #: main.cpp:70
 msgid "Run Another"
@@ -259,11 +258,11 @@
 
 #: main.cpp:112
 msgid "Import bookmarks from a file in KDE2 format"
-msgstr ""
+msgstr "استورد علامات المواقع من ملف في صيغة KDE2"
 
 #: main.cpp:113
 msgid "Import bookmarks from a file in Galeon format"
-msgstr ""
+msgstr "استورد علامات المواقع من ملف في صيغة Galeon"
 
 #: main.cpp:110
 msgid "Export bookmarks to a file in Mozilla format"
@@ -305,6 +304,9 @@
 "KFileDialog bookmarks, etc.\n"
 "The final D-Bus object path is /KBookmarkManager/dbusObjectName"
 msgstr ""
+"اسم فريد لوصف هذه المجموعة من علامات المواقع.\n"
+"يجب أن تكون باسم البرنامج الذي تتعلق به هذه العلامات.\n"
+"المسار النهائي لكوائن DBus هو /KBookmarkManager/dbusObjectName"
 
 #: main.cpp:121
 msgid "File to edit"
@@ -321,7 +323,7 @@
 #: faviconupdater.cpp:87
 #, kde-format
 msgid "%1; no HTML component found (%2)"
-msgstr ""
+msgstr "%1; لم يجد مكون HTML  (%2)"
 
 #: exporters.cpp:48
 msgid "My Bookmarks"
@@ -359,7 +361,7 @@
 
 #: actionsimpl.cpp:109
 msgid "C&hange Location"
-msgstr ""
+msgstr "غيّ&ر المكان"
 
 #: actionsimpl.cpp:110
 msgid "C&hange Comment"
@@ -480,17 +482,17 @@
 #: actionsimpl.cpp:342
 msgctxt "(qtundo-format)"
 msgid "Cut Items"
-msgstr ""
+msgstr "قصّ العناصر"
 
 #: actionsimpl.cpp:367
 msgctxt "(qtundo-format)"
 msgid "Paste"
-msgstr ""
+msgstr "ألصق"
 
 #: actionsimpl.cpp:377
 msgctxt "@title:window"
 msgid "Create New Bookmark Folder"
-msgstr ""
+msgstr "أنشئ مجلد علامات مواقع جديدة"
 
 #: actionsimpl.cpp:365
 msgid "New folder:"
@@ -499,23 +501,23 @@
 #: actionsimpl.cpp:504
 msgctxt "(qtundo-format)"
 msgid "Recursive Sort"
-msgstr ""
+msgstr "فرز تعاودي"
 
 #: actionsimpl.cpp:518
 msgctxt "(qtundo-format)"
 msgid "Sort Alphabetically"
-msgstr ""
+msgstr "افرز أبجدياً"
 
 #: actionsimpl.cpp:526
 msgctxt "(qtundo-format)"
 msgid "Delete Items"
-msgstr ""
+msgstr "احذف العناصر"
 
 #: importers.cpp:56
 #, kde-format
 msgctxt "(qtundo-format)"
 msgid "Import %1 Bookmarks"
-msgstr ""
+msgstr "استورد  علامات %1"
 
 #: importers.cpp:59
 #, kde-format
@@ -530,7 +532,7 @@
 #, kde-format
 msgctxt "@title:window"
 msgid "%1 Import"
-msgstr ""
+msgstr "استيراد %1"
 
 #: importers.cpp:91
 msgid "As New Folder"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfileaudiopreview4.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfileaudiopreview4.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfileaudiopreview4.po	2012-02-23 06:20:16.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfileaudiopreview4.po	2012-03-23 06:41:47.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 22:51+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:11+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: mediacontrols_p.h:51
 msgid "start playback"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_avi.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_avi.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_avi.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_avi.po	2012-03-23 06:41:39.000000000 +0000
@@ -19,8 +19,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:01+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:56+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kfile_avi.cpp:55
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_dds.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_dds.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_dds.po	2012-02-23 06:20:34.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_dds.po	2012-03-23 06:42:07.000000000 +0000
@@ -16,8 +16,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:23+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:57+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kfile_dds.cpp:192
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_drgeo.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_drgeo.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_drgeo.po	2012-02-23 06:20:34.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_drgeo.po	2012-03-23 06:42:07.000000000 +0000
@@ -8,14 +8,14 @@
 "Project-Id-Version: kfile_drgeo\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-10 03:45+0000\n"
-"PO-Revision-Date: 2012-01-26 03:44+0000\n"
+"PO-Revision-Date: 2012-03-13 13:14+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:29+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 01:00+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kfile/kfile_drgeo.cpp:37
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_exr.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_exr.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_exr.po	2012-02-23 06:20:34.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_exr.po	2012-03-23 06:42:07.000000000 +0000
@@ -16,8 +16,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:24+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:57+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kfile_exr.cpp:72
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_flac.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_flac.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_flac.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_flac.po	2012-03-23 06:41:39.000000000 +0000
@@ -16,8 +16,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:01+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:56+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kfile_flac.cpp:78
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_mp3.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_mp3.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_mp3.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_mp3.po	2012-03-23 06:41:39.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:02+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:56+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kfile_mp3.cpp:54
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_mpc.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_mpc.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_mpc.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_mpc.po	2012-03-23 06:41:39.000000000 +0000
@@ -16,8 +16,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:02+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:56+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kfile_mpc.cpp:61
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_ogg.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_ogg.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_ogg.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_ogg.po	2012-03-23 06:41:40.000000000 +0000
@@ -20,8 +20,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:03+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:57+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kfile_ogg.cpp:49 kfile_ogg.cpp:85
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_pnm.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_pnm.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_pnm.po	2012-02-23 06:20:34.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_pnm.po	2012-03-23 06:42:07.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:24+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:57+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kfile_pnm.cpp:28
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile.po	2012-03-23 06:41:57.000000000 +0000
@@ -18,8 +18,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:51+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:52+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: fileprops.cpp:230
 msgid "kfile"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_raw.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_raw.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_raw.po	2012-02-23 06:20:34.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_raw.po	2012-03-23 06:42:07.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:25+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:58+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kcamerarawplugin.cpp:98
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfilereplace.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfilereplace.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfilereplace.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfilereplace.po	2012-03-23 06:41:43.000000000 +0000
@@ -16,8 +16,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:18+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:35+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: configurationclasses.cpp:168
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_rgb.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_rgb.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_rgb.po	2012-02-23 06:20:34.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_rgb.po	2012-03-23 06:42:07.000000000 +0000
@@ -3,20 +3,20 @@
 #
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kfile_rgb\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-09 14:41+0000\n"
-"PO-Revision-Date: 2011-12-29 05:21+0000\n"
+"PO-Revision-Date: 2012-03-12 22:23+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:25+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:58+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kfile_rgb.cpp:44
@@ -71,19 +71,19 @@
 #: kfile_rgb.cpp:132
 msgctxt "Compression"
 msgid "Uncompressed"
-msgstr ""
+msgstr "غير مضغوط"
 
 #: kfile_rgb.cpp:136
 msgctxt "Compression"
 msgid "Runlength Encoded"
-msgstr ""
+msgstr "مشفر Runlength"
 
 #: kfile_rgb.cpp:158
 msgctxt "SharedRows"
 msgid "None"
-msgstr ""
+msgstr "بدون"
 
 #: kfile_rgb.cpp:160
 msgctxt "Compression"
 msgid "Unknown"
-msgstr ""
+msgstr "مجهول"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_rpm.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_rpm.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_rpm.po	2012-02-23 06:20:06.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_rpm.po	2012-03-23 06:41:37.000000000 +0000
@@ -18,8 +18,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:32+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:40+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kfile_rpm.cpp:44
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfileshare.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfileshare.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfileshare.po	1970-01-01 00:00:00.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfileshare.po	2012-03-23 06:41:40.000000000 +0000
@@ -0,0 +1,79 @@
+# translation of kfileshare.po to
+# Copyright (C) 2003, 2007 Free Software Foundation, Inc.
+#
+# Nuriddin Aminagha <nuriddin@eminaga.de>, 2003.
+# Youssef Chahibi <chahibi@gmail.com>, 2007.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
+msgid ""
+msgstr ""
+"Project-Id-Version: kfileshare\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-09-08 21:45+0000\n"
+"PO-Revision-Date: 2012-03-12 22:58+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:59+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: \n"
+
+#. i18n: file: samba/filepropertiesplugin/sambausershareplugin.ui:19
+#. i18n: ectx: property (text), widget (QCheckBox, sambaChk)
+#: rc.cpp:3 rc.cpp:3
+msgid "Share with S&amba (Microsoft Windows)"
+msgstr ""
+
+#. i18n: file: samba/filepropertiesplugin/sambausershareplugin.ui:36
+#. i18n: ectx: property (text), widget (QLabel, textLabel1)
+#: rc.cpp:6 rc.cpp:6
+msgid "Name:"
+msgstr "الاسم:"
+
+#. i18n: file: samba/filepropertiesplugin/sambausershareplugin.ui:56
+#. i18n: ectx: property (text), widget (QCheckBox, sambaAllowGuestChk)
+#: rc.cpp:9 rc.cpp:9
+msgid "Allow Guests"
+msgstr "اسمح للضيوف"
+
+#: samba/filepropertiesplugin/sambausershareplugin.cpp:62
+msgid "&Share"
+msgstr ""
+
+#: samba/filepropertiesplugin/sambausershareplugin.cpp:74
+msgid "Samba is not installed on your system."
+msgstr ""
+
+#: samba/filepropertiesplugin/sambausershareplugin.cpp:77
+msgid "Install Samba..."
+msgstr ""
+
+#: samba/filepropertiesplugin/sambausershareplugin.cpp:129
+msgid ""
+"<qt><strong>Samba could not be installed.</strong><br />Please, check if "
+"kpackagekit is properly installed</qt>"
+msgstr ""
+
+#: samba/filepropertiesplugin/sambausershareplugin.cpp:207
+#, kde-format
+msgid ""
+"<qt>There is already a share with the name <strong>%1</strong>.<br /> Please "
+"choose another name.</qt>"
+msgstr ""
+
+#: samba/filepropertiesplugin/delegate.cpp:40
+msgid "---"
+msgstr ""
+
+#: samba/filepropertiesplugin/delegate.cpp:41
+msgid "Full Control"
+msgstr ""
+
+#: samba/filepropertiesplugin/delegate.cpp:42
+msgid "Read Only"
+msgstr ""
+
+#: samba/filepropertiesplugin/delegate.cpp:43
+msgid "Deny"
+msgstr "امنع"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_sid.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_sid.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_sid.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_sid.po	2012-03-23 06:41:40.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:03+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:57+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kfile_sid.cpp:51
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_theora.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_theora.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_theora.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_theora.po	2012-03-23 06:41:40.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:03+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:57+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kfile_theora.cpp:70
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_tiff.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_tiff.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_tiff.po	2012-02-23 06:20:34.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_tiff.po	2012-03-23 06:42:07.000000000 +0000
@@ -18,8 +18,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:26+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:58+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kfile_tiff.cpp:44
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_wav.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_wav.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_wav.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_wav.po	2012-03-23 06:41:40.000000000 +0000
@@ -19,8 +19,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:04+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:57+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kfile_wav.cpp:55
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_xps.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_xps.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfile_xps.po	2012-02-23 06:20:34.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfile_xps.po	2012-03-23 06:42:07.000000000 +0000
@@ -18,8 +18,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:26+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:58+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kfile_xps.cpp:39
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfindpart.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfindpart.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfindpart.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfindpart.po	2012-03-23 06:42:00.000000000 +0000
@@ -1,7 +1,6 @@
 # translation of kfindpart.po to Arabic
 # translation of kfindpart.po to
 # Copyright (C) 2001,2002, 2004, 2006, 2007, 2008 Free Software Foundation, Inc.
-#
 # Mohammed Ibrahim Halabi <mih_flyer@hotmail.com>, 2001.
 # Isam Bayazidi <bayazidi@arabeyes.org>, 2002.
 # Ahmad M. Zawawi <azawawi@emirates.net.ae>, 2004.
@@ -9,29 +8,29 @@
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # AbdulAziz AlSharif <a.a-a.s@hotmail.com>, 2007.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
+# Abdalrahim G. Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kfindpart\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2012-01-25 10:58+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
+"PO-Revision-Date: 2012-03-14 17:22+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:44+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Poedit-Language: Arabic\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:22+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: kfinddlg.cpp:51
 msgctxt "@title:window"
 msgid "Find Files/Folders"
-msgstr ""
+msgstr "ابحث عن ملفات/مجلّدات"
 
 #: kfinddlg.cpp:71 kfinddlg.cpp:198
 msgctxt "the application is currently idle, there is no active search"
@@ -55,7 +54,7 @@
 
 #: kfinddlg.cpp:200
 msgid "Canceled."
-msgstr ""
+msgstr "ألغُي."
 
 #: kfinddlg.cpp:203 kfinddlg.cpp:208 kfinddlg.cpp:214
 msgid "Error."
@@ -130,7 +129,7 @@
 #: kfindtreeview.cpp:445
 msgctxt "@title:window"
 msgid "Save Results As"
-msgstr ""
+msgstr "احفظ النتائج كــ"
 
 #: kfindtreeview.cpp:443
 msgid "HTML page"
@@ -152,7 +151,7 @@
 #, kde-format
 msgctxt "%1=filename"
 msgid "Results were saved to: %1"
-msgstr ""
+msgstr "حفظت النتائج إلى: %1"
 
 #: kftabdlg.cpp:77
 msgctxt "this is the label for the name textfield"
@@ -264,8 +263,12 @@
 #: kftabdlg.cpp:229 kftabdlg.cpp:895
 msgid "Byte"
 msgid_plural "Bytes"
-msgstr[0] ""
-msgstr[1] ""
+msgstr[0] "بايت"
+msgstr[1] "بايت"
+msgstr[2] "بايت"
+msgstr[3] "بايت"
+msgstr[4] "بايت"
+msgstr[5] "بايت"
 
 #: kftabdlg.cpp:230
 msgid "KiB"
@@ -443,48 +446,72 @@
 "minutes, 'h' hours, 'd' days, 'm' months, 'y' years"
 msgid "&during the previous"
 msgid_plural "&during the previous"
-msgstr[0] ""
-msgstr[1] ""
+msgstr[0] "&خلال"
+msgstr[1] "&خلال"
+msgstr[2] "&خلال"
+msgstr[3] "&خلال"
+msgstr[4] "&خلال"
+msgstr[5] "&خلال"
 
 #: kftabdlg.cpp:886
 msgctxt "use date ranges to search files by modified time"
 msgid "minute"
 msgid_plural "minutes"
-msgstr[0] ""
-msgstr[1] ""
+msgstr[0] "أقل من دقيقة"
+msgstr[1] "الدقيقة ماضية"
+msgstr[2] "دقيقتين الماضيتين"
+msgstr[3] "دقائق الماضية"
+msgstr[4] "دقيقة الماضية"
+msgstr[5] "دقيقة الماضية"
 
 #: kftabdlg.cpp:887
 msgctxt "use date ranges to search files by modified time"
 msgid "hour"
 msgid_plural "hours"
 msgstr[0] ""
-msgstr[1] ""
+msgstr[1] "الساعة الماضية"
+msgstr[2] "الساعتين الماضيتين"
+msgstr[3] "ساعات الماضية"
+msgstr[4] "ساعة الماضية"
+msgstr[5] "ساعة الماضية"
 
 #: kftabdlg.cpp:888
 msgctxt "use date ranges to search files by modified time"
 msgid "day"
 msgid_plural "days"
 msgstr[0] ""
-msgstr[1] ""
+msgstr[1] "اليوم الماضي"
+msgstr[2] "اليومين الماضيين"
+msgstr[3] "أيام الماضية"
+msgstr[4] "يوما الماضي"
+msgstr[5] "يوم ماضي"
 
 #: kftabdlg.cpp:889
 msgctxt "use date ranges to search files by modified time"
 msgid "month"
 msgid_plural "months"
 msgstr[0] ""
-msgstr[1] ""
+msgstr[1] "الشهر الماضي"
+msgstr[2] "الشهرين الماضيين"
+msgstr[3] "أشهر الماضية"
+msgstr[4] "شهرا الماضي"
+msgstr[5] "شهر الماضي"
 
 #: kftabdlg.cpp:890
 msgctxt "use date ranges to search files by modified time"
 msgid "year"
 msgid_plural "years"
 msgstr[0] ""
-msgstr[1] ""
+msgstr[1] "السنة الماضية"
+msgstr[2] "السنتين الماضيتين"
+msgstr[3] "سنوات الماضية"
+msgstr[4] "سنة الماضية"
+msgstr[5] "سنة الماضية"
 
 #: kquery.cpp:554
 msgctxt "@title:window"
 msgid "Error while using locate"
-msgstr ""
+msgstr "خطأ أثناء استخدام locate"
 
 #: main.cpp:30
 msgid "KDE file find utility"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfloppy.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfloppy.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfloppy.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfloppy.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,527 +0,0 @@
-# translation of kfloppy.po to
-# Copyright (C) 2003, 2004, 2006, 2007 Free Software Foundation, Inc.
-# Waseem Bakr <bakr@mit.edu>, 2001.
-# Nuriddin Aminagha <nuriddin@haydarlinux.org>, 2003.
-# Nuriddin Aminagha <nuriddin@eminaga.de>, 2003.
-# Munzir Taha <munzir@kacst.edu.sa>, 2004.
-# Khaled Hosny <dr.khaled.hosny@gmail.com>, 2006.
-# Fahad Al-Saidi <fahad.alsaidi@gmail.com>, 2007.
-# Youssef Chahibi <chahibi@gmail.com>, 2007.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-#
-msgid ""
-msgstr ""
-"Project-Id-Version: kfloppy\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 13:31+0000\n"
-"PO-Revision-Date: 2012-01-25 08:09+0000\n"
-"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:08+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"Language: ar\n"
-
-#: floppy.cpp:81
-msgid "Floppy &drive:"
-msgstr "سواقة الأقراص المرنة:"
-
-#: floppy.cpp:89 floppy.cpp:381 floppy.cpp:724
-msgctxt "Primary floppy drive"
-msgid "Primary"
-msgstr "رئيسي"
-
-#: floppy.cpp:90 floppy.cpp:385
-msgctxt "Secondary floppy drive"
-msgid "Secondary"
-msgstr "ثانوي"
-
-#: floppy.cpp:92
-msgid "<qt>Select the floppy drive.</qt>"
-msgstr "<qt>إختر سواقة الأقراص المرنة.</qt>"
-
-#: floppy.cpp:99
-msgid "&Size:"
-msgstr "ال&حجم:"
-
-#: floppy.cpp:105 floppy.cpp:726
-msgid "Auto-Detect"
-msgstr "كشف تلقائي"
-
-#: floppy.cpp:107 floppy.cpp:392 floppy.cpp:728
-msgid "3.5\" 1.44MB"
-msgstr "3.5\" 1.44م.بايت"
-
-#: floppy.cpp:108 floppy.cpp:396
-msgid "3.5\" 720KB"
-msgstr "3.5\" 720ك.بايت"
-
-#: floppy.cpp:109 floppy.cpp:400
-msgid "5.25\" 1.2MB"
-msgstr "5.25\" 1.2م.بايت"
-
-#: floppy.cpp:110 floppy.cpp:404
-msgid "5.25\" 360KB"
-msgstr "5.25\" 360ك.بايت"
-
-#: floppy.cpp:113
-msgid ""
-"<qt>This allows you to select the floppy disk's size and density.</qt>"
-msgstr "<qt>يسمح لك هذا باختيار حجم وسعة القرص المرن.</qt>"
-
-#: floppy.cpp:121
-msgid "F&ile system:"
-msgstr "نظام ال&ملفات:"
-
-#: floppy.cpp:129 floppy.cpp:141
-msgctxt "Linux"
-msgid ""
-"KFloppy supports three file formats under Linux: MS-DOS, Ext2, and Minix"
-msgstr ""
-"يدعم KFloppy ثلاث من أنواع تهيئة القرص المرن فى لينكس: MS-DOS، Ext2، و Minix"
-
-#: floppy.cpp:132
-msgctxt "BSD"
-msgid "KFloppy supports three file formats under BSD: MS-DOS, UFS, and Ext2"
-msgstr ""
-"يدعم KFloppy ثلاث من أنواع تهيئة القرص المرن فى BSD:  MS-DOS، UFS، و Ext2"
-
-#: floppy.cpp:143 floppy.cpp:172 floppy.cpp:603 floppy.cpp:730
-msgid "DOS"
-msgstr "دوس"
-
-#: floppy.cpp:145
-msgctxt "Linux"
-msgid "Program mkdosfs found."
-msgstr "وجد برنامج mkdosfs."
-
-#: floppy.cpp:148
-msgctxt "Linux"
-msgid ""
-"Program mkdosfs <b>not found</b>. MSDOS formatting <b>not available</b>."
-msgstr "<b>تعذر ايجاد</b> البرنامج mkdosfs.<b>لا تتوفر</b> تهيئة MSDOS."
-
-#: floppy.cpp:152 floppy.cpp:190 floppy.cpp:620
-msgid "ext2"
-msgstr "ext2"
-
-#: floppy.cpp:154 floppy.cpp:192
-msgid "Program mke2fs found."
-msgstr "وجد البرنامج mke2fs."
-
-#: floppy.cpp:157 floppy.cpp:195
-msgid "Program mke2fs <b>not found</b>. Ext2 formatting <b>not available</b>"
-msgstr "<b>تعذر ايجاد</b> البرنامج mke2fs.<b>لا تتوفر</b> تهيئة Ext2."
-
-#: floppy.cpp:161 floppy.cpp:647
-msgid "Minix"
-msgstr "Minix"
-
-#: floppy.cpp:163
-msgctxt "Linux"
-msgid "Program mkfs.minix found."
-msgstr "وجد البرنامج mkfs.minix."
-
-#: floppy.cpp:166
-msgctxt "Linux"
-msgid ""
-"Program mkfs.minix <b>not found</b>. Minix formatting <b>not available</b>"
-msgstr "<b>تعذر ايجاد</b> البرنامج mkfs.minix.<b>لا تتوفر</b> تهيئة Minix."
-
-#: floppy.cpp:170
-msgctxt "BSD"
-msgid "KFloppy supports two file formats under BSD: MS-DOS and UFS"
-msgstr "يدعم KFloppy اثنان من أنواع تهيئة القرص المرن فى BSD:  MS-DOS، و UFS"
-
-#: floppy.cpp:174
-msgctxt "BSD"
-msgid "Program newfs_msdos found."
-msgstr "وجد البرنامج newfs_msdos."
-
-#: floppy.cpp:177
-msgctxt "BSD"
-msgid ""
-"Program newfs_msdos <b>not found</b>. MSDOS formatting <b>not available</b>."
-msgstr "<b>تعذر ايجاد</b> البرنامج newfs_msdos.<b>لا تتوفر</b> تهيئة MSDOS."
-
-#: floppy.cpp:181 floppy.cpp:513 floppy.cpp:638
-msgid "UFS"
-msgstr "UFS"
-
-#: floppy.cpp:183
-msgctxt "BSD"
-msgid "Program newfs found."
-msgstr "وجد البرنامج newfs."
-
-#: floppy.cpp:186
-msgctxt "BSD"
-msgid "Program newfs <b>not found</b>. UFS formatting <b>not available</b>."
-msgstr "<b>تعذر ايجاد</b> البرنامج newfs.<b>لا تتوفر</b> تهيئة UFS."
-
-#: floppy.cpp:201
-msgid "&Formatting"
-msgstr "جارى ال&تهيئة"
-
-#: floppy.cpp:204
-msgid "Q&uick format"
-msgstr "تهيئة &سريعة"
-
-#: floppy.cpp:208
-msgid ""
-"<qt>Quick format is only a high-level format: it creates only a file "
-"system.</qt>"
-msgstr ""
-"<qt>التهيئة السريعة هى تهيأة مستوى عالى فقط: فهى تنشئ نظام ملفات فقط.</qt>"
-
-#: floppy.cpp:211
-msgid "&Zero out and quick format"
-msgstr "ملأ بأصفار وتهيئة سريعة"
-
-#: floppy.cpp:215
-msgid ""
-"<qt>This first erases the floppy by writing zeros and then it creates the "
-"file system.</qt>"
-msgstr ""
-"<qt>يقوم هذا أولا بمسح القرص المرن عن طريق كتابة أصفار عليه ثم ينشئ نظام "
-"ملفات.</qt>"
-
-#: floppy.cpp:217
-msgid "Fu&ll format"
-msgstr "ت&هيئة كاملة"
-
-#: floppy.cpp:221
-msgid ""
-"Full format is a low-level and high-level format. It erases everything on "
-"the disk."
-msgstr ""
-"التهيئة الكاملة هى تهيئة مستوى سفلى (تهيئة أولية) و تهيئة مستوى عالى. تقوم "
-"بمسح كل شئ على القرص."
-
-#: floppy.cpp:230
-msgid "Program fdformat found."
-msgstr "وجد البرنامج fdformat."
-
-#: floppy.cpp:235
-msgid "Program fdformat <b>not found</b>. Full formatting <b>disabled</b>."
-msgstr ""
-"<b>تعذر ايجاد</b> البرنامج fdformat. <b>تم  تعطيل</b> التهيئة الكاملة."
-
-#: floppy.cpp:242
-msgid "Program dd found."
-msgstr "وجد البرنامج dd."
-
-#: floppy.cpp:246
-msgid "Program dd <b>not found</b>. Zeroing-out <b>disabled</b>."
-msgstr "<b>تعذر ايجاد</b> البرنامج dd. <b>تم  تعطيل</b> الملأ بالأصفار."
-
-#: floppy.cpp:251
-msgid "&Verify integrity"
-msgstr "الت&حقّق من الصلاحية"
-
-#: floppy.cpp:255
-msgid ""
-"<qt>Check this if you want the floppy disk to be checked after formatting. "
-"Please note that the floppy will be checked twice if you have selected full "
-"formatting.</qt>"
-msgstr ""
-"<qt>اختر هذا اذاكنت ترغب فى التحقق من صلاحية القرص المرن بعد تهيئته. من فضلك "
-"لاحظ أن القرص سيختبر مرتين اذا اخترت التهيئة الكاملة.</qt>"
-
-#: floppy.cpp:260
-msgid "Volume la&bel:"
-msgstr "&عنوان القرص:"
-
-#: floppy.cpp:264
-msgid ""
-"<qt>Check this if you want a volume label for your floppy. Please note that "
-"Minix does not support labels at all.</qt>"
-msgstr ""
-"<qt>اختر هذا اذا كنت ترغب فى ضع عنوان للقرص المرن.  من فضلك لا حظ أن Minix "
-"لا يدعم العناوين على أى حال.</qt>"
-
-#: floppy.cpp:273 floppy.cpp:722
-msgctxt "Volume label, maximal 11 characters"
-msgid "KDE Floppy"
-msgstr "KDE Floppy"
-
-#: floppy.cpp:277
-msgid ""
-"<qt>This is for the volume label. Due to a limitation of MS-DOS the label "
-"can only be 11 characters long. Please note that Minix does not support "
-"labels, whatever you enter here.</qt>"
-msgstr ""
-"<qt>هذا من أجل عنوان القرص.  بسبب التقييد فى MS-DOS لا يمكن أن يزيد العنوان "
-"عن 11 رمز.  من فضلك لا حظ أن  Minix لا يدعم العناوين بغض النظر عما تدخله "
-"هنا.</qt>"
-
-#: floppy.cpp:287 floppy.cpp:495
-msgid "&Format"
-msgstr "&هيء"
-
-#: floppy.cpp:294
-msgid "<qt>Click here to start formatting.</qt>"
-msgstr "<qt>انقر هنا لتبدأ التهيئة.</qt>"
-
-#: floppy.cpp:318
-msgid ""
-"<qt>This is the status window, where error messages are displayed.</qt>"
-msgstr "<qt>هذه هى نافذة الحالة، حيث ستظهر رسائل الخطأ.</qt>"
-
-#: floppy.cpp:332
-msgid "<qt>Shows progress of the format.</qt>"
-msgstr "<qt>اعرض تقدم التهيئة.</qt>"
-
-#: floppy.cpp:340
-msgid ""
-"KFloppy cannot find any of the needed programs for creating file systems; "
-"please check your installation.<br /><br />Log:"
-msgstr ""
-"لا يستطيع KFloppy ايجاد أى من البرامج الضرورية لإنشاء أنظمة الملفات؛ من فضلك "
-"تأكد من تثبيتك لها. <br><br>السجل:"
-
-#: floppy.cpp:372
-msgid "KDE Floppy Formatter"
-msgstr "برنامج كدى لتهيئة الأقراص المرنة"
-
-#: floppy.cpp:515
-msgctxt "BSD"
-msgid "Formatting with BSD on a user-given device is only possible with UFS"
-msgstr "لا يمكن تهيئة جهاز معطى من المستخدم فى BSD سوى بـUFS"
-
-#: floppy.cpp:523
-#, kde-format
-msgid ""
-"<qt>Formatting will erase all data on the device:<br/><b>%1</b><br/>(Please "
-"check the correctness of the device name.)<br/>Are you sure you wish to "
-"proceed?</qt>"
-msgstr ""
-"<qt>عملية التهيئة ستقوم بإزالة كافة البيانات الموجودة على الجهاز: "
-"<br/><b>%1</b> <br/>(من فضلك تأكد من صحة اسم الجهاز.) <br/>هل ترغب حقًا في "
-"المتابعة؟</qt>"
-
-#: floppy.cpp:526 floppy.cpp:541
-msgid "Proceed?"
-msgstr "المتابعة؟"
-
-#: floppy.cpp:534
-msgid "Full formatting of a user-given device is not possible."
-msgstr "لا يمكن تهيئة الجهاز المعطى تهيئة كاملة."
-
-#: floppy.cpp:540
-msgid ""
-"Formatting will erase all data on the disk.\n"
-"Are you sure you wish to proceed?"
-msgstr ""
-"عملية التهيئة ستقوم بإزالة كافة البيانات الموجودة على القرص.\n"
-"هل ترغب حقًا في المتابعة؟"
-
-#: format.cpp:266
-#, kde-format
-msgid "Unexpected drive number %1."
-msgstr "رقم سواقة غير متوقع %1."
-
-#: format.cpp:278
-#, kde-format
-msgid "Unexpected density number %1."
-msgstr "رقم سعة غير متوقع %1."
-
-#: format.cpp:293
-#, kde-format
-msgid "Cannot find a device for drive %1 and density %2."
-msgstr "لا يمكن العثور على جهاز للسواقة %1 والسعة %2."
-
-#: format.cpp:312
-#, kde-format
-msgid ""
-"Cannot access %1\n"
-"Make sure that the device exists and that you have write permission to it."
-msgstr ""
-"لا أستطيع الوصول إلى %1\n"
-"تأكد من أن الجهاز موجود وأنك تملك إذنا بالكتابة إليه."
-
-#: format.cpp:343
-#, kde-format
-msgid "The program %1 terminated with an error."
-msgstr "لقد انتهى البرنامج %1 بسبب خطأ."
-
-#: format.cpp:349
-#, kde-format
-msgid "The program %1 terminated abnormally."
-msgstr "لقد انتهى البرنامج %1 بشكل غير طبيعى."
-
-#: format.cpp:412 format.cpp:573 format.cpp:670 format.cpp:769 format.cpp:847
-#: format.cpp:941
-msgid "Internal error: device not correctly defined."
-msgstr "خطأ داخلى: الجهاز غير معرّف بشكل صحيح."
-
-#: format.cpp:419
-msgid "Cannot find fdformat."
-msgstr "لا يمكن إيجاد fdformat."
-
-#: format.cpp:451
-msgid "Could not start fdformat."
-msgstr "لا يمكن تشغيل fdformat."
-
-#: format.cpp:478
-#, kde-format
-msgid "Error formatting track %1."
-msgstr "خطأ عند تهيئة المسار %1."
-
-#: format.cpp:486 format.cpp:519
-msgid ""
-"Cannot access floppy or floppy drive.\n"
-"Please insert a floppy and make sure that you have selected a valid floppy "
-"drive."
-msgstr ""
-"لا أستطيع الوصول إلى القرص المرن أو إلى مشغل الأقراص.\n"
-"يرجى إدخال القرص المرن والتأكد من أنك قد اخترت مشغل الأقراص الصحيح."
-
-#: format.cpp:507
-#, kde-format
-msgid "Low-level formatting error at track %1."
-msgstr "خطأ عند التهيئة الأولى للمسار %1."
-
-#: format.cpp:512
-#, kde-format
-msgid "Low-level formatting error: %1"
-msgstr "خطأ عند التهيئة الأولية: %1"
-
-#: format.cpp:526 format.cpp:727 format.cpp:890 format.cpp:981
-msgid ""
-"Device busy.\n"
-"Perhaps you need to unmount the floppy first."
-msgstr ""
-"الجهاز مشغول.\n"
-"ربما تحتاج الغاء ضم القرص المرن أولا."
-
-#: format.cpp:532
-#, kde-format
-msgid "Low-level format error: %1"
-msgstr "خطأ عند التهيئة الأولية: %1"
-
-#: format.cpp:580
-msgid "Cannot find dd."
-msgstr "لا يمكن إيجاد dd."
-
-#: format.cpp:595
-msgid "Could not start dd."
-msgstr "لا يمكن تشغيل dd."
-
-#: format.cpp:677
-msgid "Cannot find a program to create FAT filesystems."
-msgstr "لا يمكن العثور على برنامج لإنشاء نظام ملفات FAT."
-
-#: format.cpp:708
-msgid "Cannot start FAT format program."
-msgstr "لا يمكن تشغيل برنامج تهيئة FAT."
-
-#: format.cpp:722 format.cpp:885 format.cpp:976
-msgid ""
-"Floppy is mounted.\n"
-"You need to unmount the floppy first."
-msgstr ""
-"القرص المرن مضموم.\n"
-"تحتاج الى الغاء ضمّه أولا."
-
-#: format.cpp:776
-msgctxt "BSD"
-msgid "Cannot find a program to create UFS filesystems."
-msgstr "لا يمكن العثور على برنامج لإنشاء نظام ملفات UFS ."
-
-#: format.cpp:794
-msgctxt "BSD"
-msgid "Cannot start UFS format program."
-msgstr "لا يمكن تشغيل برنامج تهيئة UFS."
-
-#: format.cpp:854
-msgid "Cannot find a program to create ext2 filesystems."
-msgstr "لا يمكن العثور على برنامج لإنشاء نظام ملفات ext2."
-
-#: format.cpp:871
-msgid "Cannot start ext2 format program."
-msgstr "لا يمكن تشغيل برنامج تهيئة ext2."
-
-#: format.cpp:948
-msgid "Cannot find a program to create Minix filesystems."
-msgstr "لا يمكن العثور على برنامج لإنشاء نظام ملفات Minix."
-
-#: format.cpp:965
-msgid "Cannot start Minix format program."
-msgstr "لا يمكن تشغيل برنامج تهيئة Minix."
-
-#: main.cpp:35
-msgid "KDE Floppy Disk Utility"
-msgstr "أداة كيدي للأقراص المرنة"
-
-#: main.cpp:40
-msgid "KFloppy"
-msgstr "KFloppy"
-
-#: main.cpp:42
-msgid ""
-"(c) 1997, Bernd Johannes Wuebben\n"
-"(c) 2001, Chris Howells\n"
-"(c) 2002, Adriaan de Groot\n"
-"(c) 2004, 2005, Nicolas Goutte"
-msgstr ""
-"(c) 1997, Bernd Johannes Wuebben\n"
-"(c) 2001, Chris Howells\n"
-"(c) 2002, Adriaan de Groot\n"
-"(c) 2004, 2005, Nicolas Goutte"
-
-#: main.cpp:46
-msgid "KFloppy helps you format floppies with the filesystem of your choice."
-msgstr "يساعدك KFloppy  على تهيئة الأقراص المرنة بنظام ملفات من اختيارك."
-
-#: main.cpp:50
-msgid "Bernd Johannes Wuebben"
-msgstr "Bernd Johannes Wuebben"
-
-#: main.cpp:50
-msgid "Author and former maintainer"
-msgstr "المؤلف والمشرف السابق"
-
-#: main.cpp:51
-msgid "Chris Howells"
-msgstr "Chris Howells"
-
-#: main.cpp:51
-msgid "User interface re-design"
-msgstr "إعادة تصميم واجهة المستخدم"
-
-#: main.cpp:52
-msgid "Adriaan de Groot"
-msgstr "Adriaan de Groot"
-
-#: main.cpp:52
-msgid "Add BSD support"
-msgstr "إضافة دعم BSD"
-
-#: main.cpp:53
-msgid "Nicolas Goutte"
-msgstr "Nicolas Goutte"
-
-#: main.cpp:53
-msgid "Make KFloppy work again for KDE 3.4"
-msgstr "جعل KFloppy يعمل مرة أخرى لكدى 3.4"
-
-#: main.cpp:58
-msgid "Default device"
-msgstr "الجهاز الافتراضي"
-
-#: rc.cpp:1
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr ""
-"وسيم بكر, عصام بايزيدي, خالد حسنى , فهد السعيدي, ,Launchpad "
-"Contributions:,Khaled Hosny,Zayed Amer Al-Saidi"
-
-#: rc.cpp:2
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr ""
-"bakr@arabeyes.org, bayazidi@arabeyes.org, "
-"dr.khaled.hosny@gmail.com,Fahad.alsaidi@gmail.com,,,khaledhosny@eglug.org,zay"
-"ed.alsaidi@gmail.com"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfmclient.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfmclient.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfmclient.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfmclient.po	2012-03-23 06:42:00.000000000 +0000
@@ -18,10 +18,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:45+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:23+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
-"X-Poedit-Language: Arabic\n"
 
 #: kfmclient.cpp:55
 msgid "kfmclient"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfontinst.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfontinst.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfontinst.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfontinst.po	2012-03-23 06:42:03.000000000 +0000
@@ -15,16 +15,16 @@
 "Project-Id-Version: kfontinst\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:14+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-14 17:13+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:57+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:06+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: rc.cpp:1
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfourinline.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfourinline.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kfourinline.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kfourinline.po	2012-03-23 06:41:38.000000000 +0000
@@ -3,20 +3,21 @@
 #
 # Isam Bayazidi <bayazidi@arabeyes.org>, 2002.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kwin4\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:39+0000\n"
-"PO-Revision-Date: 2012-01-25 11:45+0000\n"
-"Last-Translator: Youssef Chahibi <Unknown>\n"
-"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
+"PO-Revision-Date: 2012-03-12 22:56+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:44+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:47+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: \n"
 
 #: chatdlg.cpp:44
 msgid "Chat Dlg"
@@ -234,7 +235,7 @@
 
 #: main.cpp:79
 msgid "Run game in demo (autoplay) mode"
-msgstr "شغل اللعبة في نمط الإستعراضي (تشغيل تلقائي)"
+msgstr "شغل اللعبة في النمط الاستعراضي (لعب تلقائي)"
 
 #: rc.cpp:147
 msgctxt "NAME OF TRANSLATORS"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kgeography.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kgeography.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kgeography.po	2012-02-23 06:20:14.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kgeography.po	2012-03-23 06:41:45.000000000 +0000
@@ -7,14 +7,14 @@
 "Project-Id-Version: kgeography\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-10 03:36+0000\n"
-"PO-Revision-Date: 2012-01-25 11:04+0000\n"
+"PO-Revision-Date: 2012-03-12 23:08+0000\n"
 "Last-Translator: Youssef Chahibi <Unknown>\n"
 "Language-Team: Arabeyes\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 22:21+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:55+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: answersdialog.cpp:24
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kgetplugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kgetplugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kgetplugin.po	2012-02-23 06:20:09.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kgetplugin.po	2012-03-23 06:41:40.000000000 +0000
@@ -15,18 +15,15 @@
 "Project-Id-Version: kget\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 21:45+0000\n"
-"PO-Revision-Date: 2012-01-26 23:48+0000\n"
+"PO-Revision-Date: 2012-03-12 23:53+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:10+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Poedit-Country: SAUDI ARABIA\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:00+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
-"X-Poedit-SourceCharset: utf-8\n"
 
 #: kget_plug_in.cpp:55
 msgid "Download Manager"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kget.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kget.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kget.po	2012-02-23 06:20:09.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kget.po	2012-03-23 06:41:40.000000000 +0000
@@ -10,25 +10,23 @@
 # Mohamed SAAD محمد سعد <metehyi@free.fr>, 2007.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2009.
-# Osama Khalid <osamak.wfm@gmail.com>, 2009.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kget\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 21:45+0000\n"
-"PO-Revision-Date: 2011-01-06 02:51+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <>\n"
+"PO-Revision-Date: 2012-03-12 22:57+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:09+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Poedit-Country: SAUDI ARABIA\n"
-"X-Poedit-Language: Arabic\n"
-"X-Poedit-SourceCharset: utf-8\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:59+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: conf/transfersgrouptree.cpp:110 conf/transfersgrouptree.cpp:115
 msgid "New Group"
@@ -36,11 +34,11 @@
 
 #: conf/autopastemodel.cpp:174
 msgid "Pattern"
-msgstr ""
+msgstr "النمط"
 
 #: conf/autopastemodel.cpp:176
 msgid "Syntax"
-msgstr ""
+msgstr "الصياغة"
 
 #: conf/autopastemodel.cpp:209 conf/integrationpreferences.cpp:35
 msgid "Escape sequences"
@@ -48,7 +46,7 @@
 
 #: conf/autopastemodel.cpp:209 conf/integrationpreferences.cpp:36
 msgid "Regular expression"
-msgstr ""
+msgstr "تعبير نمطي"
 
 #: conf/preferencesdialog.cpp:49
 msgid "Xml"
@@ -60,19 +58,19 @@
 
 #: conf/preferencesdialog.cpp:54
 msgid "Nepomuk"
-msgstr ""
+msgstr "نِبومَك"
 
 #: conf/preferencesdialog.cpp:58
 msgid "Turn Off Computer"
-msgstr "أوقف تشغيل الحاسوب"
+msgstr "أ&طفئ الحاسوب"
 
 #: conf/preferencesdialog.cpp:59
 msgid "Hibernate Computer"
-msgstr ""
+msgstr "أسبِت الحاسوب"
 
 #: conf/preferencesdialog.cpp:60
 msgid "Suspend Computer"
-msgstr ""
+msgstr "علّق الحاسوب"
 
 #: conf/preferencesdialog.cpp:75
 msgid "Appearance"
@@ -110,12 +108,12 @@
 
 #: conf/preferencesdialog.cpp:79
 msgid "Verification"
-msgstr ""
+msgstr "التحقّق"
 
 #: conf/preferencesdialog.cpp:80
 msgctxt "integration of KGet with other applications"
 msgid "Integration"
-msgstr ""
+msgstr "التكامل"
 
 #: conf/preferencesdialog.cpp:81
 msgctxt "Advanced Options"
@@ -136,11 +134,11 @@
 
 #: conf/integrationpreferences.cpp:32
 msgid "Include"
-msgstr ""
+msgstr "ضمّن"
 
 #: conf/integrationpreferences.cpp:33
 msgid "Exclude"
-msgstr ""
+msgstr "استثنِ"
 
 #: core/transfergrouphandler.cpp:97
 #, kde-format
@@ -280,8 +278,12 @@
 #, kde-format
 msgid "KGet is downloading %1 file"
 msgid_plural "KGet is downloading %1 files"
-msgstr[0] ""
-msgstr[1] ""
+msgstr[0] "يجري تنزيل %1 ملفات"
+msgstr[1] "يجرب تنزيل ملفّ واحد"
+msgstr[2] "يجري تنزيل ملفين"
+msgstr[3] "يجري تنزيل %1 ملفات"
+msgstr[4] "يجري تنزيل %1 ملفًّا"
+msgstr[5] "يجري تنزيل %1 ملف"
 
 #: core/kget.h:366 ui/tray.cpp:41 main.cpp:123 mainwindow.cpp:91
 #: mainwindow.cpp:470
@@ -291,7 +293,7 @@
 #: core/verifier.cpp:412
 msgctxt "the type of the hash, e.g. MD5"
 msgid "Type"
-msgstr ""
+msgstr "النوع"
 
 #: core/verifier.cpp:414
 msgctxt "the used hash for verification"
@@ -301,7 +303,7 @@
 #: core/verifier.cpp:416
 msgctxt "verification-result of a file, can be true/false"
 msgid "Verified"
-msgstr ""
+msgstr "متحقّق منه"
 
 #: core/kgetkjobadapter.cpp:44
 msgid "KGet Transfer"
@@ -342,7 +344,7 @@
 
 #: core/kget.cpp:148
 msgid "Remove groups"
-msgstr ""
+msgstr "أزل المجموعات"
 
 #: core/kget.cpp:256
 #, kde-format
@@ -353,7 +355,7 @@
 
 #: core/kget.cpp:257 core/kget.cpp:353
 msgid "Download added"
-msgstr ""
+msgstr "تم إضافة التنزيل"
 
 #: core/kget.cpp:348
 msgid "<p>The following transfer has been added to the download list:</p>"
@@ -443,7 +445,7 @@
 
 #: core/kget.cpp:1031 core/urlchecker.cpp:588
 msgid "Download it again?"
-msgstr ""
+msgstr "أأعيد تنزيله؟"
 
 #: core/kget.cpp:1043 core/urlchecker.cpp:379
 #, kde-format
@@ -457,7 +459,7 @@
 
 #: core/kget.cpp:1044 core/urlchecker.cpp:585
 msgid "Delete it and download again?"
-msgstr ""
+msgstr "احذفه ثم نزّله مجدّدًا"
 
 #: core/kget.cpp:1067 core/kget.cpp:1074
 msgid "Directory is not writable"
@@ -476,12 +478,12 @@
 
 #: core/kget.cpp:1112
 msgid "You are already downloading the same file"
-msgstr ""
+msgstr "أنت تنزّل هذا الملف بالفعل"
 
 #: core/kget.cpp:1116 core/kget.cpp:1119 core/urlchecker.cpp:600
 #: core/urlchecker.cpp:701 transfer-plugins/metalink/metalink.cpp:735
 msgid "File already exists"
-msgstr ""
+msgstr "الملف موجود مسبقاً"
 
 #: core/kget.cpp:1220
 #, kde-format
@@ -530,7 +532,7 @@
 
 #: core/kget.cpp:1356
 msgid "Download started"
-msgstr ""
+msgstr "بدأ التنزيل"
 
 #: core/kget.cpp:1358
 #, kde-format
@@ -542,7 +544,7 @@
 
 #: core/kget.cpp:1363
 msgid "Resolve"
-msgstr ""
+msgstr "حلّ"
 
 #: core/kget.cpp:1411
 msgid "KGet is now closing, as all downloads have completed."
@@ -555,7 +557,7 @@
 #: core/kget.cpp:1415
 msgctxt "Shutting down computer"
 msgid "Shutdown"
-msgstr ""
+msgstr "أطفئ"
 
 #: core/kget.cpp:1418
 msgid ""
@@ -575,12 +577,12 @@
 #: core/kget.cpp:1421
 msgctxt "Suspending computer"
 msgid "Suspending"
-msgstr ""
+msgstr "يعلّق"
 
 #: core/kget.cpp:1429
 msgctxt "abort the proposed action"
 msgid "Abort"
-msgstr ""
+msgstr "الغِ"
 
 #: core/kget.cpp:1439
 msgid "<p>All transfers have been finished.</p>"
@@ -588,7 +590,7 @@
 
 #: core/kget.cpp:1440
 msgid "Downloads completed"
-msgstr ""
+msgstr "اكتمل التنزيل"
 
 #: core/verifier.cpp:1233
 msgid ""
@@ -609,17 +611,17 @@
 #: core/filemodel.cpp:280
 msgctxt "file in a filesystem"
 msgid "File"
-msgstr ""
+msgstr "ملف"
 
 #: core/filemodel.cpp:280
 msgctxt "status of the download"
 msgid "Status"
-msgstr ""
+msgstr "الحالة"
 
 #: core/filemodel.cpp:280
 msgctxt "size of the download"
 msgid "Size"
-msgstr ""
+msgstr "الحجم"
 
 #: core/filemodel.cpp:280
 msgctxt "checksum of a file"
@@ -633,7 +635,7 @@
 
 #: core/urlchecker.cpp:253 core/urlchecker.cpp:293
 msgid "No download directory specified."
-msgstr ""
+msgstr "لم يحدّد مجلد للتنزيلات."
 
 #: core/urlchecker.cpp:255
 msgid "Invalid download directory specified."
@@ -658,7 +660,7 @@
 #: core/urlchecker.cpp:277 core/urlchecker.cpp:317 core/urlchecker.cpp:407
 #: core/urlchecker.cpp:421
 msgid "No URL specified."
-msgstr ""
+msgstr "لم يحدد عنوان URL."
 
 #: core/urlchecker.cpp:279 transfer-plugins/bittorrent/bttransfer.cpp:256
 #: transfer-plugins/bittorrent/advanceddetails/trackerview.cpp:94
@@ -993,7 +995,7 @@
 
 #: transfer-plugins/bittorrent/bttransfer.cpp:429
 msgid "Cannot initialize port..."
-msgstr ""
+msgstr "تعذّر بدء المنفذ..."
 
 #: transfer-plugins/bittorrent/bttransfer.cpp:498
 msgctxt "Transfer status: seeding"
@@ -1531,7 +1533,7 @@
 #: ui/signaturedlg.cpp:33
 msgctxt "trust level"
 msgid "Unknown"
-msgstr ""
+msgstr "مجهول"
 
 #: ui/signaturedlg.cpp:33
 msgctxt "trust level"
@@ -1541,7 +1543,7 @@
 #: ui/signaturedlg.cpp:33
 msgctxt "trust level"
 msgid "Never"
-msgstr ""
+msgstr "أبداً"
 
 #: ui/signaturedlg.cpp:33
 msgctxt "trust level"
@@ -1631,7 +1633,7 @@
 #: ui/signaturedlg.cpp:245
 msgctxt "pgp signature is not verified"
 msgid "Failed"
-msgstr ""
+msgstr "فشل"
 
 #: ui/signaturedlg.cpp:248
 msgid ""
@@ -1656,7 +1658,7 @@
 #: ui/linkview/kget_linkview.cpp:75
 msgctxt "of a filter, e.g. RegExp or Wildcard"
 msgid "Pattern Syntax"
-msgstr ""
+msgstr "صيغة النمط"
 
 #: ui/linkview/kget_linkview.cpp:76
 msgid "Escape Sequences"
@@ -1664,7 +1666,7 @@
 
 #: ui/linkview/kget_linkview.cpp:79
 msgid "Regular Expression"
-msgstr ""
+msgstr "التعبير النمطي"
 
 #: ui/linkview/kget_linkview.cpp:91
 msgctxt "Download the items which have been selected"
@@ -1734,16 +1736,16 @@
 
 #: ui/renamefile.cpp:32
 msgid "Rename File"
-msgstr ""
+msgstr "إعادة تسمية الملف"
 
 #: ui/renamefile.cpp:41
 #, kde-format
 msgid "Rename %1 to:"
-msgstr ""
+msgstr "أعد تسمية %1 إلى:"
 
 #: ui/renamefile.cpp:44
 msgid "&Rename"
-msgstr ""
+msgstr "أ&عِد التسمية"
 
 #: ui/transferdetails.cpp:74
 #, kde-format
@@ -1976,7 +1978,7 @@
 #: ui/metalinkcreator/dragdlg.cpp:90
 msgctxt "comma, to seperate members of a list"
 msgid ","
-msgstr ""
+msgstr "،"
 
 #: ui/metalinkcreator/filedlg.cpp:110
 msgid "File Properties"
@@ -1988,7 +1990,7 @@
 
 #: ui/metalinkcreator/filedlg.cpp:125
 msgid "The filename exists already, choose a different one."
-msgstr ""
+msgstr "اسم الملم مستخدم مسبقاً، استخدم ملفاً آخر."
 
 #: ui/metalinkcreator/filedlg.cpp:128
 msgid "Enter at least one URL."
@@ -1996,7 +1998,7 @@
 
 #: ui/metalinkcreator/dragdlg.cpp:67
 msgid "Import dropped files"
-msgstr ""
+msgstr "أسقطت ملفات من عملية الاستيراد"
 
 #: ui/metalinkcreator/metalinkcreator.cpp:90
 msgid "Create a Metalink"
@@ -2036,7 +2038,7 @@
 #: ui/metalinkcreator/metalinkcreator.cpp:241
 msgctxt "file as in file on hard drive"
 msgid "Files"
-msgstr ""
+msgstr "الملفات"
 
 #: ui/transfersettingsdialog.cpp:32
 #, kde-format
@@ -2050,7 +2052,7 @@
 
 #: ui/transfersettingsdialog.cpp:161
 msgid "Destination unmodified"
-msgstr ""
+msgstr "لم يتم تغيير الوجهة"
 
 #: ui/contextmenu.cpp:77
 msgid "Semantic Desktop"
@@ -2097,22 +2099,22 @@
 #: ui/mirror/mirrormodel.cpp:388
 msgctxt "Mirror as in server, in url"
 msgid "Mirror"
-msgstr ""
+msgstr "مرآة"
 
 #: ui/mirror/mirrormodel.cpp:391
 msgctxt "The priority of the mirror"
 msgid "Priority"
-msgstr ""
+msgstr "الأولوية"
 
 #: ui/mirror/mirrormodel.cpp:396
 msgctxt "Number of paralell connections to the mirror"
 msgid "Connections"
-msgstr ""
+msgstr "الاتصالات"
 
 #: ui/mirror/mirrormodel.cpp:398
 msgctxt "Location = country"
 msgid "Location"
-msgstr ""
+msgstr "الموقع"
 
 #: ui/mirror/mirrorsettings.cpp:44
 msgid "Add mirror"
@@ -2250,6 +2252,10 @@
 "(C) 2002, Carsten Pfeiffer\n"
 "(C) 1998 - 2000, Matej Koss"
 msgstr ""
+"(C) 2005 - 2011, The KGet developers\n"
+"(C) 2001 - 2002, Patrick Charbonnier\n"
+"(C) 2002, Carsten Pfeiffer\n"
+"(C) 1998 - 2000, Matej Koss"
 
 #: main.cpp:131
 msgid "<a href=\"mailto:kget@kde.org\">kget@kde.org</a>"
@@ -2261,7 +2267,7 @@
 
 #: main.cpp:133
 msgid "Maintainer, Core Developer, Torrent Plugin Author"
-msgstr ""
+msgstr "مشرف، مطوّر أساسيّ، مؤلّف ملحق التورنت"
 
 #: main.cpp:134
 msgid "Dario Massarin"
@@ -2385,23 +2391,23 @@
 
 #: mainwindow.cpp:187
 msgid "Top Priority"
-msgstr ""
+msgstr "الأولوية القصوى"
 
 #: mainwindow.cpp:192
 msgid "Least Priority"
-msgstr ""
+msgstr "الأولويّة الدنيا"
 
 #. i18n: file: conf/dlgintegration.ui:100
 #. i18n: ectx: property (text), widget (KPushButton, increase)
 #: mainwindow.cpp:197 rc.cpp:152
 msgid "Increase Priority"
-msgstr ""
+msgstr "زِد الأولوية"
 
 #. i18n: file: conf/dlgintegration.ui:107
 #. i18n: ectx: property (text), widget (KPushButton, decrease)
 #: mainwindow.cpp:202 rc.cpp:155
 msgid "Decrease Priority"
-msgstr ""
+msgstr "قلِّل الأولوية"
 
 #: mainwindow.cpp:217
 msgid "Set Icon..."
@@ -2433,7 +2439,7 @@
 #: mainwindow.cpp:255
 msgctxt "delete all finished transfers"
 msgid "Remove All Finished"
-msgstr ""
+msgstr "أزِل كلّ المنتهي"
 
 #: mainwindow.cpp:260
 msgctxt "redownload selected transfer item"
@@ -2581,15 +2587,16 @@
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
 msgstr ""
-"Majed Ali,زايد السعيدي,أسامة خالد, ,Launchpad Contributions:,Munzir "
-"Taha,Osama Khalid,Zayed Amer Al-Saidi,jasim,metehyi"
+"Majed Ali,زايد السعيدي,أسامة خالد,عبدالرحيم الفاخوري, ,Launchpad "
+"Contributions:,Munzir Taha,Osama Khalid,Zayed Amer Al-Saidi,jasim,metehyi"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
 msgstr ""
-"GMajedli@gmail.com,zayed.alsaidi@gmail.com,osamak.wfm@gmail.com,,,,osamak.wfm"
-"@gmail.com,zayed.alsaidi@gmail.com,jasimlinux@gmail.com,"
+"GMajedli@gmail.com,zayed.alsaidi@gmail.com,osamak.wfm@gmail.com,abdilra7eem@y"
+"ahoo.com,,,,osamak.wfm@gmail.com,zayed.alsaidi@gmail.com,jasimlinux@gmail.com"
+","
 
 #. i18n: file: conf/dlgadvanced.ui:17
 #. i18n: ectx: property (text), widget (QCheckBox, kcfg_ExpertMode)
@@ -2685,7 +2692,7 @@
 #. i18n: ectx: property (text), widget (QRadioButton, kcfg_FilesOverwrite)
 #: rc.cpp:53
 msgid "Overwrite"
-msgstr "أكتب عليه"
+msgstr "اطمس"
 
 #. i18n: file: conf/dlgnetwork.ui:20
 #. i18n: ectx: property (title), widget (QGroupBox, kcfg_LimitDownloads)
@@ -2725,7 +2732,7 @@
 #. i18n: ectx: property (suffix), widget (QSpinBox, kcfg_TransferSpeedLimit)
 #: rc.cpp:59 rc.cpp:65 rc.cpp:71
 msgid " KiB/s"
-msgstr ""
+msgstr " كيلوبايت/ثانية"
 
 #. i18n: file: conf/dlgnetwork.ui:95
 #. i18n: ectx: property (text), widget (QLabel, label_2)
@@ -2761,7 +2768,7 @@
 #. i18n: ectx: property (suffix), widget (QSpinBox, kcfg_ReconnectDelay)
 #: rc.cpp:83
 msgid " sec"
-msgstr ""
+msgstr " ثانية"
 
 #. i18n: file: conf/dlgnetwork.ui:193
 #. i18n: ectx: property (title), widget (QGroupBox, groupBoxCompleted)
@@ -2831,7 +2838,7 @@
 #. i18n: ectx: property (text), widget (QCheckBox, kcfg_SignatureAutomaticVerification)
 #: rc.cpp:116
 msgid "Automatic verification"
-msgstr ""
+msgstr "التحقّق التلقائيّ"
 
 #. i18n: file: conf/verificationpreferences.ui:96
 #. i18n: ectx: property (text), widget (QCheckBox, kcfg_SignatureAutomaticDownloading)
@@ -2843,7 +2850,7 @@
 #. i18n: ectx: property (text), widget (QLabel, label)
 #: rc.cpp:122
 msgid "Keyservers:"
-msgstr ""
+msgstr "خواديم المفاتيح"
 
 #. i18n: file: conf/verificationpreferences.ui:146
 #. i18n: ectx: property (text), widget (KPushButton, up)
@@ -3673,7 +3680,7 @@
 #. i18n: ectx: property (text), widget (QLabel, label)
 #: rc.cpp:610
 msgid "Remaining Time:"
-msgstr "الوقت المتبقي"
+msgstr "الوقت المتبقي:"
 
 #. i18n: file: ui/metalinkcreator/introduction.ui:17
 #. i18n: ectx: property (text), widget (QLabel, label_2)
@@ -3713,7 +3720,7 @@
 #. i18n: ectx: attribute (title), widget (QWidget, tab_3)
 #: rc.cpp:628
 msgid "Required"
-msgstr ""
+msgstr "مطلوب"
 
 #. i18n: file: ui/metalinkcreator/filedlg.ui:95
 #. i18n: ectx: property (text), widget (QLabel, label_9)
@@ -3763,7 +3770,7 @@
 #. i18n: ectx: property (text), widget (QLabel, label_2)
 #: rc.cpp:658
 msgid "Version:"
-msgstr ""
+msgstr "الإصدار:"
 
 #. i18n: file: ui/metalinkcreator/commondata.ui:56
 #. i18n: ectx: property (text), widget (QLabel, label_12)
@@ -3817,7 +3824,7 @@
 #. i18n: ectx: property (text), widget (QLabel, label_8)
 #: rc.cpp:685
 msgid "Name:"
-msgstr ""
+msgstr "الاسم:"
 
 #. i18n: file: ui/metalinkcreator/commondata.ui:157
 #. i18n: ectx: property (toolTip), widget (KLineEdit, pub_name)
@@ -3831,13 +3838,13 @@
 #. i18n: ectx: property (clickMessage), widget (KLineEdit, pub_name)
 #: rc.cpp:691
 msgid "Name of the publisher"
-msgstr ""
+msgstr "اسم الناشر"
 
 #. i18n: file: ui/metalinkcreator/commondata.ui:180
 #. i18n: ectx: property (clickMessage), widget (KLineEdit, pub_url)
 #: rc.cpp:700
 msgid "URL to the publisher"
-msgstr ""
+msgstr "عنوان URL للناشر"
 
 #. i18n: file: ui/metalinkcreator/generalwidget.ui:23
 #. i18n: ectx: property (text), widget (QLabel, label_5)
@@ -4122,13 +4129,13 @@
 #. i18n: ectx: property (text), widget (QLabel, label_3)
 #: rc.cpp:850
 msgid "Creation:"
-msgstr ""
+msgstr "الإنشاء:"
 
 #. i18n: file: ui/signaturedlg.ui:163
 #. i18n: ectx: property (text), widget (QLabel, label_4)
 #: rc.cpp:853
 msgid "Expiration:"
-msgstr ""
+msgstr "انتهاء الصلاحية:"
 
 #. i18n: file: ui/signaturedlg.ui:191
 #. i18n: ectx: property (text), widget (QLabel, label_5)
@@ -4163,7 +4170,7 @@
 #: rc.cpp:871 rc.cpp:877 rc.cpp:883
 msgctxt "No value has been set"
 msgid "Not set"
-msgstr ""
+msgstr "غير محدد"
 
 #. i18n: file: ui/transfersettingsdialog.ui:103
 #. i18n: ectx: property (text), widget (QLabel, labelUpload)
@@ -4194,20 +4201,20 @@
 #: rc.cpp:898
 msgctxt "The available mirrors (servers) for downloading"
 msgid "Mirrors"
-msgstr ""
+msgstr "المرايا"
 
 #. i18n: file: ui/transfersettingsdialog.ui:163
 #. i18n: ectx: property (text), widget (KPushButton, verification)
 #: rc.cpp:904
 msgctxt "verification of the download (e.g. by using MD5)"
 msgid "Verification"
-msgstr ""
+msgstr "التحقّق"
 
 #. i18n: file: ui/mirror/mirroradddlg.ui:29
 #. i18n: ectx: property (text), widget (QLabel, labelMirror)
 #: rc.cpp:911
 msgid "Mirror:"
-msgstr ""
+msgstr "مرآة:"
 
 #. i18n: file: ui/mirror/mirroradddlg.ui:36
 #. i18n: ectx: property (text), widget (QLabel, labelConnections)
@@ -4219,13 +4226,13 @@
 #. i18n: ectx: property (clickMessage), widget (KLineEdit, url)
 #: rc.cpp:917
 msgid "Enter a URL"
-msgstr ""
+msgstr "أدخل مسار URL"
 
 #. i18n: file: ui/mirror/mirroradddlg.ui:63
 #. i18n: ectx: property (text), widget (QLabel, labelPriority)
 #: rc.cpp:920
 msgid "Priority:"
-msgstr ""
+msgstr "الأولوية:"
 
 #. i18n: file: ui/mirror/mirroradddlg.ui:70
 #. i18n: ectx: property (toolTip), widget (KIntNumInput, priority)
@@ -4237,7 +4244,7 @@
 #. i18n: ectx: property (text), widget (QLabel, labelLocation)
 #: rc.cpp:929
 msgid "Location:"
-msgstr ""
+msgstr "الموقع:"
 
 #. i18n: file: ui/kgetui.rc:4
 #. i18n: ectx: Menu (file)
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kglobalaccel.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kglobalaccel.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kglobalaccel.po	2012-02-23 06:20:25.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kglobalaccel.po	2012-03-23 06:41:57.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:52+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:52+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: globalshortcutsregistry.cpp:233
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kgoldrunner.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kgoldrunner.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kgoldrunner.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kgoldrunner.po	2012-03-23 06:41:38.000000000 +0000
@@ -15,10 +15,9 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:45+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:47+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
-"X-Poedit-Bookmarks: -1,-1,-1,-1,-1,-1,-1,448,-1,-1\n"
 
 #: rc.cpp:1
 msgctxt "NAME OF TRANSLATORS"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kgpg.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kgpg.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kgpg.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kgpg.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,3892 +0,0 @@
-# translation of kgpg.po to
-# Copyright (C) 2004, 2006, 2007 Free Software Foundation, Inc.
-# Ahmad M. Zawawi <azawawi@emirates.net.ae>, 2004.
-# Khalid Siddig <Mjuma@kacst.edu.sa>, 2004.
-# Khaled Hosny <dr.khaled.hosny@gmail.com>, 2006.
-# خالد حسنى <khaledhosny@eglug.org>, 2006.
-# Fahad Al-Saidi <fahad.alsaidi@gmail.com>, 2007.
-# Youssef Chahibi <chahibi@gmail.com>, 2007.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-#
-msgid ""
-msgstr ""
-"Project-Id-Version: kgpg\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 13:31+0000\n"
-"PO-Revision-Date: 2012-01-25 11:07+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
-"3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:09+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"Language: ar\n"
-
-#: kgpg.h:32
-msgid ""
-"Hi,\n"
-"\n"
-"please find attached the user id '%UIDNAME%' of your key %KEYID% signed by "
-"me. This mail is encrypted with that key to make sure you control both the "
-"email address and the key.\n"
-"\n"
-"If you have multiple user ids, I sent the signature for each user id "
-"separately to that user id's associated email address. You can import the "
-"signatures by running each through `gpg --import` after you have decrypted "
-"them with `gpg --decrypt`.\n"
-"\n"
-"If you are using KGpg store the attachment to disk and then import it. Just "
-"select `Import Key...` from `Keys` menu and open the file.\n"
-"\n"
-"Note that I did not upload your key to any keyservers. If you want this new "
-"signature to be available to others, please upload it yourself. With GnuPG "
-"this can be done using gpg --keyserver subkeys.pgp.net --send-key %KEYID%.\n"
-"\n"
-"With KGpg you can right click on the key once you imported all user ids and "
-"choose `Export Public Key...`.\n"
-"\n"
-"If you have any questions, don't hesitate to ask.\n"
-msgstr ""
-
-#: caff.cpp:262
-msgctxt "Email template placeholder for key id"
-msgid "KEYID"
-msgstr "KEYID"
-
-#: caff.cpp:263
-msgctxt "Email template placeholder for key id"
-msgid "UIDNAME"
-msgstr "UIDNAME"
-
-#: caff.cpp:280
-msgid "your key "
-msgstr ""
-
-#: detailedconsole.cpp:58
-msgid "Info"
-msgstr "معلومات"
-
-#: groupedit.cpp:34
-msgid "Available Keys"
-msgstr "المفاتيح المتوفرة"
-
-#. i18n: file: groupedit.ui:22
-#. i18n: ectx: property (text), widget (QLabel, textLabel1)
-#: rc.cpp:250
-msgid "Available Trusted Keys"
-msgstr "المفاتيح الموثُوقة المتوفرة"
-
-#: keyinfodialog.cpp:373
-msgid ""
-"<qt>The requested key is not present in the keyring anymore.<br />Perhaps it "
-"was deleted by another application</qt>"
-msgstr ""
-
-#: keyinfodialog.cpp:373
-msgid "Key not found"
-msgstr "لم يعثر على المفتاح"
-
-#: keyinfodialog.cpp:387
-msgctxt "no email address"
-msgid "none"
-msgstr "بدون"
-
-#: keyinfodialog.cpp:402
-msgid ""
-"<qt>The left part is the algorithm used by the <b>signature</b> key. The "
-"right part is the algorithm used by the <b>encryption</b> key.</qt>"
-msgstr ""
-
-#: core/kgpgkey.cpp:504
-msgctxt "Unlimited key lifetime"
-msgid "Unlimited"
-msgstr "غير محدود"
-
-#: keyinfodialog.cpp:408
-msgid ""
-"<qt>The left part is the size of the <b>signature</b> key. The right part is "
-"the size of the <b>encryption</b> key.</qt>"
-msgstr ""
-
-#: keyinfodialog.cpp:412
-msgctxt "no key comment"
-msgid "none"
-msgstr "بدون"
-
-#: keyinfodialog.cpp:520
-msgid "Passphrase for the key was changed"
-msgstr "غيّرت عبارة المرور للمفتاح"
-
-#: keyinfodialog.cpp:523
-msgid "Bad old passphrase, the passphrase for the key was not changed"
-msgstr "عبارة المرورالقديمة سيئة، عبارة المرور للمفتاح لم تغير."
-
-#: keyinfodialog.cpp:523
-msgid "Could not change passphrase"
-msgstr "تعذّر تغيير عبارة المرور"
-
-#: keyinfodialog.cpp:528
-msgid ""
-"KGpg was unable to change the passphrase.<br />Please see the detailed log "
-"for more information."
-msgstr ""
-"لم يستطع KGpg تغير العبارة السرية.<br />الرجاء رؤية السجل المفصل لمزيد من "
-"المعلومات."
-
-#: keyinfodialog.cpp:566
-msgid "Changing key properties failed."
-msgstr "تغير خصائص المفتاح فشلت."
-
-#: keyinfodialog.cpp:186 keyinfodialog.cpp:566
-msgid "Key properties"
-msgstr "خصائص المفتاح"
-
-#: keyservers.cpp:51
-msgid "Key Server"
-msgstr "خادم المفاتيح"
-
-#: keyservers.cpp:107 keyservers.cpp:178
-msgid "You must enter a search string."
-msgstr "يجب عليك إدخال نص البحث."
-
-#: keyservers.cpp:119
-msgid "You need to configure keyservers before trying to download keys."
-msgstr "أنت بحاجة إلى ضبط خوادم المفاتيح قبل أن تحاول تنزيل المفاتيح."
-
-#: keyservers.cpp:120
-msgid "No keyservers defined"
-msgstr "لا يوجد خوادم المفاتيح معرفة"
-
-#: keyservers.cpp:157
-msgctxt "Caption of message box"
-msgid "Key Import Finished"
-msgstr "استيراد المفتاح انتهى"
-
-#: keyservers.cpp:166
-msgid "Upload to keyserver finished without errors"
-msgstr "انتهى الرفع إلى خادم المفاتيح بدون أخطاء"
-
-#: keyservers.cpp:168
-msgid "Upload to keyserver failed"
-msgstr "فشل الرفع إلى خادم المفاتيح"
-
-#: keyservers.cpp:193 keysmanager.cpp:1358
-msgid "Import Key From Keyserver"
-msgid_plural "Import Keys From Keyserver"
-msgstr[0] ""
-msgstr[1] ""
-
-#. i18n: file: keyserver.ui:144
-#. i18n: ectx: property (text), widget (QPushButton, Buttonimport)
-#: keyservers.cpp:198 rc.cpp:324 editor/kgpgtextedit.cpp:377
-msgid "&Import"
-msgstr "ا&ستورد"
-
-#: keyservers.cpp:203
-msgid "Connecting to the server..."
-msgstr "جاري الاتصال بالملقم..."
-
-#: keyservers.cpp:294
-#, kde-format
-msgid "Found 1 matching key"
-msgid_plural "Found %1 matching keys"
-msgstr[0] ""
-msgstr[1] ""
-
-#: keyservers.cpp:278
-msgid "No matching keys found"
-msgstr ""
-
-#: keyservers.cpp:344
-msgid "You must choose a key."
-msgstr "يجب عليك اختيار مفتاح."
-
-#: keysmanager.cpp:128
-msgid "Key Management"
-msgstr "إدارة المفاتيح"
-
-#: keysmanager.cpp:137
-msgid "&Open Editor"
-msgstr "افت&ح المحرر"
-
-#: keysmanager.cpp:141
-msgid "&Key Server Dialog"
-msgstr "مربع حوار خادم ال&مفاتيح"
-
-#: keysmanager.cpp:147 selectpublickeydialog.cpp:139
-msgid "&Go to Default Key"
-msgstr "اذ&هب للمفتاح الافتراضي"
-
-#: keysmanager.cpp:169
-msgid "Tip of the &Day"
-msgstr "&نصيحة اليوم"
-
-#: keysmanager.cpp:173
-msgid "View GnuPG Manual"
-msgstr "عرض كتيب GnuPG"
-
-#: keysmanager.cpp:179
-msgid "&Refresh List"
-msgstr "&حدّث القائمة"
-
-#: keysmanager.cpp:185
-msgid "&Show Only Secret Keys"
-msgstr ""
-
-#: keysmanager.cpp:190
-msgid "Show &Long Key Id"
-msgstr ""
-
-#: keysmanager.cpp:196
-msgid "K&ey Properties"
-msgstr "خ&صائص المفتاح"
-
-#: keysmanager.cpp:201
-msgid "Edit Key in &Terminal"
-msgstr "تحرير المفتاح في ال&طرفية"
-
-#: keysmanager.cpp:207
-msgid "&Generate Key Pair..."
-msgstr "&ولّد زوج مفاتيح ..."
-
-#: keysmanager.cpp:218
-msgid "&Import Key..."
-msgstr "استور&د مفتاح..."
-
-#: keysmanager.cpp:224
-msgid "&Create New Contact in Address Book"
-msgstr "أن&شئ جهة اتصال جديدة في دفتر العناوين"
-
-#: keysmanager.cpp:232
-msgid "&Edit Group..."
-msgstr "حرّر م&جموعة..."
-
-#: keysmanager.cpp:236
-msgid "&Delete Group"
-msgstr "احذف &مجموعة"
-
-#: keysmanager.cpp:238
-msgid "&Rename Group"
-msgstr ""
-
-#: keysmanager.cpp:246
-msgid "Set as De&fault Key"
-msgstr "حدّد كمفتاح افترا&ضي"
-
-#: keysmanager.cpp:249
-msgid "&Add Photo..."
-msgstr "أ&ضف صورة..."
-
-#: keysmanager.cpp:252
-msgid "&Add User Id..."
-msgstr "أ&ضف هوية مستخدم..."
-
-#: keysmanager.cpp:255
-msgid "Export Secret Key..."
-msgstr "صدّر المفتاح السري..."
-
-#: keysmanager.cpp:258
-msgid "Delete Key Pair"
-msgstr "احذف زوج المفاتيح"
-
-#: keysmanager.cpp:262
-msgid "Revoke Key..."
-msgstr "أبطل مفتاح..."
-
-#: keysmanager.cpp:265
-msgid "&Regenerate Public Key"
-msgstr "أ&عد توليد المفتاح العام"
-
-#: keysmanager.cpp:271
-msgid "Set User Id as &Primary"
-msgstr "ضع هوية المستخدم &كأولية"
-
-#: keysmanager.cpp:275
-msgid "&Open Photo"
-msgstr "افتح ال&صورة"
-
-#: keysmanager.cpp:279
-msgid "&Delete Photo"
-msgstr "احذف الص&ورة"
-
-#: keysmanager.cpp:287
-msgid "Import &Missing Signatures From Keyserver"
-msgstr "استورد التواقيع المفقودة من خادم المفاتيح"
-
-#: keysmanager.cpp:303 model/kgpgitemmodel.cpp:285
-msgid "Trust"
-msgstr "ثقة"
-
-#: keysmanager.cpp:306 model/kgpgitemmodel.cpp:286
-msgid "Size"
-msgstr "حجم"
-
-#: keysmanager.cpp:309 model/kgpgitemmodel.cpp:288
-msgid "Creation"
-msgstr "إنشاء"
-
-#: keysmanager.cpp:312 model/kgpgitemmodel.cpp:287
-msgid "Expiration"
-msgstr "إنتهاء الصلاحية"
-
-#: keysmanager.cpp:317
-msgid "&Photo ID's"
-msgstr "&صور الهويات"
-
-#. i18n: file: conf_misc.ui:139
-#. i18n: ectx: property (text), item, widget (KComboBox, kcfg_SignMenu)
-#. i18n: file: conf_misc.ui:178
-#. i18n: ectx: property (text), item, widget (KComboBox, kcfg_DecryptMenu)
-#: keysmanager.cpp:321 rc.cpp:155 rc.cpp:169
-msgid "Disable"
-msgstr "عطّل"
-
-#: keysmanager.cpp:322
-msgctxt "small picture"
-msgid "Small"
-msgstr "صغير"
-
-#: keysmanager.cpp:323
-msgctxt "medium picture"
-msgid "Medium"
-msgstr "متوسط"
-
-#: keysmanager.cpp:324
-msgctxt "large picture"
-msgid "Large"
-msgstr "كبير"
-
-#: keysmanager.cpp:328
-msgid "Minimum &Trust"
-msgstr ""
-
-#: keysmanager.cpp:331
-msgctxt "no filter: show all keys"
-msgid "&None"
-msgstr "&بدون"
-
-#: keysmanager.cpp:332
-msgctxt "show only active keys"
-msgid "&Active"
-msgstr "&نشط"
-
-#: keysmanager.cpp:333
-msgctxt "show only keys with at least marginal trust"
-msgid "&Marginal"
-msgstr "&هامشية"
-
-#: keysmanager.cpp:334
-msgctxt "show only keys with at least full trust"
-msgid "&Full"
-msgstr "&كامل"
-
-#: keysmanager.cpp:335
-msgctxt "show only ultimately trusted keys"
-msgid "&Ultimate"
-msgstr "&غير محدود"
-
-#. i18n: file: searchres.ui:28
-#. i18n: ectx: property (text), widget (QLabel, filterEditLabel)
-#: keysmanager.cpp:435 rc.cpp:570
-msgid "Search:"
-msgstr "ابحث:"
-
-#: keysmanager.cpp:445
-msgctxt ""
-"Name of the action that is a search line, shown for example in the toolbar "
-"configuration dialog"
-msgid "Search Line"
-msgstr "بحث خطي"
-
-#: keysmanager.cpp:450
-msgctxt "Name of the action that gives the focus to the search line"
-msgid "Focus Search Line"
-msgstr "ركز على سطر البحث"
-
-#: keysmanager.cpp:498
-msgid ""
-"Another key generation operation is still in progress.\n"
-"Please wait a moment until this operation is complete."
-msgstr ""
-
-#: keysmanager.cpp:499 keysmanager.cpp:524 keysmanager.cpp:573
-msgid "Generating new key pair"
-msgstr "جاري توليد زوج  مفاتيح جديد."
-
-#: keysmanager.cpp:525
-msgid "Can not start \"konsole\" application for expert mode."
-msgstr ""
-
-#: keysmanager.cpp:566 keysmanager.cpp:2569
-msgctxt "Application ready for user input"
-msgid "Ready"
-msgstr "مستعد"
-
-#: keysmanager.cpp:577
-msgid "Bad passphrase. Cannot generate a new key pair."
-msgstr "عبارة مرور سيّئة لم يستطع توليد زوج مفاتيح جديد."
-
-#: keysmanager.cpp:580
-msgid "Aborted by the user. Cannot generate a new key pair."
-msgstr "أجهض من قبل المستخدم. لم يستطع توليد زوج مفاتيح جديد."
-
-#: keysmanager.cpp:583
-msgid "The email address is not valid. Cannot generate a new key pair."
-msgstr "عنوان البريد الالكتروني غير صالح. لم يستطع توليد زوج مفاتيح  جديد."
-
-#: keysmanager.cpp:586
-msgid "The name is not accepted by gpg. Cannot generate a new key pair."
-msgstr "الاسم لم يقبل من قبل gpg.  لم يستطع توليد زوج مفاتيح جديد.."
-
-#. i18n: file: newkey.ui:13
-#. i18n: ectx: property (windowTitle), widget (QWidget, newKey)
-#: keysmanager.cpp:592 rc.cpp:527
-msgid "New Key Pair Created"
-msgstr "ولّدَ زوج مفاتيح جديد"
-
-#: keysmanager.cpp:632 keysmanager.cpp:636
-msgid "backup copy"
-msgstr "نسخه احتياطية"
-
-#: keysmanager.cpp:642
-msgid "gpg process did not finish. Cannot generate a new key pair."
-msgstr "لم تنته عملية gpg . لم يستطع توليد زوج مفاتيح جديد.."
-
-#: keysmanager.cpp:750
-msgid "You can only refresh primary keys. Please check your selection."
-msgstr "يمكنك انعاش المفاتيح الأولية فقط. فضلا افحص اختيارك."
-
-#: keysmanager.cpp:864
-msgid ""
-"Another operation is still in progress.\n"
-"Please wait a moment until this operation is complete."
-msgstr ""
-
-#: keysmanager.cpp:864 keysmanager.cpp:869
-msgid "Add New User Id"
-msgstr "أضف هوية مستخدم جديد"
-
-#: keysmanager.cpp:931
-msgid ""
-"The image must be a JPEG file. Remember that the image is stored within your "
-"public key, so if you use a very large picture, your key will become very "
-"large as well. The size should not exceed 6 KiB. An image size of around "
-"240x288 is a good size to use."
-msgstr ""
-
-#: keysmanager.cpp:936
-#, kde-format
-msgid ""
-"<qt>Are you sure you want to delete Photo id <b>%1</b><br/>from key <b>%2 "
-"&lt;%3&gt;</b>?</qt>"
-msgstr ""
-"<qt>هل تريد حقا حذف صورة الهوية<b>%1</b><br>من المفتاح <b>%2 &lt;%3&gt;</b> "
-"?</qt>"
-
-#: keysmanager.cpp:1037
-#, kde-format
-msgid "<qt>Search string '<b>%1</b>' not found.</qt>"
-msgstr "<qt>تعذر العثور على عبارة البحث'<b>%1</b>' </qt>."
-
-#: keysmanager.cpp:1110
-msgid "Unable to contact the address book. Please check your installation."
-msgstr "تعذر الاتصال بدفتر العناوين. رجاءا افحص تثبيتك للبرنامج."
-
-#: keysmanager.cpp:1171
-msgid "Public Key"
-msgstr "مفتاح عام"
-
-#: keysmanager.cpp:1174
-msgid "Sub Key"
-msgstr "مفتاح فرعى"
-
-#: keysmanager.cpp:1177
-msgid "Secret Key Pair"
-msgstr "زوج مفاتيح سرى"
-
-#: keysmanager.cpp:1180
-msgid "Key Group"
-msgstr "مجموعة مفاتيح"
-
-#: keysmanager.cpp:1183
-msgid "Signature"
-msgstr "التوقيع"
-
-#: keysmanager.cpp:1186
-msgid "User ID"
-msgstr "هوية مستخدم"
-
-#: keysmanager.cpp:1189
-msgid "Revocation Signature"
-msgstr "توقيع الإلغاء"
-
-#: keysmanager.cpp:1192
-msgid "Photo ID"
-msgstr "صورة الهوية"
-
-#: keysmanager.cpp:1195
-msgid "Orphaned Secret Key"
-msgstr "المفاتيح السرية اليتيمة"
-
-#: keysmanager.cpp:1200
-msgid "Group member"
-msgstr "عضو المجموعة"
-
-#: keysmanager.cpp:1307
-msgid "&Sign User ID ..."
-msgid_plural "&Sign User IDs ..."
-msgstr[0] ""
-msgstr[1] ""
-
-#: keysmanager.cpp:1335
-msgid "Sign and &Mail User ID ..."
-msgid_plural "Sign and &Mail User IDs ..."
-msgstr[0] ""
-msgstr[1] ""
-
-#: keysmanager.cpp:1308
-msgid "E&xport Public Key..."
-msgid_plural "E&xport Public Keys..."
-msgstr[0] ""
-msgstr[1] ""
-
-#: keysmanager.cpp:1309
-msgid "&Refresh Key From Keyserver"
-msgid_plural "&Refresh Keys From Keyserver"
-msgstr[0] ""
-msgstr[1] ""
-
-#: keysmanager.cpp:1310
-msgid "&Create Group with Selected Key..."
-msgid_plural "&Create Group with Selected Keys..."
-msgstr[0] ""
-msgstr[1] ""
-
-#: keysmanager.cpp:1311
-msgid "&Sign Key..."
-msgid_plural "&Sign Keys..."
-msgstr[0] ""
-msgstr[1] ""
-
-#: keysmanager.cpp:1312
-msgid "&Delete User ID"
-msgid_plural "&Delete User IDs"
-msgstr[0] ""
-msgstr[1] ""
-
-#: keysmanager.cpp:1360
-msgid "Delete Sign&ature"
-msgid_plural "Delete Sign&atures"
-msgstr[0] ""
-msgstr[1] ""
-
-#: keysmanager.cpp:1381
-msgid "&Delete Key"
-msgid_plural "&Delete Keys"
-msgstr[0] ""
-msgstr[1] ""
-
-#: kgpginterface.cpp:862
-msgid "Creation of the revocation certificate failed..."
-msgstr "فشل إنشاء شهادة سحب الترخيص."
-
-#: keysmanager.cpp:1454
-msgid ""
-"<qt>Secret keys <b>should not</b> be saved in an unsafe place.<br/>If "
-"someone else can access this file, encryption with this key will be "
-"compromised.<br/>Continue key export?</qt>"
-msgstr ""
-"<qt>المفاتيح السرية <b>لا يجب</b> حفظها في الأماكن غير الآمنة.<br/>إذا كان "
-"بإمكان أي شخص الوصول إلى هذا الملف ، فإن التشفير بهذا الرقمستنعدم "
-"فائدته.<br/>هل أتابع تصدير المفتاح؟</qt>"
-
-#: keysmanager.cpp:1489
-msgid "*.asc|*.asc Files"
-msgstr ""
-
-#: keysmanager.cpp:1466
-msgid "Export PRIVATE KEY As"
-msgstr "صدر المفتاح الخاص كـ"
-
-#: keysmanager.cpp:1484
-#, kde-format
-msgid ""
-"<qt>Your <b>private</b> key \"%1\" was successfully exported "
-"to<br/>%2.<br/><b>Do not</b> leave it in an insecure place.</qt>"
-msgstr ""
-"<qt>مفتاحك <b>الخاص</b> \"%1\" صدر بنجاح إلى<br/>%2.<br/><b>لا </b> تتركه في "
-"مكان غير آمن.</qt>"
-
-#: keysmanager.cpp:1487
-msgid ""
-"Your secret key could not be exported.\n"
-"Check the key."
-msgstr ""
-"تعذر تصدير المفتاح السري الخاص بك.\n"
-"افحص المفتاح."
-
-#: keysmanager.cpp:1520
-msgid "Public Key Export"
-msgstr "تصدير المفتاح العام"
-
-#: keysmanager.cpp:1537 editor/kgpgeditor.cpp:507
-msgid "Save File"
-msgstr "احفظ ملف"
-
-#: keysmanager.cpp:1601
-#, kde-format
-msgid "<qt>The public key was successfully exported to<br/>%2</qt>"
-msgid_plural ""
-"<qt>The %1 public keys were successfully exported to<br/>%2</qt>"
-msgstr[0] ""
-msgstr[1] ""
-
-#: keysmanager.cpp:1605 keysmanager.cpp:1620 keysmanager.cpp:1634
-msgid ""
-"Your public key could not be exported\n"
-"Check the key."
-msgstr ""
-"تعذر تصدير مفتاحك العام\n"
-"افحص المفتاح."
-
-#: keysmanager.cpp:1658
-msgid ""
-"<qt>A viewer for JPEG images is not specified.<br/>Please check your "
-"installation.</qt>"
-msgstr ""
-
-#: keysmanager.cpp:1658
-msgid "Show photo"
-msgstr "أظهر الصورة"
-
-#: keysmanager.cpp:1743
-msgid ""
-"<p>This key is an orphaned secret key (secret key without public key.) It is "
-"currently not usable.</p><p>Would you like to regenerate the public key?</p>"
-msgstr ""
-"<p>هذا المفتاح عبارة عن مفتاح سرى يتيم (مفتاح سرى بدون مفتاح عام.) لا فائدة "
-"منه حاليا. </p><p>هل ترغب فى اعادة توليد المفتاح العام؟</p>"
-
-#: keysmanager.cpp:1744
-msgid "Generate"
-msgstr "ولّد"
-
-#: keysmanager.cpp:1744
-msgid "Do Not Generate"
-msgstr "لا تولّد"
-
-#: keysmanager.cpp:1774
-#, kde-format
-msgid "<qt>Are you sure you want to delete group <b>%1</b> ?</qt>"
-msgstr "<qt>أمتأكد من أنك تريد حذف المجموعة <b>%1</b> ؟</qt>"
-
-#: keysmanager.cpp:1774 keysmanager.cpp:2372
-msgid "Delete"
-msgstr "اح&ذف"
-
-#: keysmanager.cpp:1811
-msgid "Rename Group"
-msgstr ""
-
-#: keysmanager.cpp:1812
-msgctxt "Enter the new name for the key group being renamed"
-msgid "Enter new group name:"
-msgstr ""
-
-#: keysmanager.cpp:1797
-msgid ""
-"<qt>You cannot create a group containing signatures, subkeys or other "
-"groups.</qt>"
-msgstr ""
-"<qt>لا يمكنك انشاء مجموعة تحتوي على توقيعات أو مفاتيح فرعيه أو مجموعات أخرى "
-". </qt>"
-
-#: keysmanager.cpp:1411 keysmanager.cpp:1806
-#, kde-format
-msgctxt "<Name> (<Email>) ID: <KeyId>"
-msgid "%1 (%2) ID: %3"
-msgstr "%1 (%2) رقم: %3"
-
-#: keysmanager.cpp:1811
-msgid "Create New Group"
-msgstr "أنشئ مجموعة جديده"
-
-#: keysmanager.cpp:1812
-msgctxt "Enter the name of the group you are creating now"
-msgid "Enter new group name:"
-msgstr "أدخل اسم المجموعة الجديده:"
-
-#: keysmanager.cpp:1818
-msgid ""
-"Following keys are not valid or not trusted and will not be added to the "
-"group:"
-msgstr ""
-"المفاتيح التاليه ليست صالحة أو غير موثوق بها و لن يتم اضافتها للمجموعة:"
-
-#: keysmanager.cpp:1827
-#, kde-format
-msgid ""
-"<qt>No valid or trusted key was selected. The group <b>%1</b> will not be "
-"created.</qt>"
-msgstr ""
-"<qt>لم يحدد مفتاح صالح أو موثوق به . لن تنشء المجموعة <b>%1</b> .</qt>"
-
-#: keysmanager.cpp:1839
-msgid "Group Properties"
-msgstr "خصائص المجموعة"
-
-#: keysmanager.cpp:1876
-msgid "You can only sign primary keys. Please check your selection."
-msgstr "يمكنك توقيع المفاتيح الأولية فقط. فضلا افحص اختيارك."
-
-#: keysmanager.cpp:1885
-#, kde-format
-msgid ""
-"<qt>You are about to sign key:<br /><br />%1<br />ID: %2<br />Fingerprint: "
-"<br /><b>%3</b>.<br /><br />You should check the key fingerprint by phoning "
-"or meeting the key owner to be sure that someone is not trying to intercept "
-"your communications.</qt>"
-msgstr ""
-"<qt>أنت مقبل على توقيع المفتاح:<br /><br />%1<br />رقم الهوية: %2<br />بصمة "
-"الأصبع: <br /><b>%3</b><br /><br />ينبغي أن تتحقق من بصمة المفتاح بالاتصال "
-"هاتفيا أو مقابلة مالك المفتاح لتكون متأكدا من أنه لا يوجد من يحاول إعتراض "
-"اتصالاتك</qt>"
-
-#: keysmanager.cpp:1889
-#, kde-format
-msgid ""
-"<qt>You are about to sign key:<br /><br />%1 (%2)<br />ID: %3<br "
-"/>Fingerprint: <br /><b>%4</b>.<br /><br />You should check the key "
-"fingerprint by phoning or meeting the key owner to be sure that someone is "
-"not trying to intercept your communications.</qt>"
-msgstr ""
-
-#: keysmanager.cpp:1903 keysmanager.cpp:1985 kgpgfirstassistant.cpp:279
-#: model/keylistproxymodel.cpp:100
-#, kde-format
-msgctxt "Name: ID"
-msgid "%1: %2"
-msgstr "%1: %2"
-
-#: keysmanager.cpp:1905 keysmanager.cpp:1988 kgpgfirstassistant.cpp:281
-#, kde-format
-msgctxt "Name (Email): ID"
-msgid "%1 (%2): %3"
-msgstr "%1 (%2): %3"
-
-#: keysmanager.cpp:1911
-msgid ""
-"<qt>You are about to sign the following keys in one pass.<br/><b>If you have "
-"not carefully checked all fingerprints, the security of your communications "
-"may be compromised.</b></qt>"
-msgstr ""
-"<qt>أنت مقبل على توقيعن المفاتيح التالية في ترخيص واحد.<br><b>إذا لم تتحقق "
-"بحذر من كل بصمات الأصبع, ربما يكون أمن اتصالاتك معرضاً للخطر.</b></qt>"
-
-#: keysmanager.cpp:1951
-msgid ""
-"You can only sign user ids and photo ids. Please check your selection."
-msgstr "يمكنك توقيع رقم المستخدم و رقم الصورة. فضلا افحص اختيارك."
-
-#: keysmanager.cpp:1965
-#, kde-format
-msgid ""
-"<qt>You are about to sign user id:<br /><br />%1<br />ID: %2<br "
-"/>Fingerprint: <br /><b>%3</b>.<br /><br />You should check the key "
-"fingerprint by phoning or meeting the key owner to be sure that someone is "
-"not trying to intercept your communications.</qt>"
-msgstr ""
-"<qt>أنت مقبل على توقيع هوية مستخد:<br /><br />%1<br />رقم الهوية: %2<br "
-"/>بصمة الأصبع: <br /><b>%3</b>.<br /><br />ينبغي أن تتحقق من بصمة المفتاح "
-"بالاتصال هاتفيا أو مقابلة مالك المفتاح لتكون متأكدا من أنه لا يوجد من يحاول "
-"إعتراض اتصالاتك</qt>"
-
-#: keysmanager.cpp:1969
-#, kde-format
-msgid ""
-"<qt>You are about to sign user id:<br /><br />%1 (%2)<br />ID: %3<br "
-"/>Fingerprint: <br /><b>%4</b>.<br /><br />You should check the key "
-"fingerprint by phoning or meeting the key owner to be sure that someone is "
-"not trying to intercept your communications.</qt>"
-msgstr ""
-
-#: keysmanager.cpp:1994
-msgid ""
-"<qt>You are about to sign the following user ids in one pass.<br/><b>If you "
-"have not carefully checked all fingerprints, the security of your "
-"communications may be compromised.</b></qt>"
-msgstr ""
-
-#: keysmanager.cpp:2064
-#, kde-format
-msgid "<qt>Bad passphrase, key <b>%1 (%2)</b> not signed.</qt>"
-msgstr ""
-
-#: keysmanager.cpp:2068
-#, kde-format
-msgid "<qt>The key <b>%1 (%2)</b> is already signed.</qt>"
-msgstr ""
-
-#: keysmanager.cpp:2073
-#, kde-format
-msgid ""
-"<qt>Signing key <b>%1</b> with key <b>%2</b> failed.<br />Do you want to try "
-"signing the key in console mode?</qt>"
-msgstr ""
-"فشل <qt>توقيع المفتاح <b>%1</b> بالمفتاح <b>%2</b>.<br/>هل تريد محاولة توقيع "
-"المفتاح في نمط الكونسول؟</qt>"
-
-#: keysmanager.cpp:2141
-msgid "All signatures for this key are already in your keyring"
-msgid_plural "All signatures for this keys are already in your keyring"
-msgstr[0] "كل التواقيع لهذا المفتاح لم توجد أصلا في حلقة مفاتيحك"
-msgstr[1] "كل التواقيع لهذا المفتاح موجودة أصلا في حلقة مفاتيحك"
-msgstr[2] "كل التواقيع لهذين المفتاحين موجودة أصلا في حلقة مفاتيحك"
-msgstr[3] "كل التواقيع لهذا المفاتيح موجودة أصلا في حلقة مفاتيحك"
-msgstr[4] "كل التواقيع لهذا المفتاح موجودة أصلا في حلقة مفاتيحك"
-msgstr[5] "كل التواقيع لهذا المفتاح موجودة أصلا في حلقة مفاتيحك"
-
-#: keysmanager.cpp:2230
-msgid "Edit key manually to delete a self-signature."
-msgstr "حرّر المفتاح يدويا لحذف توقيع-شخصي."
-
-#: keysmanager.cpp:2234
-#, kde-format
-msgid ""
-"<qt>Are you sure you want to delete signature<br /><b>%1</b><br />from user "
-"id <b>%2</b><br />of key: <b>%3</b>?</qt>"
-msgstr ""
-"<qt>هل ترغب بتأكيد حذف التوقيع<br /><b>%1</b><br />من هوية المستخدم "
-"<b>%2</b><br />للمفتاح: <b>%3</b>؟</qt>"
-
-#: keysmanager.cpp:2253
-msgid "Requested operation was unsuccessful, please edit the key manually."
-msgstr "لم تنجح العملية المطلوبة، فضلا قم بتحرير المفتاح يدويا."
-
-#: keysmanager.cpp:2325
-msgid ""
-"<qt>The key you are deleting is a member of the following key group. Do you "
-"want to remove it from this group?</qt>"
-msgid_plural ""
-"<qt>The key you are deleting is a member of the following key groups. Do you "
-"want to remove it from these groups?</qt>"
-msgstr[0] ""
-msgstr[1] ""
-
-#: keysmanager.cpp:2329 keysmanager.cpp:2379 keysmanager.cpp:2394
-#: keysmanager.cpp:2397 keysmanager.cpp:2407 keysmanager.cpp:2421
-#: keysmanager.cpp:2431
-msgid "Delete key"
-msgstr "اح&ذف المفتاح"
-
-#: keysmanager.cpp:2370
-#, kde-format
-msgid ""
-"<p>Delete <b>secret</b> key pair <b>%1</b>?</p>Deleting this key pair means "
-"you will never be able to decrypt files encrypted with this key again."
-msgstr ""
-
-#: keysmanager.cpp:2379 keysmanager.cpp:2407
-msgid ""
-"Another key delete operation is still in progress.\n"
-"Please wait a moment until this operation is complete."
-msgstr ""
-
-#: keysmanager.cpp:2394
-#, kde-format
-msgid "Key <b>%1</b> deleted."
-msgstr ""
-
-#: keysmanager.cpp:2397
-#, kde-format
-msgid "Deleting key <b>%1</b> failed."
-msgstr ""
-
-#: keysmanager.cpp:2421
-#, kde-format
-msgid "Can not delete key <b>%1</b> while it is edited in terminal."
-msgstr "غير قادر على حذف المفتاح <b>%1</b> خلال تحريره في الطرفية."
-
-#: keysmanager.cpp:2431
-msgid ""
-"You have selected items that are not keys. They can not be deleted with this "
-"menu entry."
-msgstr ""
-
-#: keysmanager.cpp:2453
-#, kde-format
-msgid ""
-"<qt>The following are secret key pairs:<br/><b>%1</b><br/>They will not be "
-"deleted.</qt>"
-msgstr ""
-"<qt>المفاتيح التالية هي أزواج مفاتيح سرية:<br/><b>%1</b><br/>فلن يتم حذفها. "
-"</qt>"
-
-#: keysmanager.cpp:2465
-#, kde-format
-msgid "<qt><b>Delete the following public key?</b></qt>"
-msgid_plural "<qt><b>Delete the following %1 public keys?</b></qt>"
-msgstr[0] "<qt><b> لا تحذف أي مفتاح عام؟</b></qt>"
-msgstr[1] "<qt><b>حذف المفتاح العام التالي?</b></qt>"
-msgstr[2] "<qt><b>حذف المفتاحين العامين التاليين?</b></qt>"
-msgstr[3] "<qt><b>حذف ال %1 مفاتيح العامة التالية?</b></qt>"
-msgstr[4] "<qt><b>حذف ال %1 مفتاحاً عاما التالية?</b></qt>"
-msgstr[5] "<qt><b>حذف ال %1 مفتتاح عاة التالية?</b></qt>"
-
-#: keysmanager.cpp:2496 keysmanager.cpp:2555
-msgid "Key Import"
-msgstr "استورد مفتاح"
-
-#: keysmanager.cpp:2503
-msgid "Open File"
-msgstr "افتح ملف"
-
-#: keysmanager.cpp:2616
-msgid ""
-"<qt>The text in the clipboard does not look like a key, but like encrypted "
-"text.<br />Do you want to decrypt it first and then try importing it?</qt>"
-msgstr ""
-
-#: keysmanager.cpp:2617
-msgid "Import from Clipboard"
-msgstr "استورد من الحافظة"
-
-#: keysmanager.cpp:2538
-msgid "Importing..."
-msgstr "جارى الإستيرا&د..."
-
-#: keysmanager.cpp:2555
-msgid ""
-"Key importing failed. Please see the detailed log for more information."
-msgstr "فشل استيراد المفتاح. افحص السجل المفصل لمزيد من المعلومات."
-
-#: keysmanager.cpp:2621
-msgid "KGpg - encryption tool"
-msgstr "KGpg - أداة تشفير"
-
-#: keysmanager.cpp:2642
-msgid "Ke&y Manager"
-msgstr "م&دير المفتاح"
-
-#: keysmanager.cpp:2646
-msgid "&Encrypt Clipboard"
-msgstr "ش&فّر الحافظة"
-
-#: keysmanager.cpp:2649
-msgid "&Decrypt Clipboard"
-msgstr "ف&ك تشفير الحافظة"
-
-#: keysmanager.cpp:2652
-msgid "&Sign/Verify Clipboard"
-msgstr "و&قّع/افحص الحافظة"
-
-#: keysmanager.cpp:2684 keysmanager.cpp:2743 keysmanager.cpp:2761
-msgid "Clipboard is empty."
-msgstr "الحافظة فارغة."
-
-#: keysmanager.cpp:2733
-msgid "Text successfully encrypted."
-msgstr ""
-
-#: keytreeview.cpp:167
-#, kde-format
-msgid "<p>Do you want to import file <b>%1</b> into your key ring?</p>"
-msgstr "<p>هل تريد استيراد الملف <b>%1</b>إلى حلقة مفاتيحك?</p>"
-
-#. i18n: file: keyserver.ui:32
-#. i18n: ectx: attribute (title), widget (QWidget, tab)
-#: keytreeview.cpp:168 kgpgtextinterface.cpp:671 rc.cpp:298
-msgid "Import"
-msgstr "ا&ستورد"
-
-#: keytreeview.cpp:169 kgpgtextinterface.cpp:671
-msgid "Do Not Import"
-msgstr "لا تستورد"
-
-#: kgpg.cpp:91
-#, kde-format
-msgid ""
-"<qt>The use of <b>GnuPG Agent</b> is enabled in GnuPG's configuration file "
-"(%1).<br />However, the agent does not seem to be running. This could result "
-"in problems with signing/decryption.<br />Please disable GnuPG Agent from "
-"KGpg settings, or fix the agent.</qt>"
-msgstr ""
-"تم تمكين <qt>استخدام <b>عميل GnuPG</b> في ملف إعداد  GnuPG (%1).<br>مع ذلك, "
-"لا يبدو أن العميل يعمل. قد يؤدى هذا الى مشاكل فى توقيع/فك التشفير.< / br> "
-"فضلا عطل عميل GnuPG من إعدادات KGpg,أو قم بإصلاح العميل.</qt>"
-
-#: kgpg.cpp:128
-msgid ""
-"Unable to perform requested operation.\n"
-"Please select only one folder, or several files, but do not mix files and "
-"folders."
-msgstr ""
-"تعذر تنفيذ العملية المطلوبة.\n"
-"فضلا اختر مجلدا واحدا فقط أو عدة ملفات، ولكن لا تخلط الملفات والمجلدات معا."
-
-#: kgpg.cpp:143
-msgid "Cannot decrypt and show folder."
-msgstr "لا يمكن فك تشفير و عرض المجلد."
-
-#: kgpg.cpp:148
-msgid "Cannot sign folder."
-msgstr "لا يمكن توقيع المجلد."
-
-#: kgpg.cpp:153
-msgid "Cannot verify folder."
-msgstr "لا يمكن فحص المجلد."
-
-#: kgpgexternalactions.cpp:76
-#, kde-format
-msgid ""
-"<qt>KGpg will now create a temporary archive file:<br /><b>%1</b> to process "
-"the encryption. The file will be deleted after the encryption is "
-"finished.</qt>"
-msgstr ""
-"<qt>سوف يقوم KGpg الآن بانشاء ملف أرشيف مؤقت:<br/><b>%1</b>للبدأ في التشفير. "
-"سوف يتم مسح الملف بعد الانتهاء من التشفير.</qt>"
-
-#: kgpgexternalactions.cpp:77
-msgid "Temporary File Creation"
-msgstr "انشاء ملف مؤقت"
-
-#: kgpgexternalactions.cpp:85
-msgid "Compression method for archive:"
-msgstr "طريقة الضغط للأرشيف:"
-
-#: kgpgexternalactions.cpp:88
-msgid "Zip"
-msgstr "Zip"
-
-#: kgpgexternalactions.cpp:89
-msgid "Gzip"
-msgstr "Gzip"
-
-#: kgpgexternalactions.cpp:90
-msgid "Bzip2"
-msgstr "Bzip2"
-
-#: kgpgexternalactions.cpp:91
-msgid "Tar"
-msgstr "Tar"
-
-#: kgpgexternalactions.cpp:93
-msgid "Tar/XZ"
-msgstr "Tar/XZ"
-
-#: kgpgexternalactions.cpp:156 kgpgexternalactions.cpp:340 kgpglibrary.cpp:112
-#: editor/kgpgeditor.cpp:528
-msgid "File Already Exists"
-msgstr "الملف موجود مسبقا"
-
-#: kgpgexternalactions.cpp:169
-msgid "Processing folder compression and encryption"
-msgstr "يتم ضغط وتشفير المجلد"
-
-#: kgpgexternalactions.cpp:169 kgpglibrary.cpp:191
-msgid "Please wait..."
-msgstr "رجاءا انتظر..."
-
-#: kgpgexternalactions.cpp:197
-msgid "Unable to create temporary file"
-msgstr "تعذر إنشاء ملف مؤقت"
-
-#: kgpgexternalactions.cpp:370
-msgid "Decryption of this file failed:"
-msgid_plural "Decryption of these files failed:"
-msgstr[0] ""
-msgstr[1] ""
-
-#: kgpgexternalactions.cpp:372 editor/kgpgtextedit.cpp:302
-#: editor/kgpgtextedit.cpp:341
-msgid "Decryption failed."
-msgstr "فشلت عملية فك التَّشْفير."
-
-#: kgpgexternalactions.cpp:401
-msgid ""
-"<qt>You have not set a path to your GnuPG config file.<br />This may cause "
-"some surprising results in KGpg's execution.<br />Would you like to start "
-"KGpg's assistant to fix this problem?</qt>"
-msgstr ""
-
-#: kgpgexternalactions.cpp:402
-msgid "Start Assistant"
-msgstr "ابدأ المساعد"
-
-#: kgpgexternalactions.cpp:402
-msgid "Do Not Start"
-msgstr "لا تبدأ"
-
-#: kgpgfirstassistant.cpp:41
-msgid "KGpg Assistant"
-msgstr "مساعد KGpg"
-
-#: kgpgfirstassistant.cpp:66
-msgid ""
-"This assistant will first setup some basic configuration options required "
-"for KGpg to work properly. Next, it will allow you to create your own key "
-"pair, enabling you to encrypt your files and emails."
-msgstr ""
-
-#: kgpgfirstassistant.cpp:74
-msgid "Welcome to the KGpg Assistant"
-msgstr "أهلا وسهلا إلى مساعد KGpg"
-
-#: kgpgfirstassistant.cpp:86
-msgid "KGpg needs to know which GnuPG binary to use."
-msgstr ""
-
-#: kgpgfirstassistant.cpp:93 kgpgfirstassistant.cpp:126
-msgid ""
-"Unless you want to try some unusual settings, just click on the \"next\" "
-"button."
-msgstr ""
-"مالم تكن تريد تجربة بعض الإعدادات غير المعتادة، فقط انقر على زر \"التالي\"."
-
-#: kgpgfirstassistant.cpp:107
-msgctxt "search filter for gpg binary"
-msgid ""
-"gpg|GnuPG binary\n"
-"*|All files"
-msgstr ""
-
-#. i18n: file: conf_gpg.ui:107
-#. i18n: ectx: property (title), widget (QGroupBox, groupBox3)
-#: kgpgfirstassistant.cpp:115 rc.cpp:101
-msgid "GnuPG Binary"
-msgstr "ملف ثنائي GnuPG"
-
-#: kgpgfirstassistant.cpp:133
-msgid "KGpg needs to know where your GnuPG configuration file is stored."
-msgstr "يحتاج KGpg لمعرفة مكان تخزين ملف إعدادات GnuPG."
-
-#: kgpgfirstassistant.cpp:148
-msgid "Path to your GnuPG configuration file:"
-msgstr ""
-
-#: kgpgfirstassistant.cpp:162
-msgid "Configuration File"
-msgstr "ملف الضبط"
-
-#: kgpgfirstassistant.cpp:173
-msgid "Your default key:"
-msgstr "مفتاحك الافتراضي:"
-
-#: kgpgfirstassistant.cpp:192
-msgid "Default Key"
-msgstr "المفتاح الافتراضي"
-
-#: kgpgfirstassistant.cpp:214
-msgid "Generate new key"
-msgstr "ولد مفتاح جديد"
-
-#. i18n: file: kgpg.kcfg:126
-#. i18n: ectx: label, entry (AutoStart), group (User Interface)
-#: kgpgfirstassistant.cpp:224 rc.cpp:434
-msgid "Start KGpg automatically at KDE startup."
-msgstr "شغّل KGpg تلقائيا عند بدأ كدى."
-
-#: kgpgfirstassistant.cpp:228
-msgid "Done"
-msgstr "تم"
-
-#: kgpgfirstassistant.cpp:240
-msgid ""
-"<qt><b>The GnuPG configuration file was not found</b>. Should KGpg try to "
-"create a config file ?</qt>"
-msgstr ""
-"<qt><b> لم يتم العثور على ملف اعداد GnuPG</b>. هل تريد أن يحاول KGpg انشاء "
-"ملف اعداد ؟ </qt>"
-
-#: kgpgfirstassistant.cpp:240
-msgid "Create Config"
-msgstr "أنشئ ملف اعداد"
-
-#: kgpgfirstassistant.cpp:240
-msgid "Do Not Create"
-msgstr "لا تنشيء"
-
-#: kgpgfirstassistant.cpp:249
-msgid "<qt><b>The GnuPG configuration file was not found</b>.</qt>"
-msgstr "<qt><b>لم يعثر على ملف إعدادات  GnuPG </b>.</qt>"
-
-#: kgpgfirstassistant.cpp:293
-#, kde-format
-msgid "Your GnuPG binary is: %1"
-msgstr "ملف GnuPG التنفيذي الخاص بك: %1"
-
-#: kgpgfirstassistant.cpp:309 kgpgfirstassistant.cpp:365
-#, kde-format
-msgid "You have GnuPG version: %1"
-msgstr "لديك إصدار GnuPG  : %1"
-
-#: kgpgfirstassistant.cpp:312
-#, kde-format
-msgid "Your default key is: %1"
-msgstr "مفتاحك الافتراضي: %1"
-
-#: kgpgfirstassistant.cpp:365
-#, kde-format
-msgid ""
-"Your GnuPG version (%1) seems to be too old.<br />Compatibility with "
-"versions before 1.4.0 is no longer guaranteed."
-msgstr ""
-
-#: kgpginterface.cpp:607
-msgid "An error occurred while scanning your keyring"
-msgstr ""
-
-#: kgpgkeygenerate.cpp:41
-msgid "Key Generation"
-msgstr "توليد مفتاح"
-
-#: kgpgkeygenerate.cpp:44
-msgid "&Expert Mode"
-msgstr "&نمط المتقدم"
-
-#: kgpgkeygenerate.cpp:45
-msgid "Go to Expert Mode"
-msgstr ""
-
-#: kgpgkeygenerate.cpp:48
-msgid ""
-"If you go to expert mode, you will use the command line to create your key."
-msgstr ""
-
-#: kgpgkeygenerate.cpp:50
-msgid "Generate Key Pair"
-msgstr "توليد زوج مفاتيح"
-
-#: kgpgkeygenerate.cpp:52
-msgctxt "Name of key owner"
-msgid "&Name:"
-msgstr "&الإسم:"
-
-#: kgpgkeygenerate.cpp:58
-msgctxt "Email address of key owner"
-msgid "E&mail:"
-msgstr "ال&بريد الإلكتروني:"
-
-#: kgpgkeygenerate.cpp:62
-msgid "Commen&t (optional):"
-msgstr "ال&تعليق (خياري):"
-
-#: keyinfodialog.cpp:208 kgpgkeygenerate.cpp:66
-msgid "Expiration:"
-msgstr "تاريخ الانتهاء:"
-
-#: kgpgkeygenerate.cpp:79
-msgctxt "Key will not expire"
-msgid "Never"
-msgstr "لا ينتهي"
-
-#: kgpgkeygenerate.cpp:80
-msgid "Days"
-msgstr "أيام"
-
-#: kgpgkeygenerate.cpp:81
-msgid "Weeks"
-msgstr "أسابيع"
-
-#: kgpgkeygenerate.cpp:82
-msgid "Months"
-msgstr "أشهر"
-
-#: kgpgkeygenerate.cpp:83
-msgid "Years"
-msgstr "سنوات"
-
-#: kgpgkeygenerate.cpp:87
-msgid "&Key size:"
-msgstr "&حجم المفتاح:"
-
-#: kgpgkeygenerate.cpp:89
-msgid "768"
-msgstr "768"
-
-#: kgpgkeygenerate.cpp:90
-msgid "1024"
-msgstr "1024"
-
-#: kgpgkeygenerate.cpp:91
-msgid "2048"
-msgstr "2048"
-
-#: kgpgkeygenerate.cpp:92
-msgid "4096"
-msgstr "4096"
-
-#: kgpgkeygenerate.cpp:97
-msgid "&Algorithm:"
-msgstr "ال&خوارزمية:"
-
-#: kgpgkeygenerate.cpp:146
-msgid "You must give a name."
-msgstr "يجب أن تعطي اسم."
-
-#: kgpgkeygenerate.cpp:152
-msgid "The name must have at least 5 characters"
-msgstr "الاسم يجب أن يحوي خمسة رموز على الأقل"
-
-#: kgpgkeygenerate.cpp:158
-msgid "The name must not start with a digit"
-msgstr "الاسم يجب أن لا يبدأ برقم"
-
-#: kgpgkeygenerate.cpp:165
-msgid "You are about to create a key with no email address"
-msgstr "أنت  مقدم على إنشاء مفتاح بدون عنوان بريد إلكتروني"
-
-#: kgpgkeygenerate.cpp:172
-msgid "Email address not valid"
-msgstr "عنوان البريد الإلكتروني غير صالح"
-
-#: kgpglibrary.cpp:98
-msgid "You have not chosen an encryption key."
-msgstr "لم تختر مفتاح تشفير."
-
-#: kgpglibrary.cpp:124
-#, kde-format
-msgid "<p><b>Encrypting </b>%2</p>"
-msgid_plural "<p><b>%1 Files left.</b><br /><b>Encrypting </b>%2</p>"
-msgstr[0] ""
-msgstr[1] ""
-
-#: kgpglibrary.cpp:154
-msgid "<p><b>Process halted</b>.<br />Not all files were encrypted.</p>"
-msgstr "<p><b>أوقفت العملية</b>.<br />لم تشفر كل الملفات. </p>"
-
-#: kgpglibrary.cpp:188
-#, kde-format
-msgid "Decrypting %1"
-msgstr "جارى فك تشفير %1"
-
-#: kgpglibrary.cpp:191
-msgid "Processing decryption"
-msgstr "جاري عملية فك التشفير"
-
-#. i18n: file: conf_encryption.ui:14
-#. i18n: ectx: property (windowTitle), widget (QWidget, Encryption)
-#: kgpgoptions.cpp:86 rc.cpp:19
-msgid "Encryption"
-msgstr "تشفير"
-
-#: kgpgoptions.cpp:87
-msgid "Decryption"
-msgstr "فك التشفيرّ"
-
-#: kgpgoptions.cpp:88
-msgid "Appearance"
-msgstr "المظهر"
-
-#: kgpgoptions.cpp:89
-msgid "GnuPG Settings"
-msgstr "GPG إعدادات"
-
-#: kgpgoptions.cpp:90
-msgid "Key Servers"
-msgstr "خوادم المفاتيح"
-
-#: kgpgoptions.cpp:91
-msgid "Misc"
-msgstr "متفرقات"
-
-#: kgpgoptions.cpp:126
-msgid "New GnuPG Home Location"
-msgstr "موقع منزل GnuPG جديد"
-
-#: kgpgoptions.cpp:150
-msgid ""
-"No configuration file was found in the selected location.\n"
-"Do you want to create it now?\n"
-"\n"
-"Without a configuration file, neither KGpg nor GnuPG will work properly."
-msgstr ""
-
-#: kgpgoptions.cpp:140
-msgid "No Configuration File Found"
-msgstr "تعذر ايجاد ملف اعدادات"
-
-#: kgpgoptions.cpp:141
-msgid "Create"
-msgstr "أنشئ"
-
-#: kgpgoptions.cpp:142
-msgid "Ignore"
-msgstr "تجاهَل"
-
-#: kgpgoptions.cpp:156
-msgid ""
-"Cannot create configuration file. Please check if destination media is "
-"mounted and if you have write access."
-msgstr ""
-"تعذر انشاء ملف اعدادات. من فضلك افحص الوسط الهدف مضموم وأنك تملك صلاحية "
-"الكتابة"
-
-#: kgpgoptions.cpp:179
-msgid "Key server URLs may not contain whitespace."
-msgstr "عناوين خادم المفاتيح لا يمكن أن تحوي مسافة بيضاء."
-
-#: kgpgoptions.cpp:184
-msgid "Key server already in the list."
-msgstr ""
-
-#: kgpgoptions.cpp:193
-msgid "Add New Key Server"
-msgstr "أضف خادم مفاتيح جديد"
-
-#: kgpgoptions.cpp:193 kgpgoptions.cpp:248
-msgid "Server URL:"
-msgstr "عنوان الخادم:"
-
-#: kgpgoptions.cpp:248
-msgid "Edit Key Server"
-msgstr "حرر خادم المفاتيح"
-
-#: kgpgoptions.cpp:252 kgpgoptions.cpp:273 kgpgoptions.cpp:317
-#: kgpgoptions.cpp:334
-#, kde-format
-msgctxt "Mark default keyserver in GUI"
-msgid "%1 (Default)"
-msgstr "(الافتراضى) %1"
-
-#: kgpgoptions.cpp:269
-msgctxt "Mark default keyserver in GUI"
-msgid "(Default)"
-msgstr "(الافتراضى)"
-
-#: kgpgoptions.cpp:463 kgpgoptions.cpp:464
-msgctxt "no key available"
-msgid "none"
-msgstr "لا يوجد"
-
-#: kgpgoptions.cpp:498
-msgid "Decrypt File"
-msgstr "فكّ تشفير ملف"
-
-#: kgpgoptions.cpp:515
-msgid "Sign File"
-msgstr "توقيع الملف"
-
-#: kgpgoptions.cpp:562 kgpgoptions.cpp:601
-msgctxt "Remove default marker from GUI if it is there"
-msgid "(Default)"
-msgstr "(الافتراضى)"
-
-#: keysmanager.cpp:1405
-msgid "Create Revocation Certificate"
-msgstr "أنشئ شهادة إلغاء الترخيص"
-
-#: kgpgtextinterface.cpp:119
-msgid "Enter passphrase (symmetrical encryption)"
-msgstr "أدخل عبارة مرور (تشفير متماثل)"
-
-#: kgpgtextinterface.cpp:133 core/KGpgRefNode.cpp:126
-#: transactions/kgpgtransaction.cpp:260
-msgid "[No user id found]"
-msgstr "[لم يتم العثور على هوية مستخدم]"
-
-#: kgpginterface.cpp:415 kgpgtextinterface.cpp:135
-#: transactions/kgpgtransaction.cpp:184
-msgid " or "
-msgstr " أو "
-
-#: kgpgtextinterface.cpp:139
-msgid "<p><b>No user id found</b>. Trying all secret keys.</p>"
-msgstr ""
-"<p><b>لم يتم العثور على هوية مستخدم</b>.جارى محاولة كل المفاتيح السرية.</p>"
-
-#: kgpgtextinterface.cpp:141 transactions/kgpgtransaction.cpp:265
-#, kde-format
-msgid "<p><b>Bad passphrase</b>. You have 1 try left.</p>"
-msgid_plural "<p><b>Bad passphrase</b>. You have %1 tries left.</p>"
-msgstr[0] ""
-msgstr[1] ""
-
-#: kgpgtextinterface.cpp:144
-msgid "Enter passphrase"
-msgstr "أدخل عبارة السر"
-
-#: kgpgtextinterface.cpp:146 transactions/kgpgtransaction.cpp:267
-#, kde-format
-msgid "Enter passphrase for <b>%1</b>"
-msgstr "أدخل عبارة مرور لـ <b>%1</b>"
-
-#: kgpgtextinterface.cpp:443 kgpgtextinterface.cpp:637
-#: kgpgtextinterface.cpp:665
-msgid "No signature found."
-msgstr "لم يتم العثور على توقيع."
-
-#: kgpgtextinterface.cpp:640
-#, kde-format
-msgid "<qt>Good signature from:<br /><b>%1</b><br />Key ID: %2<br /></qt>"
-msgstr "<qt>توقيع جيد من:<br /><b>%1</b><br />هوية المفتاح: %2 <br /></qt>"
-
-#: kgpgtextinterface.cpp:645
-#, kde-format
-msgid ""
-"<qt><b>BAD signature</b> from:<br /> %1<br />Key id: %2<br /><br /><b>The "
-"file is corrupted</b><br /></qt>"
-msgstr ""
-"<qt><b>توقيع سيئ </b>من:<br /> %1<br />هويّة المفتاح : %2<br /><br "
-"/><b>الملف معطوب </b><br /></qt>"
-
-#: kgpgtextinterface.cpp:652
-msgid "<qt>The signature is valid, but the key is untrusted<br /></qt>"
-msgstr "<qt>التوقيع صحيح، لكن المفتاح غير موثوق<br /></qt>"
-
-#: kgpgtextinterface.cpp:654
-msgid ""
-"<qt>The signature is valid, and the key is ultimately trusted<br /></qt>"
-msgstr "<qt>التوقيع صحيح، والمفتاح موثوق تماماً<br /></qt>"
-
-#: kgpgtextinterface.cpp:549 editor/kgpgtextedit.cpp:296
-msgctxt "Caption of message box"
-msgid "Verification Finished"
-msgstr "الفحص انتهى"
-
-#: kgpgtextinterface.cpp:670 editor/kgpgtextedit.cpp:384
-#, kde-format
-msgid ""
-"<qt><b>Missing signature:</b><br />Key id: %1<br /><br />Do you want to "
-"import this key from a keyserver?</qt>"
-msgstr ""
-"<qt><b>توقيع مفقود:</b><br />رقم هوية المفتاح: %1<br /><br />هل تريد استيراد "
-"هذا المفتاح من ملقم المفاتيح?</qt>"
-
-#: main.cpp:28
-msgid ""
-"KGpg - simple gui for gpg\n"
-"\n"
-"KGpg was designed to make gpg very easy to use.\n"
-"I tried to make it as secure as possible.\n"
-"Hope you enjoy it."
-msgstr ""
-"Kgpg - gpg واجهة رسومية بسيطة لـ \n"
-"\n"
-"لقد صممت Kgpg لتجعل استخدام gpg سهلا جدا.\n"
-"لقد حاولت أن أجعلها مؤمنة قدر الإمكان.\n"
-"أتمنى أن تستمتع بها."
-
-#: main.cpp:34
-msgid "KGpg"
-msgstr "KGpg"
-
-#: main.cpp:34
-msgid "(C) 2003 Jean-Baptiste Mardelle"
-msgstr "حقوق المحفوظة(C) 2003 Jean-Baptiste Mardelle"
-
-#: main.cpp:35
-msgid "Jean-Baptiste Mardelle"
-msgstr "Jean-Baptiste Mardelle"
-
-#: main.cpp:35
-msgid "Author and former maintainer"
-msgstr "المؤلف و المشرف السابق"
-
-#: main.cpp:36
-msgid "Jimmy Gilles"
-msgstr "Jimmy Gilles"
-
-#: main.cpp:37
-msgid "Rolf Eike Beer"
-msgstr "Rolf Eike Beer"
-
-#: main.cpp:37
-msgid "Maintainer"
-msgstr "مشرف المشروع"
-
-#: main.cpp:42
-msgid "Encrypt file"
-msgstr "شفّر الملف"
-
-#: main.cpp:43
-msgid "Open key manager"
-msgstr "افتح مدير المفاتيح"
-
-#: main.cpp:44
-msgid "Open editor"
-msgstr "افت&ح المحرر"
-
-#: main.cpp:45
-msgid "Show encrypted file"
-msgstr "اعرض الملف المشفر"
-
-#: main.cpp:47
-msgid "Verify signature"
-msgstr "تحقق من التوقيع"
-
-#: main.cpp:48
-msgid "File to open"
-msgstr "الملف المراد فتحه"
-
-#: rc.cpp:589
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr ""
-"عبدالرحمن عبدالخالق غريب,أحمد محمد زواوي, خالد صديق,خالد حسنى , فهد "
-"السعيدي,زايد السعيدي, ,Launchpad Contributions:,Khaled Hosny,Khalid "
-"Siddig,Youssef Chahibi"
-
-#: rc.cpp:590
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr ""
-"king_abdo@yahoo.com,azawawi@emirates.net.ae, "
-"khall92@yahoo.com,khaledhosny@eglug.org, Fahad.Al-"
-"Saidi@gmail.com,zayed.alsaidi@gmail.com,,,khaledhosny@eglug.org,,"
-
-#. i18n: file: newkey.ui:19
-#. i18n: ectx: property (title), widget (QGroupBox, groupBox2)
-#: rc.cpp:530
-msgid "New Key Created"
-msgstr "مفتاح جديد أنشئ"
-
-#. i18n: file: newkey.ui:25
-#. i18n: ectx: property (text), widget (QLabel, textLabel2)
-#: rc.cpp:533
-msgid "You have successfully created the following key:"
-msgstr "لقد أنشأت المفتاح التالي بنجاح:"
-
-#. i18n: file: newkey.ui:37
-#. i18n: ectx: property (text), widget (QLabel, textLabel3)
-#: rc.cpp:536
-msgid "Name:"
-msgstr "الاسم:"
-
-#. i18n: file: adduid.ui:29
-#. i18n: ectx: property (text), widget (QLabel, textLabel2)
-#. i18n: file: newkey.ui:67
-#. i18n: ectx: property (text), widget (QLabel, textLabel4)
-#: rc.cpp:6 rc.cpp:540
-msgid "Email:"
-msgstr "البريد الإلكتروني:"
-
-#. i18n: file: newkey.ui:91
-#. i18n: ectx: property (text), widget (QLabel, textLabel5)
-#: keyinfodialog.cpp:205 rc.cpp:544
-msgid "Key ID:"
-msgstr "هوية المفتاح :"
-
-#. i18n: file: newkey.ui:115
-#. i18n: ectx: property (text), widget (QLabel, textLabel6)
-#: rc.cpp:548
-msgid "Fingerprint:"
-msgstr "بصمة الإصبع:"
-
-#. i18n: file: newkey.ui:136
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, CBdefault)
-#: rc.cpp:551
-msgid ""
-"<qt><b>Set as your default key:</b><br />\n"
-"<p>Checking this option sets the newly created key pair as the default key "
-"pair.</p></qt>"
-msgstr ""
-
-#. i18n: file: newkey.ui:139
-#. i18n: ectx: property (text), widget (QCheckBox, CBdefault)
-#: rc.cpp:555
-msgid "Set as your default key"
-msgstr "التعين كمفتاح الافتراضي لك"
-
-#. i18n: file: newkey.ui:151
-#. i18n: ectx: property (title), widget (QGroupBox, groupBox1)
-#: rc.cpp:558
-msgid "Revocation Certificate"
-msgstr "شهادة سحب الترخيص"
-
-#. i18n: file: newkey.ui:157
-#. i18n: ectx: property (text), widget (QLabel, textLabel1)
-#: rc.cpp:561
-msgid ""
-"It is recommended to save or print a revocation certificate in case your key "
-"is compromised."
-msgstr ""
-"هذه مطلوبة لحفظ أو طباعة شهادة سحب الترخيص في الحالة التي يكون فيها مفتاحك "
-"معرضا للخطر."
-
-#. i18n: file: newkey.ui:169
-#. i18n: ectx: property (text), widget (QCheckBox, CBsave)
-#: rc.cpp:564
-msgid "Save as:"
-msgstr "احفظ باسم:"
-
-#. i18n: file: newkey.ui:185
-#. i18n: ectx: property (text), widget (QCheckBox, CBprint)
-#: rc.cpp:567
-msgid "Print"
-msgstr "اطبع"
-
-#. i18n: file: kgpg.kcfg:12
-#. i18n: ectx: label, entry (CustomDecrypt), group (Decryption)
-#: rc.cpp:365
-msgid "Custom decryption command."
-msgstr "أمر فك تشفير مخصص."
-
-#. i18n: file: kgpg.kcfg:18
-#. i18n: ectx: label, entry (CustomEncryptionOptions), group (Encryption)
-#: rc.cpp:368
-msgid "Custom encryption options"
-msgstr "خيارات تشفير مخصصة"
-
-#. i18n: file: kgpg.kcfg:21
-#. i18n: ectx: label, entry (AllowCustomEncryptionOptions), group (Encryption)
-#: rc.cpp:371
-msgid "Allow custom encryption options"
-msgstr "السماح بخيارات تشفير مخصصة"
-
-#. i18n: file: kgpg.kcfg:25
-#. i18n: ectx: label, entry (FileEncryptionKey), group (Encryption)
-#: rc.cpp:374
-msgid "File encryption key."
-msgstr "مفتاح تشفير ملف."
-
-#. i18n: file: kgpg.kcfg:28
-#. i18n: ectx: label, entry (EncryptFilesTo), group (Encryption)
-#: rc.cpp:377
-msgid "Encrypt files"
-msgstr "شفّر الملف"
-
-#. i18n: file: kgpg.kcfg:32
-#. i18n: ectx: label, entry (AsciiArmor), group (Encryption)
-#: rc.cpp:380
-msgid "Use ASCII armored encryption."
-msgstr "استخدم تشفير ASCII المحصّن"
-
-#. i18n: file: kgpg.kcfg:36
-#. i18n: ectx: label, entry (AllowUntrustedKeys), group (Encryption)
-#: rc.cpp:383
-msgid "Allow encryption with untrusted keys."
-msgstr "اسمح بالشفير بواسطة المفاتيح غير الموثوقة."
-
-#. i18n: file: kgpg.kcfg:41
-#. i18n: ectx: label, entry (AllowUntrustedGroupMembers), group (Encryption)
-#: rc.cpp:419 rc.cpp:696
-msgid "Allow untrusted keys to become members of key groups."
-msgstr ""
-
-#. i18n: file: kgpg.kcfg:40
-#. i18n: ectx: label, entry (HideUserID), group (Encryption)
-#: rc.cpp:386
-msgid "Hide the user ID."
-msgstr "أخفي هوية المستخدم."
-
-#. i18n: file: kgpg.kcfg:44
-#. i18n: ectx: label, entry (PgpCompatibility), group (Encryption)
-#: rc.cpp:389
-msgid "Enable PGP 6 compatibility."
-msgstr "مكّن التوافقية مع PGP 6."
-
-#. i18n: file: kgpg.kcfg:48
-#. i18n: ectx: label, entry (PgpExtension), group (Encryption)
-#: rc.cpp:392
-msgid "Use *.pgp extension for encrypted files."
-msgstr "استخدم إمتداد *.pgp للملفات المشفرة."
-
-#. i18n: file: kgpg.kcfg:55
-#. i18n: ectx: label, entry (GpgConfigPath), group (GPG Settings)
-#: rc.cpp:395
-msgid "The path of the gpg configuration file."
-msgstr "المسار لملف إعدادات gpg."
-
-#. i18n: file: kgpg.kcfg:58
-#. i18n: ectx: label, entry (GpgBinaryPath), group (GPG Settings)
-#: rc.cpp:398
-msgid "The path of the gpg binary used by KGpg."
-msgstr "المسار لملف الثنائي gpg المستخدم بواسطة KGpg."
-
-#. i18n: file: kgpg.kcfg:62
-#. i18n: ectx: label, entry (Groups), group (GPG Settings)
-#: rc.cpp:401
-msgid "GPG groups"
-msgstr "مجموعات GPG"
-
-#. i18n: file: kgpg.kcfg:77
-#. i18n: ectx: label, entry (FirstRun), group (General Options)
-#: rc.cpp:404
-msgid "Is the first time the application runs."
-msgstr "هذه هي المرة الأولى التي يتم فيها تشغيل التطبيق."
-
-#. i18n: file: kgpg.kcfg:81
-#. i18n: ectx: label, entry (EditorGeometry), group (General Options)
-#: rc.cpp:407
-msgid "The size of the editor window."
-msgstr "حجم نافذة المحرر."
-
-#. i18n: file: kgpg.kcfg:84
-#. i18n: ectx: label, entry (ShowTrust), group (General Options)
-#: rc.cpp:410
-msgid "Show the trust value in key manager."
-msgstr "إظهار قيمة الثقة في  مدير مفتايح."
-
-#. i18n: file: kgpg.kcfg:88
-#. i18n: ectx: label, entry (ShowExpi), group (General Options)
-#: rc.cpp:413
-msgid "Show the expiration value in key manager."
-msgstr "أظهر قيمة تاريخ الانتهاء في مدير المفاتيح"
-
-#. i18n: file: kgpg.kcfg:92
-#. i18n: ectx: label, entry (ShowSize), group (General Options)
-#: rc.cpp:416
-msgid "Show the size value in key manager."
-msgstr "أظهر قيمة الحجم في مدير المفاتيح."
-
-#. i18n: file: kgpg.kcfg:96
-#. i18n: ectx: label, entry (ShowCreat), group (General Options)
-#: rc.cpp:419
-msgid "Show the creation value in key manager."
-msgstr "أظهر قيمة تاريخ الإنشاء في مدير المفاتيح."
-
-#. i18n: file: kgpg.kcfg:100
-#. i18n: ectx: label, entry (ShowSecret), group (General Options)
-#: rc.cpp:422
-msgid "Show only secret keys in key manager."
-msgstr "أظهرمفاتيح الامان في مدير المفاتيح."
-
-#. i18n: file: kgpg.kcfg:104
-#. i18n: ectx: label, entry (ShowLongKeyId), group (General Options)
-#: rc.cpp:425
-msgid "Show long key id in key manager."
-msgstr ""
-
-#. i18n: file: kgpg.kcfg:108
-#. i18n: ectx: label, entry (TrustLevel), group (General Options)
-#: rc.cpp:428
-msgid "Show only keys with at least that trust level in key manager."
-msgstr "أظهر المفاتيح ذات أقل مستوى في الثقة في مدير المفاتيح فقط"
-
-#. i18n: file: kgpg.kcfg:122
-#. i18n: ectx: label, entry (UseMouseSelection), group (User Interface)
-#: rc.cpp:431
-msgid "Use the mouse selection instead of the clipboard."
-msgstr "استخدم تحديد الفأرة بدلا من الحافظة."
-
-#. i18n: file: kgpg.kcfg:130
-#. i18n: ectx: label, entry (RemoteFileWarn), group (User Interface)
-#: rc.cpp:437
-msgid ""
-"Display a warning before creating temporary files during remote file "
-"operations."
-msgstr "اعرض تحذير قبل إنشاء ملفات مؤقتة أثناء عمليات الملفات البعيدة."
-
-#. i18n: file: kgpg.kcfg:134
-#. i18n: ectx: label, entry (LeftClick), group (User Interface)
-#: rc.cpp:440
-msgid "Choose default left-click behavior"
-msgstr "اختر السلوك الإفتراضى للنقر الأيسر"
-
-#. i18n: file: kgpg.kcfg:141
-#. i18n: ectx: label, entry (EncryptedDropEvent), group (User Interface)
-#: rc.cpp:443
-msgid "Handle encrypted drops"
-msgstr "تعامل مع الإلقاءات المشفرة"
-
-#. i18n: file: kgpg.kcfg:149
-#. i18n: ectx: label, entry (UnencryptedDropEvent), group (User Interface)
-#: rc.cpp:446
-msgid "Handle unencrypted drops"
-msgstr "تعامل مع الإلقاءات غير المشفرة"
-
-#. i18n: file: kgpg.kcfg:157
-#. i18n: ectx: label, entry (SignMenu), group (User Interface)
-#: rc.cpp:449
-msgid "Show the \"sign file\" service menu."
-msgstr "أظهر قائمة الخدمة \"توقيع ملف\"."
-
-#. i18n: file: kgpg.kcfg:165
-#. i18n: ectx: label, entry (DecryptMenu), group (User Interface)
-#: rc.cpp:452
-msgid "Show the \"decrypt file\" service menu."
-msgstr "أظهر قائمة الخدمة \"فك تشفير ملف\"."
-
-#. i18n: file: kgpg.kcfg:174
-#. i18n: ectx: label, entry (ShowSystray), group (User Interface)
-#: rc.cpp:455
-msgid "Show the systray icon"
-msgstr "أظهر أيقونة صينية النظام"
-
-#. i18n: file: kgpg.kcfg:178
-#. i18n: ectx: label, entry (RecentFiles), group (User Interface)
-#: rc.cpp:458
-msgid "The number of recently opened files shown in the editor menu."
-msgstr ""
-
-#. i18n: file: kgpg.kcfg:185
-#. i18n: ectx: label, entry (ShowTipOfDay), group (TipOfDay)
-#: rc.cpp:461
-msgid "Show tip of the day."
-msgstr "اعرض تلميحة اليوم."
-
-#. i18n: file: kgpg.kcfg:192
-#. i18n: ectx: label, entry (ColorGood), group (Key Colors)
-#: rc.cpp:464
-msgid "Color used for trusted keys."
-msgstr "اللون المستخدم للمفاتيح الموثوقة."
-
-#. i18n: file: kgpg.kcfg:196
-#. i18n: ectx: label, entry (ColorRev), group (Key Colors)
-#: rc.cpp:467
-msgid "Color used for revoked keys."
-msgstr "اللون المستخدم للمفاتيح المرفوضة."
-
-#. i18n: file: kgpg.kcfg:200
-#. i18n: ectx: label, entry (ColorUnknown), group (Key Colors)
-#: rc.cpp:470
-msgid "Color used for unknown keys."
-msgstr "اللون المستخدم للمفاتيح المجهولة."
-
-#. i18n: file: kgpg.kcfg:204
-#. i18n: ectx: label, entry (ColorBad), group (Key Colors)
-#: rc.cpp:473
-msgid "Color used for untrusted keys."
-msgstr "اللون المستخدم للمفاتيح غير الموثوقة."
-
-#. i18n: file: kgpg.kcfg:208
-#. i18n: ectx: label, entry (ColorUltimate), group (Key Colors)
-#: rc.cpp:476
-msgid "Color used for ultimately trusted keys."
-msgstr ""
-
-#. i18n: file: kgpg.kcfg:212
-#. i18n: ectx: label, entry (ColorMarginal), group (Key Colors)
-#: rc.cpp:479
-msgid "Color used for marginally trusted keys."
-msgstr "اللون المستخدم للمفاتيح الموثوقة بشكل هامشي."
-
-#. i18n: file: kgpg.kcfg:216
-#. i18n: ectx: label, entry (ColorExpired), group (Key Colors)
-#: rc.cpp:482
-msgid "Color used for expired keys."
-msgstr "اللون المستخدم للمفاتيح المنتهية."
-
-#. i18n: file: kgpg.kcfg:223
-#. i18n: ectx: label, entry (Font), group (Text Font)
-#: rc.cpp:485
-msgid "Font"
-msgstr "الخط"
-
-#. i18n: file: kgpg.kcfg:234
-#. i18n: ectx: label, entry (KeyServers), group (Servers)
-#: rc.cpp:488
-msgid ""
-"Key servers used by KGpg. The first server in the list is the default server."
-msgstr ""
-
-#. i18n: file: kgpg.kcfg:241
-#. i18n: ectx: label, entry (UseProxy), group (Key Servers)
-#: rc.cpp:491
-msgid "Use HTTP proxy when available."
-msgstr "استخدم بروكسى HTTP اذا كان متوفرا."
-
-#. i18n: file: kgpg.kcfg:253
-#. i18n: ectx: label, entry (EmailTemplate), group (Key Signing)
-#: rc.cpp:530 rc.cpp:807
-msgid ""
-"This is the text of the email sent by the \"Sign and Mail User ID\" action."
-msgstr ""
-
-#. i18n: file: keysmanager.rc:23
-#. i18n: ectx: Menu (view)
-#. i18n: file: editor/kgpgeditor.rc:13
-#. i18n: ectx: Menu (view)
-#. i18n: file: keysmanager.rc:23
-#. i18n: ectx: Menu (view)
-#: rc.cpp:356 rc.cpp:593 rc.cpp:605
-msgid "&View"
-msgstr "&اعرض"
-
-#. i18n: file: editor/kgpgeditor.rc:18
-#. i18n: ectx: Menu (signature)
-#: rc.cpp:596
-msgid "Si&gnature"
-msgstr "ا&لتوقيع"
-
-#. i18n: file: keyserver.ui:38
-#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel1)
-#: rc.cpp:301
-msgid ""
-"<qt><b>Key Server:</b><br /> <p>A Key Server is a centralized repository of "
-"PGP/GnuPG keys connected to the Internet which can be conveniently accessed "
-"in order to obtain or deposit keys. Select from the drop down list to "
-"specify which key server should be used.</p> <p>Often these keys are held by "
-"people whom the user has never met and as such the authenticity is dubious "
-"at best. Refer to the GnuPG manual covering \"Web-of-Trust\" relationships "
-"to find out how GnuPG works around the problem of verifying "
-"authenticity.</p> </qt>"
-msgstr ""
-"<qt><b>خادم المفاتيح:</b><br /> <p>خادم المفاتيح هو مستودع مركزى لمفاتيح "
-"PGP/GnuPG ومتصل بالإنترنت مما يسهل الوصول اليه للحصول على أو ارسال المفاتيح "
-"اليه. اختر من القائمة المنسدلة ملقم المفاتيح الواجب استخدامه.</p> <p>كثير من "
-"هذه المفاتيخ تخص أناساً لم يلتق المستخدم  بهم قط ولذا فإن التوثيق يكون "
-"مشكوكاً فيه على الأفضل. ارجع لدليل GnuPG حيث يغطى علاقات \"شبكة الثقة\" "
-"لتعرف كيف يتعامل GnuPG مع مشكلة التحقق من الموثوقية.</p> </qt>"
-
-#. i18n: file: keyexport.ui:51
-#. i18n: ectx: property (text), widget (QRadioButton, checkServer)
-#. i18n: file: keyserver.ui:41
-#. i18n: ectx: property (text), widget (QLabel, textLabel1)
-#. i18n: file: keyserver.ui:176
-#. i18n: ectx: property (text), widget (QLabel, textLabel3)
-#: rc.cpp:280 rc.cpp:304 rc.cpp:330
-msgid "Key server:"
-msgstr "خادم المفاتيح:"
-
-#. i18n: file: keyserver.ui:52
-#. i18n: ectx: property (whatsThis), widget (KComboBox, kCBimportks)
-#: rc.cpp:307
-msgid ""
-"<b>Key Server Drop Down Dialog:</b>\n"
-"Allows the user to select the Key Server which will be used to import "
-"PGP/GnuPG keys into the local keyring."
-msgstr ""
-"<b>مربع حوار خادم المفاتيح:</b>\n"
-"يسمح للمستخدم باختيار ملقم المفاتيح الذى سيستخدم لاستيراد مفاتيح PGP/GnuPG "
-"الى حلقة المفاتيح المحلية."
-
-#. i18n: file: keyserver.ui:60
-#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel2)
-#: rc.cpp:311
-msgid ""
-"<qt><b>Text to search or ID of the key to import:</b><br />\n"
-"<p>There are multiple ways to search for a key, you can use a text or "
-"partial text search (example: entering Phil or Zimmerman will bring up all "
-"keys in which Phil or Zimmerman shows up) or you can search by the ID's of "
-"the key. Key ID's are strings of letters and numbers that uniquely identify "
-"a key (example: searching for 0xED7585F4 would bring up the key associated "
-"with that ID).</p></qt>"
-msgstr ""
-
-#. i18n: file: keyserver.ui:69
-#. i18n: ectx: property (text), widget (QLabel, textLabel2)
-#: rc.cpp:315
-msgid "Text to search or ID of the key to import:"
-msgstr "النص المراد بحثه أو هوية المفتاح المراد استيراده:"
-
-#. i18n: file: keyserver.ui:91
-#. i18n: ectx: property (text), widget (QCheckBox, cBproxyI)
-#. i18n: file: keyserver.ui:221
-#. i18n: ectx: property (text), widget (QCheckBox, cBproxyE)
-#: rc.cpp:318 rc.cpp:343
-msgid "Honor HTTP proxy:"
-msgstr "استخدم بروكسى HTTP"
-
-#. i18n: file: keyserver.ui:134
-#. i18n: ectx: property (text), widget (QPushButton, Buttonsearch)
-#: rc.cpp:321
-msgid "&Search"
-msgstr "ا&بحث"
-
-#. i18n: file: keyserver.ui:170
-#. i18n: ectx: attribute (title), widget (QWidget, tab)
-#: rc.cpp:327
-msgid "Export"
-msgstr "صدّر"
-
-#. i18n: file: keyserver.ui:190
-#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel4)
-#: rc.cpp:333
-msgid ""
-"<qt><b>Key to be exported:</b><br />\n"
-"<p>This allows the user to specify the key from the drop down list that will "
-"be exported to the key server selected.</p></qt>"
-msgstr ""
-
-#. i18n: file: keyserver.ui:193
-#. i18n: ectx: property (text), widget (QLabel, textLabel4)
-#: rc.cpp:337
-msgid "Key to be exported:"
-msgstr "المفتاح المراد تصديره:"
-
-#. i18n: file: keyserver.ui:206
-#. i18n: ectx: property (text), widget (QCheckBox, exportAttributes)
-#: rc.cpp:340
-msgid "Export attributes (photo id)"
-msgstr "تصدير الصّفات (صورة الهوية)"
-
-#. i18n: file: keyserver.ui:265
-#. i18n: ectx: property (whatsThis), widget (QPushButton, Buttonexport)
-#: rc.cpp:346
-msgid ""
-"<qt><b>Export:</b><br />\n"
-"<p>Pushing this button will export the specified key to the specified "
-"server.</p></qt>"
-msgstr ""
-
-#. i18n: file: keyserver.ui:268
-#. i18n: ectx: property (text), widget (QPushButton, Buttonexport)
-#: rc.cpp:350
-msgid "&Export"
-msgstr "&صدّر"
-
-#. i18n: file: kgpgKeyInfo.ui:14
-#. i18n: ectx: property (windowTitle), widget (KDialog, kgpgKeyInfo)
-#: rc.cpp:244
-msgid "Kgpg"
-msgstr ""
-
-#: keyinfodialog.cpp:206
-msgid "Comment:"
-msgstr "التعليق:"
-
-#: keyinfodialog.cpp:207
-msgid "Creation:"
-msgstr "الانشاء:"
-
-#: keyinfodialog.cpp:209
-msgid "Trust:"
-msgstr "ثقة:"
-
-#: keyinfodialog.cpp:210
-msgid "Owner trust:"
-msgstr "الثقة فى المالك:"
-
-#: keyinfodialog.cpp:223
-msgid "I do not know"
-msgstr "لا أعرف"
-
-#: keyinfodialog.cpp:224
-msgid "I do NOT trust"
-msgstr "لا تثق"
-
-#: keyinfodialog.cpp:225 core/convert.cpp:51
-msgid "Marginally"
-msgstr "بشكل هامشي"
-
-#: keyinfodialog.cpp:226 core/convert.cpp:52
-msgid "Fully"
-msgstr "كامل"
-
-#: keyinfodialog.cpp:227 core/convert.cpp:53
-msgid "Ultimately"
-msgstr "لا نهائى"
-
-#: keyinfodialog.cpp:211
-msgid "Algorithm:"
-msgstr "الخوارزمية:"
-
-#: keyinfodialog.cpp:212
-msgid "Length:"
-msgstr "الطول:"
-
-#: keyinfodialog.cpp:274
-msgid "Photo"
-msgstr "الصورة"
-
-#: keyinfodialog.cpp:283
-msgid ""
-"<qt><b>Photo:</b><p>A photo can be included with a public key for extra "
-"security. The photo can be used as an additional method of authenticating "
-"the key. However, it should not be relied upon as the only form of "
-"authentication.</p></qt>"
-msgstr ""
-
-#: keyinfodialog.cpp:275
-msgid "No Photo"
-msgstr "بدون صورة"
-
-#: keyinfodialog.cpp:298
-msgid "Disable key"
-msgstr "تعطيل المفتاح"
-
-#. i18n: file: kgpgKeyInfo.ui:350
-#. i18n: ectx: property (text), widget (KPushButton, m_expirationbtn)
-#: rc.cpp:301
-msgid "Change Expiration"
-msgstr ""
-
-#. i18n: file: kgpgKeyInfo.ui:357
-#. i18n: ectx: property (text), widget (KPushButton, m_password)
-#: rc.cpp:304
-msgid "Change Passphrase"
-msgstr ""
-
-#: keyinfodialog.cpp:332
-msgid "Fingerprint"
-msgstr "بصمة الإصبع"
-
-#. i18n: file: keysmanager.rc:6
-#. i18n: ectx: Menu (managekeys)
-#: rc.cpp:353 rc.cpp:602
-msgid "&Keys"
-msgstr "ال&مفاتيح"
-
-#. i18n: file: keysmanager.rc:28
-#. i18n: ectx: Menu (show_details)
-#: rc.cpp:359 rc.cpp:608
-msgid "&Show Details"
-msgstr "أ&ظهر التفاصيل"
-
-#. i18n: file: keysmanager.rc:40
-#. i18n: ectx: Menu (groups)
-#: rc.cpp:362 rc.cpp:611
-msgid "&Groups"
-msgstr "الم&جموعات"
-
-#. i18n: file: conf_decryption.ui:52
-#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel1_4_2)
-#: rc.cpp:12
-msgid ""
-"<qt><b>Custom Decryption Command:</b><br />\n"
-"<p>This option allows the user to specify a custom command to be executed by "
-"GPG when decryption occurs. (This is recommended for advanced users "
-"only).</p></qt>"
-msgstr ""
-
-#. i18n: file: conf_decryption.ui:55
-#. i18n: ectx: property (text), widget (QLabel, textLabel1_4_2)
-#: rc.cpp:16
-msgid "Custom decryption command:"
-msgstr "أمر فك تشفير مخصص:"
-
-#. i18n: file: keyexport.ui:41
-#. i18n: ectx: property (text), widget (QRadioButton, checkClipboard)
-#. i18n: file: sourceselect.ui:34
-#. i18n: ectx: property (text), widget (QRadioButton, checkClipboard)
-#: rc.cpp:277 rc.cpp:579
-msgid "Clipboard"
-msgstr "حافظة"
-
-#. i18n: file: keyexport.ui:65
-#. i18n: ectx: property (text), widget (QRadioButton, checkFile)
-#. i18n: file: sourceselect.ui:43
-#. i18n: ectx: property (text), widget (QRadioButton, checkFile)
-#: rc.cpp:283 rc.cpp:582
-msgid "File:"
-msgstr "ملف:"
-
-#. i18n: file: sourceselect.ui:67
-#. i18n: ectx: property (text), widget (QRadioButton, checkServer)
-#: rc.cpp:585
-msgid "Keyserver:"
-msgstr "خادم المفاتيح:"
-
-#. i18n: file: sourceselect.ui:80
-#. i18n: ectx: property (toolTip), widget (KLineEdit, keyIds)
-#: rc.cpp:588
-msgid ""
-"Enter the ids or fingerprints of the keys to import as space separated list."
-msgstr ""
-
-#. i18n: file: adduid.ui:16
-#. i18n: ectx: property (text), widget (QLabel, textLabel1)
-#: rc.cpp:3
-msgid "Name (minimum 5 characters):"
-msgstr "الاسم (الحد الأدنى لعدد الرموز 5):"
-
-#. i18n: file: adduid.ui:42
-#. i18n: ectx: property (text), widget (QLabel, textLabel3)
-#: rc.cpp:9
-msgid "Comment (optional):"
-msgstr "التعليق (خياري):"
-
-#. i18n: file: conf_gpg.ui:15
-#. i18n: ectx: property (whatsThis), widget (QWidget, GPGConf)
-#: rc.cpp:78
-msgid ""
-"<qt><b>Global Settings:</b><br />\n"
-"<p></p>\n"
-"</qt>"
-msgstr ""
-
-#. i18n: file: conf_gpg.ui:21
-#. i18n: ectx: property (title), widget (QGroupBox, groupBox2)
-#: rc.cpp:83
-msgid "GnuPG Home"
-msgstr "منزل GnuPG"
-
-#. i18n: file: conf_gpg.ui:35
-#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel1_5_2)
-#: rc.cpp:89
-msgid ""
-"<b>Home Location</b><p>This is the directory where GnuPG stores its "
-"configuration and the keyrings. If you have not changed it this is usually "
-"<em>~/.gnupg/</em></p>"
-msgstr ""
-
-#. i18n: file: conf_gpg.ui:29
-#. i18n: ectx: property (text), widget (QLabel, textLabel1_5_2)
-#: rc.cpp:86
-msgid "Home location:"
-msgstr "موقع المنزل:"
-
-#. i18n: file: conf_gpg.ui:48
-#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel1_5_2_2)
-#: rc.cpp:95
-msgid ""
-"<b>Configuration File</b><p>This is the name of the configuration file in "
-"the directory specified above. The default is <em>gnupg.conf</em> while "
-"older versions of GnuPG used <em>options</em>.</p>"
-msgstr ""
-
-#. i18n: file: conf_gpg.ui:42
-#. i18n: ectx: property (text), widget (QLabel, textLabel1_5_2_2)
-#: rc.cpp:92
-msgid "Configuration file:"
-msgstr "ملف الإعدادات:"
-
-#. i18n: file: conf_gpg.ui:95
-#. i18n: ectx: property (text), widget (QPushButton, changeHome)
-#: rc.cpp:98
-msgid "Change..."
-msgstr "تغيير..."
-
-#. i18n: file: conf_gpg.ui:119
-#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel1_6_2)
-#: rc.cpp:107
-msgid ""
-"<b>Program path</b><p>This is the program that will be called for all GnuPG "
-"operations. The default of <em>gpg</em> will work on most systems.</p>"
-msgstr ""
-
-#. i18n: file: conf_gpg.ui:113
-#. i18n: ectx: property (text), widget (QLabel, textLabel1_6_2)
-#: rc.cpp:104
-msgid "Program path:"
-msgstr "مسار البرنامج:"
-
-#. i18n: file: conf_gpg.ui:159
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, use_agent)
-#: rc.cpp:113
-msgid ""
-"<b>Use GnuPG agent</b><p>The GnuPG agent stores the passwords for your "
-"secret keys in memory for a limited amount of time. If you use your secret "
-"key again while it is cached you do not have to enter it again. This is less "
-"secure than typing it every time.</p>"
-msgstr ""
-
-#. i18n: file: conf_gpg.ui:156
-#. i18n: ectx: property (text), widget (QCheckBox, use_agent)
-#: rc.cpp:110
-msgid "Use GnuPG agent"
-msgstr "ا&ستعمل عميل GnuPG"
-
-#. i18n: file: groupedit.ui:51
-#. i18n: ectx: property (text), widget (QTableView, availableKeys)
-#. i18n: file: groupedit.ui:135
-#. i18n: ectx: property (text), widget (QTableView, groupKeys)
-#: rc.cpp:253 rc.cpp:265 model/kgpgitemmodel.cpp:283
-#: model/kgpgsearchresultmodel.cpp:323
-msgid "Name"
-msgstr "الاسم"
-
-#. i18n: file: groupedit.ui:56
-#. i18n: ectx: property (text), widget (QTableView, availableKeys)
-#. i18n: file: groupedit.ui:140
-#. i18n: ectx: property (text), widget (QTableView, groupKeys)
-#: rc.cpp:256 rc.cpp:268 model/kgpgitemmodel.cpp:284
-#: model/kgpgsearchresultmodel.cpp:325
-msgctxt "@title:column Title of a column of emails"
-msgid "Email"
-msgstr "البريد الإلكترونيّ"
-
-#. i18n: file: groupedit.ui:61
-#. i18n: ectx: property (text), widget (QTableView, availableKeys)
-#. i18n: file: groupedit.ui:145
-#. i18n: ectx: property (text), widget (QTableView, groupKeys)
-#: rc.cpp:259 rc.cpp:271
-msgid "Id"
-msgstr "الهوية"
-
-#. i18n: file: groupedit.ui:77
-#. i18n: ectx: property (text), widget (QLabel, kActiveLabel1)
-#: rc.cpp:262
-msgid "Keys in the Group"
-msgstr "المفاتيح في المجموعة"
-
-#. i18n: file: conf_encryption.ui:44
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, kcfg_AsciiArmor)
-#: rc.cpp:32
-msgid ""
-"<qt><b>ASCII armored encryption:</b> <br /> \n"
-"<p>Checking this option outputs all encrypted files in a format that can be "
-"opened by a text editor and as such the output is suitable for placing in "
-"the body of an e-mail message.</p></qt>"
-msgstr ""
-
-#. i18n: file: conf_encryption.ui:40
-#. i18n: ectx: property (text), widget (QCheckBox, kcfg_AsciiArmor)
-#: rc.cpp:29 selectpublickeydialog.cpp:96
-msgid "ASCII armored encryption"
-msgstr "تشفير ASCII المحصّن"
-
-#. i18n: file: conf_encryption.ui:55
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, kcfg_PgpExtension)
-#: rc.cpp:39
-msgid ""
-"<qt><b>Use *.pgp extension for encrypted files:</b><br />\n"
-"<p>Checking this option will append a .pgp extension to all encrypted files "
-"instead of a .gpg extension. This option will maintain compatibility with "
-"users of PGP (Pretty Good Privacy) software.</p></qt>"
-msgstr ""
-
-#. i18n: file: conf_encryption.ui:51
-#. i18n: ectx: property (text), widget (QCheckBox, kcfg_PgpExtension)
-#: rc.cpp:36
-msgid "Use *.pgp extension for encrypted files"
-msgstr "استخدم الإمتداد *.pgp للملفات المشفرة"
-
-#. i18n: file: conf_encryption.ui:93
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, kcfg_AllowCustomEncryptionOptions)
-#: rc.cpp:53
-msgid ""
-"<qt><b>Custom encryption command:</b><br />\n"
-"<p>When activated, an entry field will be shown in the key selection dialog, "
-"enabling you to enter a custom command for encryption. This option is "
-"recommended for experienced users only.</p></qt>"
-msgstr ""
-
-#. i18n: file: conf_encryption.ui:89
-#. i18n: ectx: property (text), widget (QCheckBox, kcfg_AllowCustomEncryptionOptions)
-#: rc.cpp:50
-msgid "Custom encryption command:"
-msgstr "أمر تشفير مخصص:"
-
-#. i18n: file: conf_encryption.ui:141
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, encrypt_to_always)
-#: rc.cpp:60
-msgid ""
-"<qt><b>Always encrypt with:</b><br />\n"
-"<p>This ensures all files/messages will also be encrypted with the chosen "
-"key. However, if the \"Encrypt files with:\" option is selected that chosen "
-"key will override the \"Always encrypt with:\" selection.</p></qt>"
-msgstr ""
-
-#. i18n: file: conf_encryption.ui:137
-#. i18n: ectx: property (text), widget (QCheckBox, encrypt_to_always)
-#: rc.cpp:57
-msgid "Always encrypt with:"
-msgstr "التشفير دوما بـ:"
-
-#. i18n: file: conf_encryption.ui:152
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, kcfg_EncryptFilesTo)
-#: rc.cpp:67
-msgid ""
-"<qt><b>Encrypt files with:</b><br />\n"
-"<p>Checking this option and selecting a key will force any file encryption "
-"operation to use the selected key. KGpg will not query for a recipient and "
-"the default key will be bypassed.</p></qt>"
-msgstr ""
-
-#. i18n: file: conf_encryption.ui:148
-#. i18n: ectx: property (text), widget (QCheckBox, kcfg_EncryptFilesTo)
-#: rc.cpp:64
-msgid "Encrypt files with:"
-msgstr "شفّر الملفات بـ:"
-
-#. i18n: file: conf_encryption.ui:163
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, kcfg_AllowUntrustedKeys)
-#: rc.cpp:74
-msgid ""
-"<qt><b>Allow encryption with untrusted keys:</b><br />\n"
-"<p>When importing a public key, the key is usually marked as untrusted and "
-"as such cannot be used unless it is signed by the default key (thus making "
-"it 'trusted'). Checking this box enables any key to be used even if it is "
-"untrusted.</p></qt>"
-msgstr ""
-
-#. i18n: file: conf_encryption.ui:159
-#. i18n: ectx: property (text), widget (QCheckBox, kcfg_AllowUntrustedKeys)
-#: rc.cpp:71 selectpublickeydialog.cpp:101
-msgid "Allow encryption with untrusted keys"
-msgstr "السماح بالتشفير بالمفاتيح غير الموثقة"
-
-#. i18n: file: conf_encryption.ui:145
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, kcfg_AllowUntrustedGroupMembers)
-#: rc.cpp:64 rc.cpp:1018
-msgid ""
-"<qt><b>Allow untrusted keys as members of key groups:</b><br /><p>A key "
-"group allows simple encryption to multiple recipients at once. Similar to "
-"the <em>Allow encryption with untrusted keys</em> option this allows "
-"untrusted keys to become member of a key group.</p></qt>"
-msgstr ""
-
-#. i18n: file: conf_encryption.ui:148
-#. i18n: ectx: property (text), widget (QCheckBox, kcfg_AllowUntrustedGroupMembers)
-#: rc.cpp:67 rc.cpp:1021
-msgid "Allow untrusted keys as members of key groups"
-msgstr ""
-
-#. i18n: file: conf_encryption.ui:66
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, kcfg_HideUserID)
-#: rc.cpp:46
-msgid ""
-"<qt><b>Hide user ID:</b><br /> \n"
-"<p>Checking this option will remove the keyid of the recipient from all "
-"encrypted packets. The advantage: traffic analysis of the encrypted packets "
-"cannot be performed as easily because the recipient is unknown. The "
-"disadvantage: the receiver of the encrypted packets is forced to try all "
-"secret keys before being able to decrypt the packets. This can be a lengthy "
-"process depending on the number of secret keys the receiver holds.</p></qt>"
-msgstr ""
-
-#. i18n: file: conf_encryption.ui:62
-#. i18n: ectx: property (text), widget (QCheckBox, kcfg_HideUserID)
-#: rc.cpp:43 selectpublickeydialog.cpp:107
-msgid "Hide user id"
-msgstr "أخفي هوية المستخدم"
-
-#. i18n: file: conf_encryption.ui:27
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, kcfg_PgpCompatibility)
-#: rc.cpp:25
-msgid ""
-"<qt><b>PGP 6 compatibility:</b><br /> \n"
-"<p>Checking this option forces GnuPG to output encrypted packets that are as "
-"compliant with PGP (Pretty Good Privacy) 6 standards as possible thus "
-"allowing GnuPG users to inter operate with PGP 6 users.</p></qt>"
-msgstr ""
-
-#. i18n: file: conf_encryption.ui:23
-#. i18n: ectx: property (text), widget (QCheckBox, kcfg_PgpCompatibility)
-#: rc.cpp:22
-msgid "PGP 6 compatibility"
-msgstr "توافقية PGP 6"
-
-#. i18n: file: kgpgrevokewidget.ui:18
-#. i18n: ectx: property (text), widget (QLabel, textLabel1)
-#: rc.cpp:494
-msgid "Create revocation certificate for"
-msgstr "أنشيء شهادة سحب الترخيص لـ"
-
-#. i18n: file: kgpgrevokewidget.ui:28
-#. i18n: ectx: property (text), widget (QLabel, keyID)
-#: rc.cpp:497
-msgid "key id"
-msgstr "هوية المفتاح"
-
-#. i18n: file: kgpgrevokewidget.ui:45
-#. i18n: ectx: property (text), widget (QLabel, textLabel3)
-#: rc.cpp:500
-msgid "Reason for revocation:"
-msgstr "سبب السحب:"
-
-#. i18n: file: kgpgrevokewidget.ui:56
-#. i18n: ectx: property (text), item, widget (KComboBox, comboBox1)
-#: rc.cpp:503
-msgid "No Reason"
-msgstr "بدون سبب"
-
-#. i18n: file: kgpgrevokewidget.ui:61
-#. i18n: ectx: property (text), item, widget (KComboBox, comboBox1)
-#: rc.cpp:506
-msgid "Key Has Been Compromised"
-msgstr "تم تعريض المفتاح للخطر"
-
-#. i18n: file: kgpgrevokewidget.ui:66
-#. i18n: ectx: property (text), item, widget (KComboBox, comboBox1)
-#: rc.cpp:509
-msgid "Key is Superseded"
-msgstr "تم إحلال المفتاح"
-
-#. i18n: file: kgpgrevokewidget.ui:71
-#. i18n: ectx: property (text), item, widget (KComboBox, comboBox1)
-#: rc.cpp:512
-msgid "Key is No Longer Used"
-msgstr "لم يعد المفتاح يُستخدم"
-
-#. i18n: file: kgpgrevokewidget.ui:81
-#. i18n: ectx: property (text), widget (QLabel, textLabel4)
-#: rc.cpp:515
-msgid "Description:"
-msgstr "الوصف:"
-
-#. i18n: file: kgpgrevokewidget.ui:96
-#. i18n: ectx: property (text), widget (QCheckBox, cbSave)
-#: rc.cpp:518
-msgid "Save certificate:"
-msgstr "حفظ الشهادة:"
-
-#. i18n: file: kgpgrevokewidget.ui:111
-#. i18n: ectx: property (text), widget (QCheckBox, cbPrint)
-#: rc.cpp:521
-msgid "Print certificate"
-msgstr "طباعة الشهادة"
-
-#. i18n: file: kgpgrevokewidget.ui:121
-#. i18n: ectx: property (text), widget (QCheckBox, cbImport)
-#: rc.cpp:524
-msgid "Import into keyring"
-msgstr "استورد إلى حلقة المفتاح"
-
-#. i18n: file: conf_servers.ui:29
-#. i18n: ectx: property (text), widget (QLabel, textLabel1_4)
-#: rc.cpp:203
-msgid ""
-"<b>INFORMATION</b>:\n"
-"Only the default server will be stored in GnuPG's configuration file,\n"
-"all others will be stored for use by KGpg only."
-msgstr ""
-"<b>معلومات</b>:\n"
-"سيتم فقط تخزين الملقم الإفتراضى في ملف إعداد GnuPG, \n"
-"وكل الأخر سيتم تخزينها لتستخدم بواسطةKGpg فقط."
-
-#. i18n: file: conf_servers.ui:39
-#. i18n: ectx: property (text), widget (QCheckBox, kcfg_UseProxy)
-#: rc.cpp:208
-msgid "Honor HTTP proxy when available"
-msgstr "استخدم بروكسى HTTP اذا كان موجودا"
-
-#. i18n: file: conf_servers.ui:50
-#. i18n: ectx: property (text), widget (KPushButton, server_default)
-#: rc.cpp:211
-msgid "&Set as Default"
-msgstr "حدد كافتراضي"
-
-#. i18n: file: conf_servers.ui:57
-#. i18n: ectx: property (text), widget (KPushButton, server_add)
-#: rc.cpp:214
-msgid "&Add..."
-msgstr "أ&ضف..."
-
-#. i18n: file: conf_servers.ui:67
-#. i18n: ectx: property (text), widget (KPushButton, server_del)
-#: rc.cpp:217
-msgid "&Delete"
-msgstr "اح&ذف"
-
-#. i18n: file: conf_servers.ui:74
-#. i18n: ectx: property (text), widget (KPushButton, server_edit)
-#: rc.cpp:220
-msgid "&Edit..."
-msgstr "&حرّر..."
-
-#. i18n: file: conf_misc.ui:24
-#. i18n: ectx: attribute (title), widget (QWidget, tab)
-#: rc.cpp:116
-msgid "Global Settings"
-msgstr "الإعدادات العامة"
-
-#. i18n: file: conf_misc.ui:33
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, kcfg_AutoStart)
-#: rc.cpp:119
-msgid ""
-"<qt><b>Start KGpg automatically at KDE startup:</b><br />\n"
-"<p>If checked KGpg will start automatically each time that KDE starts "
-"up.</p></qt>"
-msgstr ""
-"<qt><b>بدأ KGpg تلقائيا عند تسجيل الدخول:</b><br />\n"
-"<p>إذا كان محددا سيبدأ KGpg تلقائيا في كل مرة تبدأ فيها كدى.</p></qt>"
-
-#. i18n: file: conf_misc.ui:36
-#. i18n: ectx: property (text), widget (QCheckBox, kcfg_AutoStart)
-#: rc.cpp:123
-msgid "Start KGpg automatically at login"
-msgstr "ابدأ KGpg تلقائيا عند تسجيل الدخول"
-
-#. i18n: file: conf_misc.ui:53
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, kcfg_UseMouseSelection)
-#: rc.cpp:126
-msgid ""
-"<qt><b>Use mouse selection instead of clipboard:</b><br />\n"
-"<p>If checked, clipboard operations in KGpg will use the selection "
-"clipboard, that means highlighting a text to copy, and middle button (or "
-"right+left together) to paste. If this option is not checked, the clipboard "
-"will work with Key shortcuts (Ctrl-c, Ctrl-v).</p></qt> "
-msgstr ""
-
-#. i18n: file: conf_misc.ui:56
-#. i18n: ectx: property (text), widget (QCheckBox, kcfg_UseMouseSelection)
-#: rc.cpp:130
-msgid "Use mouse selection instead of clipboard"
-msgstr "استعمال تحديد الفأرة بدلا من الحافظة"
-
-#. i18n: file: conf_misc.ui:70
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, kcfg_RemoteFileWarn)
-#: rc.cpp:133
-msgid ""
-"<qt><b>Display warning before creating temporary files:</b><br />\n"
-"<p></p></qt>"
-msgstr ""
-
-#. i18n: file: conf_misc.ui:74
-#. i18n: ectx: property (text), widget (QCheckBox, kcfg_RemoteFileWarn)
-#: rc.cpp:137
-msgid ""
-"Display warning before creating temporary files\n"
-"(only occurs on remote files operations)"
-msgstr ""
-"عرض تحذير قبل إنشاء ملفات مؤقتة\n"
-"(تحدث فقط عند عمليات الملفات البعيدة)"
-
-#. i18n: file: conf_misc.ui:97
-#. i18n: ectx: attribute (title), widget (QWidget, TabPage)
-#: rc.cpp:141
-msgid "Applet && Menus"
-msgstr "البريمج والقوائم"
-
-#. i18n: file: conf_misc.ui:103
-#. i18n: ectx: property (title), widget (QGroupBox, groupBox11)
-#: rc.cpp:144
-msgid "Konqueror Service Menus"
-msgstr "قوائم  خدمة Konqueror"
-
-#. i18n: file: conf_misc.ui:119
-#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel1)
-#: rc.cpp:147
-msgid ""
-"<qt><b>Sign file service menu:</b><br />\n"
-"<p></p>\n"
-"</qt>"
-msgstr ""
-
-#. i18n: file: conf_misc.ui:122
-#. i18n: ectx: property (text), widget (QLabel, textLabel1)
-#: rc.cpp:152
-msgid "Sign file service menu:"
-msgstr "قائمة خدمة توقيع ملف:"
-
-#. i18n: file: conf_misc.ui:144
-#. i18n: ectx: property (text), item, widget (KComboBox, kcfg_SignMenu)
-#. i18n: file: conf_misc.ui:183
-#. i18n: ectx: property (text), item, widget (KComboBox, kcfg_DecryptMenu)
-#: rc.cpp:158 rc.cpp:172
-msgid "Enable with All Files"
-msgstr "مكّن مع كل الملفات"
-
-#. i18n: file: conf_misc.ui:164
-#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel1_3)
-#: rc.cpp:161
-msgid ""
-"<qt><b>Decrypt file service menu:</b><br />\n"
-"<p></p>\n"
-"</qt>"
-msgstr ""
-
-#. i18n: file: conf_misc.ui:167
-#. i18n: ectx: property (text), widget (QLabel, textLabel1_3)
-#: rc.cpp:166
-msgid "Decrypt file service menu:"
-msgstr "قائمة خدمة فك تشفير ملف:"
-
-#. i18n: file: conf_misc.ui:188
-#. i18n: ectx: property (text), item, widget (KComboBox, kcfg_DecryptMenu)
-#: rc.cpp:175
-msgid "Enable with Encrypted Files"
-msgstr "مكّن مع الملفات المشفرة"
-
-#. i18n: file: conf_misc.ui:201
-#. i18n: ectx: property (title), widget (QGroupBox, groupBox3)
-#: rc.cpp:178
-msgid "System Tray Applet"
-msgstr "بريمجات لوحة النظام"
-
-#. i18n: file: conf_misc.ui:208
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, kcfg_ShowSystray)
-#: rc.cpp:181
-msgid ""
-"<qt><b>Show system tray icon:</b><br />\n"
-"<p>If checked KGpg will minimize to an icon in the system tray.</p></qt>"
-msgstr ""
-
-#. i18n: file: conf_misc.ui:211
-#. i18n: ectx: property (text), widget (QCheckBox, kcfg_ShowSystray)
-#: rc.cpp:185
-msgid "Show system tray icon"
-msgstr ""
-
-#. i18n: file: conf_misc.ui:223
-#. i18n: ectx: property (text), widget (QLabel, textLabel1_2)
-#: rc.cpp:188
-msgid "Left mouse click opens:"
-msgstr "النقر بزر الفأرة الأيسر يفتح:"
-
-#. i18n: file: conf_misc.ui:240
-#. i18n: ectx: property (text), item, widget (KComboBox, kcfg_LeftClick)
-#: rc.cpp:191
-msgid "Key Manager"
-msgstr "مدير المفاتيح"
-
-#. i18n: file: conf_misc.ui:245
-#. i18n: ectx: property (text), item, widget (KComboBox, kcfg_LeftClick)
-#. i18n: file: conf_misc.ui:272
-#. i18n: ectx: attribute (title), widget (QWidget, tab_2)
-#: rc.cpp:194 rc.cpp:197 editor/kgpgeditor.cpp:509
-msgid "Editor"
-msgstr "محرر"
-
-#. i18n: file: conf_misc.ui:280
-#. i18n: ectx: property (text), widget (QLabel, label)
-#: rc.cpp:200
-msgid "Recent files"
-msgstr "الملفات الأخيرة"
-
-#. i18n: file: conf_misc.ui:306
-#. i18n: ectx: attribute (title), widget (QWidget, tabSigning)
-#: rc.cpp:209 rc.cpp:1178
-msgid "Key Signing"
-msgstr "مفتاح التوقيع"
-
-#. i18n: file: conf_misc.ui:314
-#. i18n: ectx: property (whatsThis), widget (QLabel, label_2)
-#: rc.cpp:212 rc.cpp:1181
-msgid ""
-"Here you can define how User Ids that do not contain an email address (like "
-"Photo Ids) are sent to the key owner. You can choose to either send them "
-"with every other User Id you signed, only with the first Id you signed or to "
-"not send them at all."
-msgstr ""
-
-#. i18n: file: conf_misc.ui:317
-#. i18n: ectx: property (text), widget (QLabel, label_2)
-#: rc.cpp:215 rc.cpp:1184
-msgid "Mailing of User Ids without Email Addresses"
-msgstr "إرسال معرفات المستخدم بدون عنوان بريدي"
-
-#. i18n: file: conf_misc.ui:325
-#. i18n: ectx: property (text), item, widget (KComboBox, kcfg_MailUats)
-#: rc.cpp:218 rc.cpp:1187
-msgid "Send with every Email"
-msgstr "ارسل مع كل بريد إلكتروني"
-
-#. i18n: file: conf_misc.ui:330
-#. i18n: ectx: property (text), item, widget (KComboBox, kcfg_MailUats)
-#: rc.cpp:221 rc.cpp:1190
-msgid "Send only with first Email"
-msgstr "ارسل فقط مع أول بريد"
-
-#. i18n: file: conf_misc.ui:335
-#. i18n: ectx: property (text), item, widget (KComboBox, kcfg_MailUats)
-#: rc.cpp:224 rc.cpp:1193
-msgid "Do not send"
-msgstr "لا ترسل"
-
-#. i18n: file: conf_misc.ui:345
-#. i18n: ectx: property (title), widget (QGroupBox, groupBox)
-#: rc.cpp:227 rc.cpp:1196
-msgid "Email template"
-msgstr "قالب البريد الإلكتروني"
-
-#. i18n: file: conf_misc.ui:353
-#. i18n: ectx: property (whatsThis), widget (KTextEdit, kcfg_EmailTemplate)
-#: rc.cpp:231 rc.cpp:1200
-#, no-c-format
-msgid ""
-"This is the text of the email sent by the \"Sign and Mail User ID\" action.\n"
-"\n"
-"The placeholders surrounded by the percent signs (like %KEYID%) will be "
-"replaced with the corresponding text for every single mail."
-msgstr ""
-
-#. i18n: file: keyexport.ui:34
-#. i18n: ectx: property (text), widget (QRadioButton, checkMail)
-#: rc.cpp:274
-msgctxt "Export a key via email"
-msgid "Email"
-msgstr "البريد الإلكتروني"
-
-#. i18n: file: keyexport.ui:85
-#. i18n: ectx: property (title), widget (QGroupBox, buttonGroup3)
-#: rc.cpp:286
-msgid "Export Settings"
-msgstr "صدر الإعدادات"
-
-#. i18n: file: keyexport.ui:91
-#. i18n: ectx: property (text), widget (QRadioButton, checkAttrAll)
-#: rc.cpp:289
-msgid "Export everything"
-msgstr "صدر كل شيء"
-
-#. i18n: file: keyexport.ui:101
-#. i18n: ectx: property (text), widget (QRadioButton, checkAttrPhoto)
-#: rc.cpp:292
-msgid "Do not export attributes (photo ids)"
-msgstr "لا تصدير الصّفات (صورة الهوية)"
-
-#. i18n: file: keyexport.ui:108
-#. i18n: ectx: property (text), widget (QRadioButton, checkAttrClean)
-#: rc.cpp:295
-msgctxt ""
-"@option:radio Exports the smallest key possible. Maps to export-minimal "
-"option of gpg"
-msgid "Clean key"
-msgstr "مفتاح نظيف"
-
-#. i18n: file: conf_ui2.ui:32
-#. i18n: ectx: attribute (title), widget (QWidget, tab)
-#: rc.cpp:223
-msgid "Key Colors"
-msgstr "ألوان المفتاح"
-
-#. i18n: file: conf_ui2.ui:42
-#. i18n: ectx: property (text), widget (QLabel, textLabel1_5)
-#: rc.cpp:226
-msgid "Ultimately trusted keys:"
-msgstr "مفاتيح غير محدودة الثقة:"
-
-#. i18n: file: conf_ui2.ui:52
-#. i18n: ectx: property (text), widget (QLabel, textLabel1_4)
-#: rc.cpp:229
-msgid "Trusted keys:"
-msgstr "مفاتيح ثقة:"
-
-#. i18n: file: conf_ui2.ui:62
-#. i18n: ectx: property (text), widget (QLabel, textLabel1_5)
-#: rc.cpp:232
-msgid "Marginally trusted keys:"
-msgstr "المفاتيح الموثُوقة الهامشية:"
-
-#. i18n: file: conf_ui2.ui:72
-#. i18n: ectx: property (text), widget (QLabel, textLabel1_6)
-#: rc.cpp:235
-msgid "Expired keys:"
-msgstr "مفاتيح منتهية:"
-
-#. i18n: file: conf_ui2.ui:82
-#. i18n: ectx: property (text), widget (QLabel, textLabel1_2_3)
-#: rc.cpp:238
-msgid "Revoked keys:"
-msgstr "مفاتيح ملغاة:"
-
-#. i18n: file: conf_ui2.ui:92
-#. i18n: ectx: property (text), widget (QLabel, textLabel1_3_3)
-#: rc.cpp:241
-msgid "Unknown keys:"
-msgstr "مفاتيح غير معروفه:"
-
-#. i18n: file: conf_ui2.ui:102
-#. i18n: ectx: property (text), widget (QLabel, textLabel1_4_2)
-#: rc.cpp:244
-msgid "Disabled keys:"
-msgstr "مفاتيح معطلة:"
-
-#. i18n: file: conf_ui2.ui:225
-#. i18n: ectx: attribute (title), widget (QWidget, TabPage)
-#: rc.cpp:247
-msgid "Editor Font"
-msgstr "خط المحرر"
-
-#. i18n: file: searchres.ui:57
-#. i18n: ectx: property (text), widget (QTreeView, kLVsearch)
-#: rc.cpp:573
-msgid "Keys"
-msgstr "ال&مفاتيح"
-
-#. i18n: file: searchres.ui:67
-#. i18n: ectx: property (text), widget (QLabel, textLabel1)
-#: rc.cpp:576
-msgid "Key to import:"
-msgstr "المفتاح المراد استيراده:"
-
-#: selectexpirydate.cpp:27
-msgid "Choose New Expiration"
-msgstr "اختر تاريخ انتهاء جديد"
-
-#: selectexpirydate.cpp:33
-msgctxt "Key has unlimited lifetime"
-msgid "Unlimited"
-msgstr "غير محدود"
-
-#: selectpublickeydialog.cpp:45
-msgid "O&ptions"
-msgstr "الخيا&رات"
-
-#: selectpublickeydialog.cpp:52
-msgid "Select Public Key"
-msgstr "اختر مفتاح عام"
-
-#: selectpublickeydialog.cpp:55
-#, kde-format
-msgid "Select Public Key for %1"
-msgstr "اختر مفتاح عام لـ %1"
-
-#: selectpublickeydialog.cpp:58
-#, kde-format
-msgid "Select Public Key for %2 and one more file"
-msgid_plural "Select Public Key for %2 and %1 more files"
-msgstr[0] ""
-msgstr[1] ""
-
-#: selectpublickeydialog.cpp:67
-msgid "&Search: "
-msgstr "&ابحث: "
-
-#: selectpublickeydialog.cpp:84
-msgid ""
-"<b>Public keys list</b>: select the key that will be used for encryption."
-msgstr "<b>قائمة المفاتيح العامة</b>: اختر المفتاح الذي سيُستخدم للتشفير."
-
-#: selectpublickeydialog.cpp:98
-msgid ""
-"<b>ASCII encryption</b>: makes it possible to open the encrypted "
-"file/message in a text editor"
-msgstr ""
-"<b>ASCII تشفير</b>: يجعل من الممكن فتح الملف المشفر/الرسالة في محرر نصوص"
-
-#: selectpublickeydialog.cpp:103
-msgid ""
-"<b>Allow encryption with untrusted keys</b>: when you import a public key, "
-"it is usually marked as untrusted and you cannot use it unless you sign it "
-"in order to make it 'trusted'. Checking this box enables you to use any key, "
-"even if it has not be signed."
-msgstr ""
-"<b>السماح بالتشفير بمفاتيح غير موثوقة</b>: عندما تقوم باستيراد مفتاح عام، "
-"يتم تعليمه عادة كمفتاح غير موثوق ولا يمكنك استخدامه مالم توقّعه لتجعله "
-"'موثّقا'. تحديد هذا الخيار يمكنك من استخدام أي مفتاح حتى إذا لم يتم توقيعه."
-
-#: selectpublickeydialog.cpp:109
-msgid ""
-"<b>Hide user ID</b>: Do not put the keyid into encrypted packets. This "
-"option hides the receiver of the message and is a countermeasure against "
-"traffic analysis. It may slow down the decryption process because all "
-"available secret keys are tried."
-msgstr ""
-"<b>إخفاء هوية المستخدم</b>: لا تضع رقم هوية المفتاح في الحزم المشفرة. هذا "
-"الخيار يخفي مستقبل الرسالة ويعد إجراءاً مضاداً ضد تحليل الحركة. ربما يبطء "
-"بعملية التشفير لأن كل المفاتيح السرية المتاحة سيتم تجربتها."
-
-#: selectpublickeydialog.cpp:113
-msgid "Symmetrical encryption"
-msgstr "تشفير متماثل"
-
-#: selectpublickeydialog.cpp:114
-msgid ""
-"<b>Symmetrical encryption</b>: encryption does not use keys. You just need "
-"to give a password to encrypt/decrypt the file"
-msgstr ""
-"<b>تشفير متماثل</b>: تشفير لا يستخدم المفاتيح. فقط تحتاج لإعطاء كلمة المرور "
-"لتشفير/فك تشفير الملف"
-
-#: selectpublickeydialog.cpp:128
-msgid "Custom option:"
-msgstr "خيار مخصص:"
-
-#: selectpublickeydialog.cpp:132
-msgid ""
-"<b>Custom option</b>: for experienced users only, allows you to enter a gpg "
-"command line option, like: '--armor'"
-msgstr ""
-"<b>خيار مخصص</b>:للمستخدم الخبير فقط, تسمح لك بأن تدخل خيار سطر أوامر gpg, "
-"مثل: '--armor'"
-
-#: selectsecretkey.cpp:32
-msgid "Private Key List"
-msgstr "قائمة المفاتيح الخاصة"
-
-#: selectsecretkey.cpp:37
-msgid "Choose secret key for signing:"
-msgstr "اختر مفتاح سري لتوقيع:"
-
-#: selectsecretkey.cpp:53
-#, kde-format
-msgid ""
-"How carefully have you checked that the key really belongs to the person "
-"with whom you wish to communicate:"
-msgid_plural ""
-"How carefully have you checked that the %1 keys really belong to the people "
-"with whom you wish to communicate:"
-msgstr[0] ""
-msgstr[1] ""
-
-#: selectsecretkey.cpp:60
-msgid "I Will Not Answer"
-msgstr "لن أجيب"
-
-#: selectsecretkey.cpp:61
-msgid "I Have Not Checked at All"
-msgstr "لم أتحقق على الإطلاق"
-
-#: selectsecretkey.cpp:62
-msgid "I Have Done Casual Checking"
-msgstr "قمت بتحقق عادي"
-
-#: selectsecretkey.cpp:63
-msgid "I Have Done Very Careful Checking"
-msgstr "قمت بالتحقق بحرص شديد"
-
-#: selectsecretkey.cpp:65
-msgid "Local signature (cannot be exported)"
-msgstr "توقيع محلي (لا يمكن تصديره)"
-
-#: selectsecretkey.cpp:66
-msgid "Do not sign all user id's (open terminal)"
-msgstr "لا توقع كل أرقام هويات المستخدم (فتح الطرفية)"
-
-#. i18n: file: tips:2
-#. i18n: ectx: @info:tipoftheday
-#: tips.cpp:3
-msgid ""
-"<p>If you want to decrypt a text file, simply drag and drop it into the "
-"editor window. KGpg will do the rest. Even remote files can be dropped.</p>\n"
-"<p>Drag a public key into the editor window and kgpg will automatically "
-"import it if you want.</p>\n"
-msgstr ""
-"<p>إذا كنت تريد فك تشفير ملف نصي، ببساطة اسحب والقى الملف في نافذة المحرر. "
-"Kgpg سيقوم بالباقي. حتى الملفات البعيدة يمكن أن تُسحب.</p>\n"
-"<p>إذا كنت تريد ذلك اسحب المفتاح العام في نافذة المحرر وسيستورد الـ Kgpg هذه "
-"الملفات تلقائيا.</p>\n"
-
-#. i18n: file: tips:7
-#. i18n: ectx: @info:tipoftheday
-#: tips.cpp:9
-msgid ""
-"<p>The easiest way to encrypt a file: simply right click on the file, and "
-"you have an encrypt option in the contextual menu.\n"
-"This works in <strong>konqueror</strong> or on your Desktop!</p>\n"
-msgstr ""
-"<p>أسهل الطرق لتشفير ملف: ببساطة انقر بالزر الأيمن على الملف, وفي قائمة "
-"السياق لديك خيار التشفير.\n"
-"يعمل هذا في <strong>كونكيورر</strong> أو سطح المكتب!</p>\n"
-
-#. i18n: file: tips:13
-#. i18n: ectx: @info:tipoftheday
-#: tips.cpp:15
-msgid ""
-"<p>If you want to encrypt a message for several persons, just select several "
-"encryption keys by pressing the &quot;Ctrl&quot; key.</p>\n"
-msgstr ""
-
-#. i18n: file: tips:18
-#. i18n: ectx: @info:tipoftheday
-#: tips.cpp:20
-msgid ""
-"<p><strong>You do not know anything about encryption?</strong><br>\n"
-"No problem, simply create yourself a key pair in the key management window. "
-"Then, export your public key and mail it to your friends.<br>\n"
-"Ask them to do the same and import their public keys. Finally, to send an "
-"encrypted message, type it in the KGpg editor, then click "
-"&quot;encrypt&quot;. Choose\n"
-"your friend key and click &quot;encrypt&quot; again. The message will be "
-"encrypted, ready to be sent by email.</p>\n"
-msgstr ""
-
-#. i18n: file: tips:26
-#. i18n: ectx: @info:tipoftheday
-#: tips.cpp:28
-msgid ""
-"<p>To perform an operation on a key, open the key management window and "
-"right click on the key. A popup menu with all available options will "
-"appear.</p>\n"
-msgstr ""
-
-#. i18n: file: tips:31
-#. i18n: ectx: @info:tipoftheday
-#: tips.cpp:33
-msgid ""
-"<p>Decrypt a file with a single mouse click on it. You will then be prompted "
-"for password, and then that is it!</p>\n"
-msgstr ""
-
-#. i18n: file: tips:36
-#. i18n: ectx: @info:tipoftheday
-#: tips.cpp:38
-msgid ""
-"<p>If you only want to open the key manager, type this in the command line "
-"prompt: <pre>kgpg -k</pre>\n"
-"The editor can be reached by: <pre>kgpg -d</pre></p>\n"
-msgstr ""
-
-#. i18n: file: tips:42
-#. i18n: ectx: @info:tipoftheday
-#: tips.cpp:44
-msgid ""
-"<p>To open a file in the KGpg's editor and immediately decrypt it type: "
-"<pre>kgpg -s filename</pre></p>\n"
-msgstr ""
-
-#. i18n: file: tips:47
-#. i18n: ectx: @info:tipoftheday
-#: tips.cpp:49
-msgid ""
-"<p>If you want to change the password or expiration of a secret key simply "
-"double click on it to get the key properties dialog.</p>\n"
-msgstr ""
-
-#. i18n: file: tips:52
-#. i18n: ectx: @info:tipoftheday
-#: tips.cpp:54
-msgid ""
-"<p>You can reach your default key by pressing &quot;Ctrl+Home&quot; in the "
-"key manager.</p>\n"
-msgstr ""
-
-#. i18n: file: tips:57
-#. i18n: ectx: @info:tipoftheday
-#: tips.cpp:59
-msgid ""
-"<p>The number of signatures is shown as a tooltip if you hover the mouse on "
-"the size column in key manager. A key has to be expanded once for this to "
-"work.</p>\n"
-msgstr ""
-
-#: core/KGpgGroupNode.cpp:70
-#, kde-format
-msgid "1 key"
-msgid_plural "%1 keys"
-msgstr[0] "لا توجد مفاتيح"
-msgstr[1] "مفتاح واحد"
-msgstr[2] "مفتاحان"
-msgstr[3] "%1 مفاتيح"
-msgstr[4] "%1 مفتاحا"
-msgstr[5] "%1 مفتاح"
-
-#: core/KGpgKeyNode.cpp:81
-#, kde-format
-msgctxt "size of signing key / size of encryption key"
-msgid "%1 / %2"
-msgstr "%1 / %2"
-
-#: core/KGpgKeyNode.cpp:187 core/KGpgSignableNode.cpp:48
-#, kde-format
-msgid "1 signature"
-msgid_plural "%1 signatures"
-msgstr[0] ""
-msgstr[1] "توقيع واحد"
-msgstr[2] "توقيعان"
-msgstr[3] "%1 توقيعات"
-msgstr[4] "%1 توقيعا"
-msgstr[5] "%1 توقيع"
-
-#: core/KGpgNode.cpp:56
-#, kde-format
-msgctxt "Name of uid (comment)"
-msgid "%1 (%2)"
-msgstr "%1 (%2)"
-
-#: core/KGpgSignNode.cpp:63
-#, kde-format
-msgid "%1 [local signature]"
-msgstr "%1 [توقيع محلي]"
-
-#: core/KGpgSubkeyNode.cpp:74
-#, kde-format
-msgid "%1 subkey"
-msgstr "%1 مفتاح فرعي"
-
-#: core/KGpgUatNode.cpp:43
-msgid "Photo id"
-msgstr "صورة الهوية"
-
-#: kgpgkeygenerate.cpp:100 core/convert.cpp:36
-msgctxt "Encryption algorithm"
-msgid "RSA"
-msgstr "RSA"
-
-#: core/convert.cpp:37
-msgctxt "Encryption algorithm"
-msgid "DSA"
-msgstr "DSA"
-
-#: core/convert.cpp:38
-msgctxt "Encryption algorithm"
-msgid "ElGamal"
-msgstr "ElGamal"
-
-#: kgpgkeygenerate.cpp:99 core/convert.cpp:39
-msgctxt "Encryption algorithm"
-msgid "DSA & ElGamal"
-msgstr "DSA و ElGamal"
-
-#: core/convert.cpp:41
-msgctxt "Encryption algorithm RSA, Signing algorithm RSA"
-msgid "RSA & RSA"
-msgstr ""
-
-#: core/convert.cpp:41
-msgctxt "Unknown algorithm"
-msgid "Unknown"
-msgstr "مجهول"
-
-#: core/convert.cpp:49
-msgid "Do not Know"
-msgstr "لا أعرف"
-
-#: core/convert.cpp:50
-msgid "Do NOT Trust"
-msgstr "لا تثق"
-
-#: core/convert.cpp:55
-msgctxt "Unknown trust in key owner"
-msgid "Unknown"
-msgstr "مجهول"
-
-#: core/convert.cpp:63
-msgctxt "Invalid key"
-msgid "Invalid"
-msgstr "غير صالح"
-
-#: core/convert.cpp:64
-msgctxt "Disabled key"
-msgid "Disabled"
-msgstr "معطل"
-
-#: core/convert.cpp:65
-msgid "Revoked"
-msgstr "ملغى"
-
-#: core/convert.cpp:66
-msgctxt "Expired key"
-msgid "Expired"
-msgstr "منتهي"
-
-#: core/convert.cpp:67
-msgctxt "Undefined key trust"
-msgid "Undefined"
-msgstr "غير معرف"
-
-#: core/convert.cpp:68
-msgctxt "No trust in key"
-msgid "None"
-msgstr "بدون"
-
-#: core/convert.cpp:69
-msgctxt "Marginal trust in key"
-msgid "Marginal"
-msgstr "هامشي"
-
-#: core/convert.cpp:70
-msgctxt "Full trust in key"
-msgid "Full"
-msgstr "كامل"
-
-#: core/convert.cpp:71
-msgctxt "Ultimate trust in key"
-msgid "Ultimate"
-msgstr "غير محدود"
-
-#: core/convert.cpp:73
-msgctxt "Unknown trust in key"
-msgid "Unknown"
-msgstr "مجهول"
-
-#: editor/kgpgeditor.cpp:89 editor/kgpgeditor.cpp:246
-#: editor/kgpgeditor.cpp:726 editor/kgpgeditor.cpp:755
-msgid "Untitled"
-msgstr "بدون عنوان"
-
-#: editor/kgpgeditor.cpp:187
-msgid "&Encrypt File..."
-msgstr "&شفّر الملف..."
-
-#: editor/kgpgeditor.cpp:191
-msgid "&Decrypt File..."
-msgstr "&فكّ تشفير الملف..."
-
-#: editor/kgpgeditor.cpp:195
-msgid "&Open Key Manager"
-msgstr "افت&ح مدير المفاتيح"
-
-#: editor/kgpgeditor.cpp:198
-msgid "&Generate Signature..."
-msgstr "&ولّد توقيع..."
-
-#: editor/kgpgeditor.cpp:202
-msgid "&Verify Signature..."
-msgstr "ت&حقّق من التوقيع..."
-
-#: editor/kgpgeditor.cpp:205
-msgid "&Check MD5 Sum..."
-msgstr "&تحقق من MD5 Sum..."
-
-#: editor/kgpgeditor.cpp:209
-msgid "&Unicode (utf-8) Encoding"
-msgstr "ترميز &يونيكود (utf-8)"
-
-#: editor/kgpgeditor.cpp:216
-msgid "En&crypt"
-msgstr "&شفّر"
-
-#: editor/kgpgeditor.cpp:221
-msgid "&Decrypt"
-msgstr "&فكّ التشفير"
-
-#: editor/kgpgeditor.cpp:226
-msgid "S&ign/Verify"
-msgstr "و&قّع/تحقق"
-
-#: editor/kgpgeditor.cpp:250
-#, kde-format
-msgid ""
-"The document \"%1\" has changed.\n"
-"Do you want to save it?"
-msgstr ""
-"غير المستند التالي \"%1\" .\n"
-"هل تريد حفظه؟"
-
-#: editor/kgpgeditor.cpp:251
-msgid "Close the document"
-msgstr "أغلق المستند"
-
-#: editor/kgpgeditor.cpp:298
-msgid ""
-"The document could not been saved, as the selected codec is not supported."
-msgstr ""
-
-#: editor/kgpgeditor.cpp:298
-msgid ""
-"The document could not been saved, as the selected encoding cannot encode "
-"every unicode character in it."
-msgstr ""
-"لم يستطع حفظ المستند، لأن الترميز المختار لا يمكنه ترميز كل حروف يونيكود "
-"التي يحويها."
-
-#: editor/kgpgeditor.cpp:307 editor/kgpgeditor.cpp:326
-msgid ""
-"The document could not be saved, please check your permissions and disk "
-"space."
-msgstr "لا يمكن حفظ المستند، فضلا تحقق من صلاحياتك و مساحة القرص."
-
-#: editor/kgpgeditor.cpp:355 editor/kgpgeditor.cpp:365
-#, kde-format
-msgid "Overwrite existing file %1?"
-msgstr "الكتابة على الملف الحالي %1؟"
-
-#: editor/kgpgeditor.cpp:476 editor/kgpgeditor.cpp:484
-#: editor/kgpgeditor.cpp:622 editor/kgpgeditor.cpp:663
-#: editor/kgpgeditor.cpp:696
-msgid "*|All Files"
-msgstr "*|كافة الملفات"
-
-#: editor/kgpgeditor.cpp:476
-msgid "Open File to Encode"
-msgstr "افتح ملف ليتم ترميزه"
-
-#: editor/kgpgeditor.cpp:484
-msgid "Open File to Decode"
-msgstr "افتح ملف ليتم فك ترميزه"
-
-#: editor/kgpgeditor.cpp:498
-msgid "Decrypt File To"
-msgstr "فكّ تشفير ملف إلى"
-
-#: editor/kgpgeditor.cpp:622
-msgid "Open File to Sign"
-msgstr "افتح ملف لتوقيعه"
-
-#: editor/kgpgeditor.cpp:663 editor/kgpgeditor.cpp:696
-msgid "Open File to Verify"
-msgstr "افتح ملف للتحقّق"
-
-#: editor/kgpgmd5widget.cpp:28
-msgid "MD5 Checksum"
-msgstr "MD5 Checksum"
-
-#: editor/kgpgmd5widget.cpp:31
-msgid "Compare MD5 with Clipboard"
-msgstr "مقارنة MD5  مع الحافظة"
-
-#: editor/kgpgmd5widget.cpp:46
-#, kde-format
-msgid "MD5 sum for <b>%1</b> is:"
-msgstr "MD5 sum لـ <b>%1</b>هو:"
-
-#: editor/kgpgmd5widget.cpp:59
-msgid "<b>Unknown status</b>"
-msgstr "<b>حالة مجهولة</b>"
-
-#: editor/kgpgmd5widget.cpp:84
-msgid "Clipboard content is not a MD5 sum."
-msgstr "محتويات الحافظة ليست MD5 sum."
-
-#: editor/kgpgmd5widget.cpp:88
-msgid "<b>Correct checksum</b>, file is ok."
-msgstr "<b>الـ checksum صحيح</b>, الملف سليم."
-
-#: editor/kgpgmd5widget.cpp:94
-msgid "<b>Wrong checksum, <em>file corrupted</em></b>"
-msgstr "<b>الـ checksum خاطئ <em>الملف معطوب</em></b>"
-
-#: editor/kgpgtextedit.cpp:85
-msgid ""
-"<qt><b>Remote file dropped</b>.<br />The remote file will now be copied to a "
-"temporary file to process requested operation. This temporary file will be "
-"deleted after operation.</qt>"
-msgstr ""
-"<qt><b>أسقط الملف البعيد</b>.<br />الملف البعيد سيتم الآن نسخه إلى ملف مؤقت "
-"لمعالجة العملية المطلوبة. هذا الملف المؤقت سيتم حذفه بعد العملية.</qt>"
-
-#: editor/kgpgtextedit.cpp:90
-msgid "Could not download file."
-msgstr "تعذر تحميل (تنزيل) الملف."
-
-#: editor/kgpgtextedit.cpp:117
-msgid ""
-"<qt>This file is a <b>public</b> key.<br />Do you want to import it instead "
-"of opening it in editor?</qt>"
-msgstr ""
-
-#: editor/kgpgtextedit.cpp:120
-msgid ""
-"<qt>This file is a <b>private</b> key.<br />Do you want to import it instead "
-"of opening it in editor?</qt>"
-msgstr ""
-
-#: editor/kgpgtextedit.cpp:125
-msgid "Key file dropped on Editor"
-msgstr "أسقط ملف المفتاح في المحرر"
-
-#: editor/kgpgtextedit.cpp:313
-msgid "Encryption failed."
-msgstr "فشل التشفير."
-
-#: editor/kgpgtextedit.cpp:349
-msgid "Signing not possible: bad passphrase or missing key"
-msgstr "لا يمكن التوقيع: كلمة مرور خاطئة أو مفتاح مفقود"
-
-#: editor/kgpgtextedit.cpp:378
-msgid "Import key in your list"
-msgstr "استورد المفتاح إلى قائمتك"
-
-#: editor/kgpgtextedit.cpp:381
-msgid "Do &Not Import"
-msgstr "لا تستورد"
-
-#: editor/kgpgtextedit.cpp:382
-msgid "Will not import this key in your list"
-msgstr "لن يستورد هذا المفتاح إلى قائمتك"
-
-#: editor/kgpgtextedit.cpp:384
-msgid "Missing Key"
-msgstr "مفتاح مفقود"
-
-#: model/keylistproxymodel.cpp:95
-#, kde-format
-msgctxt "ID: Name"
-msgid "%1: %2"
-msgstr "%1: %2"
-
-#: model/keylistproxymodel.cpp:97
-#, kde-format
-msgctxt "ID: Name <Email>"
-msgid "%1: %2 &lt;%3&gt;"
-msgstr "%1: %2 &lt;%3&gt;"
-
-#: model/keylistproxymodel.cpp:102
-#, kde-format
-msgctxt "Name <Email>: ID"
-msgid "%1 &lt;%2&gt;: %3"
-msgstr "%1 &lt;%2&gt;: %3"
-
-#: model/kgpgitemmodel.cpp:198 model/kgpgitemmodel.cpp:201
-#, kde-format
-msgid "1 Key"
-msgid_plural "%1 Keys"
-msgstr[0] ""
-msgstr[1] "مفتاح واحد"
-msgstr[2] "مفتاحان"
-msgstr[3] "%1 مفاتيح"
-msgstr[4] "%1 مفتاحا"
-msgstr[5] "%1 مفتاح"
-
-#: model/kgpgitemmodel.cpp:202
-#, kde-format
-msgid "1 Group"
-msgid_plural "%1 Groups"
-msgstr[0] "لا توجد مجموعة"
-msgstr[1] "مجموعة واحدة"
-msgstr[2] "مجموعتان"
-msgstr[3] "%1 مجموعات"
-msgstr[4] "%1 مجموعة"
-msgstr[5] "%1 مجموعة"
-
-#: model/kgpgitemmodel.cpp:204
-#, kde-format
-msgctxt "%1 = something like 7 keys, %2 = something like 2 groups"
-msgid "%1, %2"
-msgstr "%1, %2"
-
-#: model/kgpgitemmodel.cpp:289
-msgid "ID"
-msgstr "هوية"
-
-#: model/kgpgsearchresultmodel.cpp:217
-#, kde-format
-msgctxt ""
-"example: ID abc123xy, 1024-bit RSA key, created Jan 12 2009, revoked"
-msgid "ID %1, %2-bit %3 key, created %4, revoked"
-msgstr ""
-
-#: model/kgpgsearchresultmodel.cpp:222
-#, kde-format
-msgctxt "example: ID abc123xy, 1024-bit RSA key, created Jan 12 2009"
-msgid "ID %1, %2-bit %3 key, created %4"
-msgstr ""
-
-#: model/kgpgsearchresultmodel.cpp:218
-#, kde-format
-msgid "One Photo ID"
-msgid_plural "%1 Photo IDs"
-msgstr[0] ""
-msgstr[1] ""
-
-#: transactions/kgpgaddphoto.cpp:41
-msgid "This image is very large. Use it anyway?"
-msgstr "هذه الصورة كبيرة جدا. أترغب فى استخدامها على أى حال؟"
-
-#: transactions/kgpgaddphoto.cpp:41
-msgid "Use Anyway"
-msgstr "استخدم على أى حال"
-
-#: transactions/kgpgaddphoto.cpp:41
-msgid "Do Not Use"
-msgstr "لا تستخدم"
-
-#: transactions/kgpgchangepass.cpp:68
-#, kde-format
-msgid "Enter old passphrase for <b>%1</b>"
-msgstr "أدخل عبارة مرور القديمة لـ <b>%1</b>"
-
-#: transactions/kgpgchangepass.cpp:71
-#, kde-format
-msgid ""
-"<qt>Enter new passphrase for <b>%1</b><br />If you forget this passphrase "
-"all your encrypted files and messages will be inaccessible.</qt>"
-msgstr ""
-
-#: transactions/kgpgdecrypt.cpp:86
-#, kde-format
-msgctxt "Status message 'Decrypting <filename>' (operation starts)"
-msgid "Decrypting %1"
-msgstr ""
-
-#: transactions/kgpgdecrypt.cpp:89
-#, kde-format
-msgctxt "Status message 'Decrypted <filename>' (operation was completed)"
-msgid "Decrypted %1"
-msgstr ""
-
-#: transactions/kgpggeneratekey.cpp:58
-#, kde-format
-msgid "Generating New Key for %1"
-msgstr ""
-
-#: transactions/kgpggeneratekey.cpp:94
-#, kde-format
-msgid ""
-"<p><b>Enter passphrase for %1 &lt;%2&gt;</b>:<br />Passphrase should include "
-"non alphanumeric characters and random sequences.</p>"
-msgstr ""
-
-#: transactions/kgpggeneratekey.cpp:96
-#, kde-format
-msgid ""
-"<p><b>Enter passphrase for %1</b>:<br />Passphrase should include non "
-"alphanumeric characters and random sequences.</p>"
-msgstr ""
-
-#: transactions/kgpggeneratekey.cpp:110
-msgid "Generating Key"
-msgstr "يولد المفتاح"
-
-#: transactions/kgpggeneratekey.cpp:122
-msgid "Generating prime numbers"
-msgstr "يولد المفاتيح الأولية"
-
-#: transactions/kgpggeneratekey.cpp:124
-msgid "Generating DSA key"
-msgstr "يولد مفتاح DSA"
-
-#: transactions/kgpggeneratekey.cpp:126
-msgid "Generating ElGamal key"
-msgstr "يولد مفتاح ElGamal"
-
-#: transactions/kgpggeneratekey.cpp:128
-msgid "Waiting for entropy"
-msgstr ""
-
-#: transactions/kgpggeneratekey.cpp:133
-msgid ""
-"The entropy pool ran empty. The key generation process is stalled until "
-"enough entropy is present. You can generate entropy e.g. by moving the mouse "
-"or typing at the keyboard. The easiest way is by using another application "
-"until the key generation continues."
-msgstr ""
-
-#: transactions/kgpggeneratekey.cpp:159
-#, kde-format
-msgid "Key %1 generated"
-msgstr "ولد مفتاح %1"
-
-#: transactions/kgpggeneraterevoke.cpp:49
-#, kde-format
-msgid "Generating Revocation Certificate for key %1"
-msgstr ""
-
-#: transactions/kgpgimport.cpp:125
-#, kde-format
-msgid ""
-"The import result string has an unsupported format in line %1.<br />Please "
-"see the detailed log for more information."
-msgstr ""
-
-#: transactions/kgpgimport.cpp:241
-msgid ""
-"No key imported.<br />Please see the detailed log for more information."
-msgstr ""
-
-#: transactions/kgpgimport.cpp:206
-#, kde-format
-msgid "<qt>%1 key processed.</qt>"
-msgid_plural "<qt>%1 keys processed.</qt>"
-msgstr[0] "<qt>لا يوجد مفاتيح معالجة</qt>"
-msgstr[1] "<qt>مفتاح واحد معالج</qt>"
-msgstr[2] "<qt>مفتاحان معالجان</qt>"
-msgstr[3] "<qt>%1 مفاتيح معالجة</qt>"
-msgstr[4] "<qt>%1 مفتاحا معالجا</qt>"
-msgstr[5] "<qt>%1 مفتاح معالج</qt>"
-
-#: transactions/kgpgimport.cpp:209
-#, kde-format
-msgid "<qt><br />One key without ID.</qt>"
-msgid_plural "<qt><br />%1 keys without ID.</qt>"
-msgstr[0] ""
-msgstr[1] ""
-
-#: transactions/kgpgimport.cpp:211
-#, kde-format
-msgid "<qt><br /><b>One key imported:</b></qt>"
-msgid_plural "<qt><br /><b>%1 keys imported:</b></qt>"
-msgstr[0] ""
-msgstr[1] ""
-
-#: transactions/kgpgimport.cpp:213
-#, kde-format
-msgid "<qt><br />One RSA key imported.</qt>"
-msgid_plural "<qt><br />%1 RSA keys imported.</qt>"
-msgstr[0] ""
-msgstr[1] ""
-
-#: transactions/kgpgimport.cpp:215
-#, kde-format
-msgid "<qt><br />One key unchanged.</qt>"
-msgid_plural "<qt><br />%1 keys unchanged.</qt>"
-msgstr[0] ""
-msgstr[1] ""
-
-#: transactions/kgpgimport.cpp:217
-#, kde-format
-msgid "<qt><br />One user ID imported.</qt>"
-msgid_plural "<qt><br />%1 user IDs imported.</qt>"
-msgstr[0] ""
-msgstr[1] ""
-
-#: transactions/kgpgimport.cpp:219
-#, kde-format
-msgid "<qt><br />One subkey imported.</qt>"
-msgid_plural "<qt><br />%1 subkeys imported.</qt>"
-msgstr[0] ""
-msgstr[1] ""
-
-#: transactions/kgpgimport.cpp:221
-#, kde-format
-msgid "<qt><br />One signature imported.</qt>"
-msgid_plural "<qt><br />%1 signatures imported.</qt>"
-msgstr[0] ""
-msgstr[1] ""
-
-#: transactions/kgpgimport.cpp:223
-#, kde-format
-msgid "<qt><br />One revocation certificate imported.</qt>"
-msgid_plural "<qt><br />%1 revocation certificates imported.</qt>"
-msgstr[0] ""
-msgstr[1] ""
-
-#: transactions/kgpgimport.cpp:225
-#, kde-format
-msgid "<qt><br />One secret key processed.</qt>"
-msgid_plural "<qt><br />%1 secret keys processed.</qt>"
-msgstr[0] ""
-msgstr[1] ""
-
-#: transactions/kgpgimport.cpp:227
-#, kde-format
-msgid "<qt><br /><b>One secret key imported.</b></qt>"
-msgid_plural "<qt><br /><b>%1 secret keys imported.</b></qt>"
-msgstr[0] ""
-msgstr[1] ""
-
-#: transactions/kgpgimport.cpp:229
-#, kde-format
-msgid "<qt><br />One secret key unchanged.</qt>"
-msgid_plural "<qt><br />%1 secret keys unchanged.</qt>"
-msgstr[0] ""
-msgstr[1] ""
-
-#: transactions/kgpgimport.cpp:231
-#, kde-format
-msgid "<qt><br />One secret key not imported.</qt>"
-msgid_plural "<qt><br />%1 secret keys not imported.</qt>"
-msgstr[0] ""
-msgstr[1] ""
-
-#: transactions/kgpgimport.cpp:234
-msgid ""
-"<qt><br /><b>You have imported a secret key.</b> <br />Please note that "
-"imported secret keys are not trusted by default.<br />To fully use this "
-"secret key for signing and encryption, you must edit the key (double click "
-"on it) and set its trust to Full or Ultimate.</qt>"
-msgstr ""
-"<qt> <br /><b>لقد قمت باستيراد مفتاح سرى.</b> <br />من فضلك لا حظ أن "
-"المفاتيح السرية المستوردة لا تكون موثوقة افتراضيا.  <br />لكى تستخدم هذا "
-"المفتاح السرى بشكل كامل فى التوقيع والتشفير، يجب عليك تحرير المفتاح (انقر "
-"عليه مرتين) واضبط موثوقيته الى كامل أو لا نهائى.</qt>"
-
-#: transactions/kgpgimport.cpp:278
-msgid "New Key"
-msgid_plural "New Keys"
-msgstr[0] ""
-msgstr[1] ""
-
-#: transactions/kgpgimport.cpp:281
-msgid "Key with new User Id"
-msgid_plural "Keys with new User Ids"
-msgstr[0] ""
-msgstr[1] ""
-
-#: transactions/kgpgimport.cpp:284
-msgid "Key with new Signatures"
-msgid_plural "Keys with new Signatures"
-msgstr[0] ""
-msgstr[1] ""
-
-#: transactions/kgpgimport.cpp:287
-msgid "Key with new Subkeys"
-msgid_plural "Keys with new Subkeys"
-msgstr[0] ""
-msgstr[1] "مفتاح واحد بمفاتيح فرعية جديدة"
-msgstr[2] "مفتاحان بمفاتيح فرعية جديدة"
-msgstr[3] "مفاتيح بمفاتيح فرعية جديدة"
-msgstr[4] "مفتاحا بمفاتيح فرعية جديدة"
-msgstr[5] "مفتاح بمفاتيح فرعية جديدة"
-
-#: transactions/kgpgimport.cpp:290
-msgid "New Private Key"
-msgid_plural "New Private Keys"
-msgstr[0] ""
-msgstr[1] "مفتاح واحد خاص جديد"
-msgstr[2] "مفتاحان خاصان جديدان"
-msgstr[3] "مفاتيح خاصة جديدة"
-msgstr[4] "مفتاحا خاصا جديدا"
-msgstr[5] "مفتاح خاص جديد"
-
-#: transactions/kgpgimport.cpp:307
-msgid "Unchanged Key"
-msgid_plural "Unchanged Keys"
-msgstr[0] ""
-msgstr[1] "مفتاح واحد بدون تغيير"
-msgstr[2] "مفتاحان بدون تغيير"
-msgstr[3] "مفاتيح بدون تغيير"
-msgstr[4] "مفتاحا بدون تغيير"
-msgstr[5] "مفتاح بدون تغيير"
-
-#: transactions/kgpgkeyservertransaction.cpp:93
-msgid "Keyserver"
-msgstr "خادم المفاتيح"
-
-#: transactions/kgpgkeyservertransaction.cpp:93
-msgid "<b>Connecting to the server...</b>"
-msgstr "<b> يتصل بالخادم...</b>"
-
-#: transactions/kgpgtransaction.cpp:128
-msgid "Requesting Passphrase"
-msgstr "يطلب عبارة المرور"
-
-#: transactions/kgpgtransactionjob.cpp:39
-msgctxt "Job is started up"
-msgid "Startup"
-msgstr "بدء التشغيل"
-
-#: transactions/kgpgtransactionjob.cpp:65
-msgctxt "State of operation as in status"
-msgid "State"
-msgstr "الحالة"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kgreet_classic.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kgreet_classic.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kgreet_classic.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kgreet_classic.po	2012-03-23 06:42:03.000000000 +0000
@@ -15,10 +15,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:58+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:06+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kgreet_classic.cpp:93
 msgid "&Username:"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kgreet_generic.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kgreet_generic.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kgreet_generic.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kgreet_generic.po	2012-03-23 06:42:03.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:59+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:07+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kgreet_generic.cpp:350
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kgreet_winbind.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kgreet_winbind.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kgreet_winbind.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kgreet_winbind.po	2012-03-23 06:42:03.000000000 +0000
@@ -15,10 +15,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:59+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:07+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kgreet_winbind.cpp:126
 msgid "&Domain:"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/khangman.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/khangman.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/khangman.po	2012-02-23 06:20:34.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/khangman.po	2012-03-23 06:42:07.000000000 +0000
@@ -11,7 +11,7 @@
 "Project-Id-Version: khangman\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-10 03:38+0000\n"
-"PO-Revision-Date: 2012-01-25 11:07+0000\n"
+"PO-Revision-Date: 2012-03-12 23:09+0000\n"
 "Last-Translator: Tariq AlWarhi <Unknown>\n"
 "Language-Team: American English <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
@@ -19,8 +19,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:28+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:59+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: data.i18n:2
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/khelpcenter.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/khelpcenter.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/khelpcenter.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/khelpcenter.po	2012-03-23 06:41:57.000000000 +0000
@@ -10,22 +10,21 @@
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
 # Abdalrahim G. Fakhouri <abdilra7eem@yahoo.com>, 2011.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: khelpcenter\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:44+0000\n"
+"PO-Revision-Date: 2012-03-12 22:38+0000\n"
 "Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:52+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:53+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: application.cpp:57 navigator.cpp:447
 msgid "KDE Help Center"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/khotkeys.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/khotkeys.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/khotkeys.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/khotkeys.po	2012-03-23 06:42:03.000000000 +0000
@@ -16,14 +16,14 @@
 "Project-Id-Version: khotkeys\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:14+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-14 17:04+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:01+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:08+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: rc.cpp:1 rc.cpp:1
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/khotnewstuff.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/khotnewstuff.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/khotnewstuff.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/khotnewstuff.po	2012-03-23 06:41:57.000000000 +0000
@@ -6,19 +6,20 @@
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # Abdulaziz AlSharif <a.a-a.s@hotmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: khotnewstuff\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2009-01-07 08:57+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-12 22:38+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:53+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:53+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: khotnewstuff.cpp:33 khotnewstuff_upload.cpp:33
@@ -31,18 +32,21 @@
 
 #: khotnewstuff_upload.cpp:40
 msgid "Name of .knsrc file to use"
-msgstr ""
+msgstr "اسم ملف .knsrc الذي سيستخدم"
 
 #: khotnewstuff_upload.cpp:41
 msgid "Name of file to upload"
-msgstr ""
+msgstr "اسم الملف الذي سيرفع"
 
 #: rc.cpp:1
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
-msgstr "majed316,زايد السعيدي, ,Launchpad Contributions:,Youssef Chahibi"
+msgstr ""
+"majed316,زايد السعيدي, عبدالرحيم الفاخوري, ,Launchpad "
+"Contributions:,Abdalrahim G. Fakhouri,Youssef Chahibi"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "GMajedli@gmail.com,zayed.alsaidi@gmail.com,,,"
+msgstr ""
+"GMajedli@gmail.com,zayed.alsaidi@gmail.com, abdilra7eem@yahoo.com,,,,"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/khtmlkttsd.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/khtmlkttsd.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/khtmlkttsd.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/khtmlkttsd.po	2012-03-23 06:42:00.000000000 +0000
@@ -9,16 +9,15 @@
 "Project-Id-Version: khtmlkttsd\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2012-01-25 11:01+0000\n"
+"PO-Revision-Date: 2012-03-12 22:31+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:46+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:23+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: khtmlkttsd.cpp:51
 msgid "&Speak Text"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/khtmlsettingsplugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/khtmlsettingsplugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/khtmlsettingsplugin.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/khtmlsettingsplugin.po	2012-03-23 06:42:00.000000000 +0000
@@ -6,20 +6,21 @@
 # Isam Bayazidi <bayazidi@arabeyes.org>, 2002.
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: khtmlsettingsplugin\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2009-07-10 17:31+0000\n"
+"PO-Revision-Date: 2012-03-12 22:31+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:46+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:23+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: rc.cpp:1
 msgctxt "NAME OF TRANSLATORS"
@@ -98,9 +99,9 @@
 #: settingsplugin.cpp:187
 msgid ""
 "Cookies could not be enabled, because the cookie daemon could not be started."
-msgstr ""
+msgstr "لم استطع تفعيل الكعك ؛ بسبب أن رقيب الكعك لا يمكن أن يبدأ."
 
 #: settingsplugin.cpp:189
 msgctxt "@title:window"
 msgid "Cookies Disabled"
-msgstr ""
+msgstr "الكعكات معطلة"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kiconfinder.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kiconfinder.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kiconfinder.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kiconfinder.po	2012-03-23 06:41:57.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:54+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:53+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kiconfinder.cpp:29
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kig.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kig.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kig.po	2012-02-23 06:20:34.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kig.po	2012-03-23 06:42:05.000000000 +0000
@@ -6,7 +6,7 @@
 "Project-Id-Version: kig\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-10 03:45+0000\n"
-"PO-Revision-Date: 2012-01-25 08:03+0000\n"
+"PO-Revision-Date: 2012-03-12 22:07+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
@@ -14,8 +14,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:31+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 01:01+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #. i18n: file: tips:2
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kimagemapeditor.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kimagemapeditor.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kimagemapeditor.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kimagemapeditor.po	2012-03-23 06:41:43.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:18+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:35+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kimeshell.cpp:179
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kinetd.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kinetd.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kinetd.po	2012-02-23 06:20:09.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kinetd.po	2012-03-23 06:41:40.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:11+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:01+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kinetd.cpp:253
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kinfocenter.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kinfocenter.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kinfocenter.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kinfocenter.po	2012-03-23 06:42:03.000000000 +0000
@@ -14,14 +14,14 @@
 "Project-Id-Version: kinfocenter\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:14+0000\n"
+"PO-Revision-Date: 2012-03-12 22:23+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:02+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:08+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: infocenter.cpp:57
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio4.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio4.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio4.po	2012-02-23 06:20:16.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio4.po	2012-03-23 06:41:47.000000000 +0000
@@ -19,7 +19,7 @@
 "Project-Id-Version: kio4\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 13:46+0000\n"
-"PO-Revision-Date: 2012-01-25 11:07+0000\n"
+"PO-Revision-Date: 2012-03-12 23:04+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
@@ -27,8 +27,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 22:52+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:12+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kssl/ksslcertificate.cpp:204
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_akonadi.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_akonadi.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_akonadi.po	2012-02-23 06:20:23.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_akonadi.po	2012-03-23 06:41:54.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 01:34+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:56+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: akonadislave.cpp:44
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_applications.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_applications.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_applications.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_applications.po	2012-03-23 06:41:57.000000000 +0000
@@ -17,10 +17,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:54+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:54+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kio_applications.cpp:119
 msgid "Applications"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_archive.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_archive.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_archive.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_archive.po	2012-03-23 06:41:57.000000000 +0000
@@ -13,10 +13,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:56+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:54+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
-"X-Poedit-Language: Arabic\n"
 
 #: kio_archive.cpp:241 kio_archive.cpp:337 kio_archive.cpp:411
 #, kde-format
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_audiocd.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_audiocd.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_audiocd.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_audiocd.po	2012-03-23 06:41:40.000000000 +0000
@@ -12,14 +12,14 @@
 "Project-Id-Version: kio_audiocd\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:45+0000\n"
-"PO-Revision-Date: 2011-12-12 19:13+0000\n"
+"PO-Revision-Date: 2012-03-14 17:38+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:04+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:57+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: audiocd.cpp:65
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_bookmarks.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_bookmarks.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_bookmarks.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_bookmarks.po	2012-03-23 06:41:57.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:56+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:54+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kio_bookmarks.cpp:89
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kioclient.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kioclient.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kioclient.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kioclient.po	2012-03-23 06:41:58.000000000 +0000
@@ -17,9 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:07+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:00+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kioclient.cpp:43
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kioexec.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kioexec.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kioexec.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kioexec.po	2012-03-23 06:41:58.000000000 +0000
@@ -11,16 +11,15 @@
 "Project-Id-Version: kioexec\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-26 23:24+0000\n"
+"PO-Revision-Date: 2012-03-14 10:48+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:07+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:01+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: main.cpp:44
 msgid "KIO Exec - Opens remote files, watches modifications, asks for upload"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_finger.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_finger.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_finger.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_finger.po	2012-03-23 06:41:58.000000000 +0000
@@ -18,8 +18,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:57+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:55+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: kio_finger.cpp:153
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_fish.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_fish.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_fish.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_fish.po	2012-03-23 06:41:58.000000000 +0000
@@ -16,8 +16,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:57+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:56+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: fish.cpp:299
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_floppy.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_floppy.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_floppy.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_floppy.po	2012-03-23 06:41:58.000000000 +0000
@@ -17,10 +17,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:58+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:56+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
-"X-Poedit-Language: Arabic\n"
 
 #: kio_floppy.cpp:198
 #, kde-format
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_help4.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_help4.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_help4.po	2012-02-23 06:20:16.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_help4.po	2012-03-23 06:41:47.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 22:51+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:12+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: genshortcutents.cpp:339
 msgid "Output file"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_imap4.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_imap4.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_imap4.po	2012-02-23 06:20:16.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_imap4.po	2012-03-23 06:41:47.000000000 +0000
@@ -16,8 +16,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:01+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:17+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: imap4.cpp:615
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_info.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_info.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_info.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_info.po	2012-03-23 06:41:58.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:59+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:56+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: info.cc:37
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_jabberdisco.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_jabberdisco.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_jabberdisco.po	2012-02-23 06:20:09.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_jabberdisco.po	2012-03-23 06:41:40.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:11+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:01+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: jabberdisco.cpp:107 jabberdisco.cpp:208
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_ldap.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_ldap.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_ldap.po	2012-02-23 06:20:16.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_ldap.po	2012-03-23 06:41:47.000000000 +0000
@@ -13,10 +13,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:02+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:17+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
-"X-Poedit-Language: Arabic\n"
 
 #: kio_ldap.cpp:85
 msgid ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_man.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_man.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_man.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_man.po	2012-03-23 06:41:58.000000000 +0000
@@ -15,16 +15,15 @@
 "Project-Id-Version: kio_man\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2011-12-12 19:22+0000\n"
+"PO-Revision-Date: 2012-03-14 17:31+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:59+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:57+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kio_man.cpp:493
 #, kde-format
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_nepomuk.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_nepomuk.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_nepomuk.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_nepomuk.po	2012-03-23 06:41:58.000000000 +0000
@@ -7,15 +7,14 @@
 "Project-Id-Version: \n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 19:39+0000\n"
+"PO-Revision-Date: 2012-03-13 02:06+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:01+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:57+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kio_nepomuk.cpp:303
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_nepomuksearch.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_nepomuksearch.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_nepomuksearch.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_nepomuksearch.po	2012-03-23 06:41:58.000000000 +0000
@@ -1,25 +1,25 @@
-# SOME DESCRIPTIVE TITLE.
 # Copyright (C) YEAR This_file_is_part_of_KDE
 # This file is distributed under the same license as the PACKAGE package.
-# FIRST AUTHOR <EMAIL@ADDRESS>, YEAR.
 #
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kio_nepomuksearch\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:45+0000\n"
-"Last-Translator: Majed Ali <GMajedli@gmail.com>\n"
+"PO-Revision-Date: 2012-03-12 22:38+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:01+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:57+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: kio_nepomuksearch.cpp:71
 msgid "Query folder"
-msgstr ""
+msgstr "استعلم عن المجلّد"
 
 #: kio_nepomuksearch.cpp:125
 msgid ""
@@ -34,11 +34,11 @@
 
 #: kio_nepomuksearch.cpp:261
 msgid "Desktop Queries"
-msgstr ""
+msgstr "استعلامات سطح المكتب"
 
 #: kio_nepomuksearch.cpp:447
 msgid "Saved Query"
-msgstr ""
+msgstr "حُفِظَ الاستعلام"
 
 #: rc.cpp:1
 msgctxt "NAME OF TRANSLATORS"
@@ -53,4 +53,4 @@
 #: searchfolder.cpp:291
 #, kde-format
 msgid "Search excerpt: %1"
-msgstr ""
+msgstr "بحث في المقتَضَب: %1"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_nfs.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_nfs.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_nfs.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_nfs.po	2012-03-23 06:41:58.000000000 +0000
@@ -16,10 +16,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:02+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:58+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
-"X-Poedit-Language: Arabic\n"
 
 #: kio_nfs.cpp:941
 msgid "An RPC error occurred."
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_nntp.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_nntp.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_nntp.po	2012-02-23 06:20:16.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_nntp.po	2012-03-23 06:41:47.000000000 +0000
@@ -16,10 +16,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:03+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:17+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
-"X-Poedit-Language: Arabic\n"
 
 #: nntp.cpp:124 nntp.cpp:490
 #, kde-format
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_pop3.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_pop3.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_pop3.po	2012-02-23 06:20:16.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_pop3.po	2012-03-23 06:41:47.000000000 +0000
@@ -17,10 +17,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:03+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:17+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
-"X-Poedit-Language: Arabic\n"
 
 #: pop3.cpp:228
 #, kde-format
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_remote.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_remote.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_remote.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_remote.po	2012-03-23 06:41:58.000000000 +0000
@@ -15,10 +15,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:02+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:58+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: remoteimpl.cpp:189
 msgid "Add Network Folder"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_sftp.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_sftp.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_sftp.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_sftp.po	2012-03-23 06:41:58.000000000 +0000
@@ -10,20 +10,20 @@
 # zayed <zayed.alsaidi@gmail.com>, 2008.
 # Ahmed M. Araby <egydev@fedoraproject.org>, 2012.
 # Abderrahim Kitouni <a.kitouni@gmail.com>, 2012.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kio_sftp\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:44+0000\n"
-"Last-Translator: Abderrahim Kitouni <a.kitouni@gmail.com>\n"
+"PO-Revision-Date: 2012-03-12 22:38+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:03+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:58+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kio_sftp.cpp:198 kio_sftp.cpp:202 kio_sftp.cpp:478 kio_sftp.cpp:685
@@ -36,7 +36,7 @@
 
 #: kio_sftp.cpp:403
 msgid "Could not allocate callbacks"
-msgstr ""
+msgstr "تعذّر تخصيص ردود النداء"
 
 #: kio_sftp.cpp:462
 #, kde-format
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_sieve.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_sieve.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_sieve.po	2012-02-23 06:20:16.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_sieve.po	2012-03-23 06:41:47.000000000 +0000
@@ -10,14 +10,14 @@
 "Project-Id-Version: kio_sieve\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 15:54+0000\n"
-"PO-Revision-Date: 2012-01-25 11:19+0000\n"
+"PO-Revision-Date: 2012-03-12 22:22+0000\n"
 "Last-Translator: Youssef Chahibi <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:04+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:18+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: sieve.cpp:328
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_smb.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_smb.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_smb.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_smb.po	2012-03-23 06:41:58.000000000 +0000
@@ -21,10 +21,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:04+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:59+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kio_smb_auth.cpp:141
 #, kde-format
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_smtp.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_smtp.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_smtp.po	2012-02-23 06:20:17.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_smtp.po	2012-03-23 06:41:47.000000000 +0000
@@ -19,10 +19,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:04+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:18+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
-"X-Poedit-Language: Arabic\n"
 
 #: command.cpp:135
 msgid ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_svn.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_svn.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_svn.po	2012-02-23 06:20:11.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_svn.po	2012-03-23 06:41:43.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:51+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:24+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: rc.cpp:1
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_thumbnail.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_thumbnail.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_thumbnail.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_thumbnail.po	2012-03-23 06:41:58.000000000 +0000
@@ -4,36 +4,38 @@
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kio_thumbnail\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2009-07-24 13:28+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
+"PO-Revision-Date: 2012-03-12 22:37+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:04+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Poedit-Language: Arabic\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:59+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: jpegcreator.cpp:293
 msgctxt "@option:check"
 msgid "Rotate the image automatically"
-msgstr ""
+msgstr "أدِر الصورة تلقائيًّا"
 
 #: rc.cpp:1
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
-msgstr "Mohamed SAAD محمد سعد, ,Launchpad Contributions:,Zayed Amer Al-Saidi"
+msgstr ""
+"Mohamed SAAD محمد سعد, عبدالرحيم الفاخوري, ,Launchpad "
+"Contributions:,Abdalrahim G. Fakhouri,Zayed Amer Al-Saidi"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "metehyi@free.fr,,,zayed.alsaidi@gmail.com"
+msgstr "metehyi@free.fr,abdilra7eem@yahoo.com,,,,zayed.alsaidi@gmail.com"
 
 #: thumbnail.cpp:123
 msgid "kio_thumbmail"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_timeline.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_timeline.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_timeline.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_timeline.po	2012-03-23 06:41:58.000000000 +0000
@@ -1,22 +1,23 @@
 # translation of nepomuk.po to Arabic
 # Copyright (C) YEAR This_file_is_part_of_KDE
 # This file is distributed under the same license as the PACKAGE package.
+#
 # zayed <zayed.alsaidi@gmail.com>, 2008, 2009.
 # Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-#
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: nepomuk\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-26 09:43+0000\n"
+"PO-Revision-Date: 2012-03-13 02:04+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:05+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:59+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kio_timeline.cpp:107
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_trash.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_trash.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_trash.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_trash.po	2012-03-23 06:41:58.000000000 +0000
@@ -18,8 +18,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:06+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:00+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: kio_trash_win.cpp:228 kio_trash.cpp:140
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_videodvd.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_videodvd.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_videodvd.po	2012-02-23 06:20:06.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_videodvd.po	2012-03-23 06:41:37.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:26+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:37+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: videodvd.cpp:162 videodvd.cpp:291
 msgid "No Video DVD found"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_zeroconf.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_zeroconf.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kio_zeroconf.po	2012-02-23 06:20:09.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kio_zeroconf.po	2012-03-23 06:41:40.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:12+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:01+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: dnssd.cpp:53
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kiriki.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kiriki.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kiriki.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kiriki.po	2012-03-23 06:41:38.000000000 +0000
@@ -8,7 +8,7 @@
 "Project-Id-Version: kiriki\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:39+0000\n"
-"PO-Revision-Date: 2012-01-25 11:46+0000\n"
+"PO-Revision-Date: 2012-03-12 22:56+0000\n"
 "Last-Translator: Youssef Chahibi <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
@@ -16,8 +16,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:47+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:49+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kiriki.cpp:167
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kjots.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kjots.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kjots.po	2012-02-23 06:20:10.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kjots.po	2012-03-23 06:41:41.000000000 +0000
@@ -11,7 +11,7 @@
 "Project-Id-Version: kjots\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 03:45+0000\n"
-"PO-Revision-Date: 2012-01-25 11:33+0000\n"
+"PO-Revision-Date: 2012-03-12 22:47+0000\n"
 "Last-Translator: Youssef Chahibi <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
@@ -19,8 +19,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:26+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:10+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: aboutdata.cpp:32
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kjumpingcube.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kjumpingcube.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kjumpingcube.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kjumpingcube.po	2012-03-23 06:41:38.000000000 +0000
@@ -8,14 +8,14 @@
 "Project-Id-Version: kjumpingcube\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:39+0000\n"
-"PO-Revision-Date: 2012-01-25 07:28+0000\n"
+"PO-Revision-Date: 2012-03-12 21:57+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:47+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:49+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kjumpingcube.cpp:78
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kleopatra.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kleopatra.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kleopatra.po	2012-02-23 06:20:10.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kleopatra.po	2012-03-23 06:41:41.000000000 +0000
@@ -8,7 +8,7 @@
 "Project-Id-Version: kleopatra\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 03:45+0000\n"
-"PO-Revision-Date: 2011-12-12 18:32+0000\n"
+"PO-Revision-Date: 2012-03-14 17:42+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
@@ -16,8 +16,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:27+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:10+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: models/keylistmodel.cpp:250 models/useridlistmodel.cpp:249
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/klettres.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/klettres.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/klettres.po	2012-02-23 06:20:34.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/klettres.po	2012-03-23 06:42:07.000000000 +0000
@@ -16,8 +16,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:34+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 01:03+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: klettres.cpp:108
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/klickety.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/klickety.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/klickety.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/klickety.po	2012-03-23 06:41:38.000000000 +0000
@@ -16,8 +16,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:47+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:49+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: gamescene.cpp:235
 msgid "paused"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/klines.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/klines.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/klines.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/klines.po	2012-03-23 06:41:39.000000000 +0000
@@ -8,14 +8,14 @@
 "Project-Id-Version: klines\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:39+0000\n"
-"PO-Revision-Date: 2012-01-25 11:45+0000\n"
+"PO-Revision-Date: 2012-03-12 22:57+0000\n"
 "Last-Translator: Youssef Chahibi <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:48+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:49+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: klines.cpp:51
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/klinkstatus.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/klinkstatus.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/klinkstatus.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/klinkstatus.po	2012-03-23 06:41:43.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:19+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:36+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: klinkstatus_part.cpp:52
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/klipper.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/klipper.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/klipper.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/klipper.po	2012-03-23 06:42:03.000000000 +0000
@@ -15,16 +15,16 @@
 "Project-Id-Version: klipper\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:13+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-14 17:06+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:02+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:09+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: configdialog.cpp:39
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/klock.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/klock.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/klock.po	2012-02-23 06:20:06.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/klock.po	2012-03-23 06:41:38.000000000 +0000
@@ -11,7 +11,7 @@
 "Project-Id-Version: klock\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 15:58+0000\n"
-"PO-Revision-Date: 2011-12-12 17:43+0000\n"
+"PO-Revision-Date: 2012-03-14 18:00+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
@@ -19,8 +19,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:35+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:42+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kdesavers/Euphoria.cpp:901
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmag.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmag.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmag.po	2012-02-23 06:20:06.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmag.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,488 +0,0 @@
-# translation of kmag.po to
-# Copyright (C) 2003, 2006, 2007 Free Software Foundation, Inc.
-#
-# Hafid BENHADRIA <ghosn@php4arab.info>, 2003.
-# محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
-# Youssef Chahibi <chahibi@gmail.com>, 2007.
-msgid ""
-msgstr ""
-"Project-Id-Version: kmag\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 04:10+0000\n"
-"PO-Revision-Date: 2011-12-12 17:46+0000\n"
-"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: <en@li.org>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:29+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"Language: \n"
-
-#: kmag.cpp:86
-msgctxt "Zoom at very low"
-msgid "&Very Low"
-msgstr ""
-
-#: kmag.cpp:86
-msgctxt "Zoom at low"
-msgid "&Low"
-msgstr ""
-
-#: kmag.cpp:86
-msgctxt "Zoom at medium"
-msgid "&Medium"
-msgstr ""
-
-#: kmag.cpp:86
-msgctxt "Zoom at high"
-msgid "&High"
-msgstr ""
-
-#: kmag.cpp:86
-msgctxt "Zoom at very high"
-msgid "V&ery High"
-msgstr ""
-
-#: kmag.cpp:94
-msgctxt "No color-blindness simulation, i.e. 'normal' vision"
-msgid "&Normal"
-msgstr ""
-
-#: kmag.cpp:94
-msgid "&Protanopia"
-msgstr ""
-
-#: kmag.cpp:94
-msgid "&Deuteranopia"
-msgstr ""
-
-#: kmag.cpp:94
-msgid "&Tritanopia"
-msgstr ""
-
-#: kmag.cpp:94
-msgid "&Achromatopsia"
-msgstr ""
-
-#: kmag.cpp:102
-msgid "&No Rotation (0 Degrees)"
-msgstr ""
-
-#: kmag.cpp:102
-msgid "&Left (90 Degrees)"
-msgstr ""
-
-#: kmag.cpp:102
-msgid "&Upside Down (180 Degrees)"
-msgstr ""
-
-#: kmag.cpp:102
-msgid "&Right (270 Degrees)"
-msgstr ""
-
-#: kmag.cpp:138
-msgid "New &Window"
-msgstr "&نافذة جديدة"
-
-#: kmag.cpp:141
-msgid "Open a new KMagnifier window"
-msgstr "إفتح نافذة عدسة تكبير جديدة"
-
-#: kmag.cpp:145
-msgid "&Stop"
-msgstr "&قف"
-
-#: kmag.cpp:148
-msgid "Click to stop window refresh"
-msgstr "آنقر لإيقاف إنعاش النَّافذة"
-
-#: kmag.cpp:149
-msgid ""
-"Clicking on this icon will <b>start</b> / <b>stop</b>  updating of the "
-"display. Stopping the update will zero the processing power  required (CPU "
-"usage)"
-msgstr ""
-"النَّقر على هذه الإيقونة سيؤدي إلى <b>بدء</b> / <b>إيقاف</b>  تحديث العرض. "
-"إنّ إيقاف التّحديث سيلغي مجمل طاقة المعالجة المطلوبة (إستخدام وحدة المعالجة "
-"المركزيّة - CPU)"
-
-#: kmag.cpp:155
-msgid "&Save Snapshot As..."
-msgstr "&إحفظ لَقطة الشاشة كـ..."
-
-#: kmag.cpp:158
-msgid "Saves the zoomed view to an image file."
-msgstr "يحفظ المندقة المكبّرة في ملف صورة."
-
-#: kmag.cpp:159
-msgid "Save image to a file"
-msgstr "إحفظ الصّورة في ملف"
-
-#: kmag.cpp:162
-msgid "Click on this button to print the current zoomed view."
-msgstr "آنقر على هذا الزُّر لطباعة الرُّؤية المُكبّرة الحاليّة."
-
-#: kmag.cpp:165 kmag.cpp:166
-msgid "Quits the application"
-msgstr "ينهي التَّطبيق"
-
-#: kmag.cpp:169
-msgid ""
-"Click on this button to copy the current zoomed view to the clipboard which "
-"you can paste in other applications."
-msgstr ""
-"أنقر على هذا الزرّ لنسخ الرؤية المكبرة حالياً إلى الحافظة كي تستطيع إلصاقها "
-"في تطبيقات أخرى."
-
-#: kmag.cpp:170
-msgid "Copy zoomed image to clipboard"
-msgstr "أنسخ الصُّورة المُكبّرة إلى الحافظة"
-
-#: kmag.cpp:176
-msgid "&Follow Mouse Mode"
-msgstr "&إتبع الفأرة"
-
-#: kmag.cpp:180
-msgid "Mouse"
-msgstr ""
-
-#: kmag.cpp:181
-msgid "Magnify around the mouse cursor"
-msgstr ""
-
-#: kmag.cpp:182
-msgid "If selected, the area around the mouse cursor is magnified"
-msgstr ""
-
-#: kmag.cpp:184
-msgid "&Follow Focus Mode"
-msgstr ""
-
-#: kmag.cpp:188
-msgid "Focus"
-msgstr ""
-
-#: kmag.cpp:189
-msgid "Magnify around the keyboard focus"
-msgstr ""
-
-#: kmag.cpp:190
-msgid "If selected, the area around the keyboard cursor is magnified"
-msgstr ""
-
-#: kmag.cpp:192
-msgid "Se&lection Window Mode"
-msgstr ""
-
-#: kmag.cpp:196
-msgid "Window"
-msgstr ""
-
-#: kmag.cpp:197
-msgid "Show a window for selecting the magnified area"
-msgstr ""
-
-#: kmag.cpp:199
-msgid "&Whole Screen Mode"
-msgstr ""
-
-#: kmag.cpp:203
-msgid "Screen"
-msgstr ""
-
-#: kmag.cpp:204
-msgid "Magnify the whole screen"
-msgstr ""
-
-#: kmag.cpp:205
-msgid "Click on this button to fit the zoom view to the zoom window."
-msgstr ""
-
-#: kmag.cpp:207
-msgid "Hide Mouse &Cursor"
-msgstr "إخفاء &مؤشر الفأرة"
-
-#: kmag.cpp:212
-msgid "Show Mouse &Cursor"
-msgstr "إظهار &مؤشر الفأرة"
-
-#: kmag.cpp:214
-msgid "Hide"
-msgstr ""
-
-#: kmag.cpp:215
-msgid "Hide the mouse cursor"
-msgstr "إخفاء مؤشر الفأرة"
-
-#: kmag.cpp:217
-msgid "Stays On Top"
-msgstr ""
-
-#: kmag.cpp:221
-msgid "The KMagnifier Window stays on top of other windows."
-msgstr ""
-
-#: kmag.cpp:224
-msgid "Click on this button to <b>zoom-in</b> on the selected region."
-msgstr "آنقر على هذا الزُّر كي <b> تكبّر </b> المنطقة المحددة."
-
-#: kmag.cpp:226
-msgid "&Zoom"
-msgstr ""
-
-#: kmag.cpp:229
-msgid "Select the zoom factor."
-msgstr "إختر معامل التَّكبير."
-
-#: kmag.cpp:230
-msgid "Zoom factor"
-msgstr "معامل التَّكبير"
-
-#: kmag.cpp:233
-msgid "Click on this button to <b>zoom-out</b> on the selected region."
-msgstr "آنقر على هذا الزُّر كي <b>تصغّر </b> المنطقة المحددة."
-
-#: kmag.cpp:235
-msgid "&Rotation"
-msgstr "ال&دوران"
-
-#: kmag.cpp:238
-msgid "Select the rotation degree."
-msgstr "إختر درجة الدوران."
-
-#: kmag.cpp:239
-msgid "Rotation degree"
-msgstr "درجة الدوران"
-
-#: kmag.cpp:246
-msgid "&Refresh"
-msgstr ""
-
-#: kmag.cpp:249
-msgid ""
-"Select the refresh rate. The higher the rate, the more computing power (CPU) "
-"will be needed."
-msgstr ""
-"إختر مُعدَّل التحديث. كلما زاد المُعدَّل ، كلما إزدادت الطَّاقة الحاسوبيّة "
-"(وحدة المعالجة المركزيّة - CPU) المحتاجة."
-
-#: kmag.cpp:250
-msgid "Refresh rate"
-msgstr "مُعدَّل التحديث"
-
-#: kmag.cpp:252
-msgctxt "Color-blindness simulation mode"
-msgid "&Color"
-msgstr ""
-
-#: kmag.cpp:255
-msgid "Select a mode to simulate various types of color-blindness."
-msgstr ""
-
-#: kmag.cpp:256
-msgid "Color-blindness Simulation Mode"
-msgstr ""
-
-#: kmag.cpp:583
-msgid "Save Snapshot As"
-msgstr "إ&حفظ لَّقطة الشاشة كـ"
-
-#: kmag.cpp:593
-msgid ""
-"Unable to save temporary file (before uploading to the network file you "
-"specified)."
-msgstr ""
-"تعذر حفظ الملف المؤقت (قبل تصعيد الملف إلى ملف الشَّبكة الذي حدَّدته)."
-
-#: kmag.cpp:594 kmag.cpp:598 kmag.cpp:611
-msgid "Error Writing File"
-msgstr "خطأ عند كتابة الملف"
-
-#: kmag.cpp:597
-msgid "Unable to upload file over the network."
-msgstr "غير قادر على رفع الملف عبر الشَّبكة."
-
-#: kmag.cpp:600 kmag.cpp:613
-#, kde-format
-msgid ""
-"Current zoomed image saved to\n"
-"%1"
-msgstr ""
-"تم حفظ الصُّورة المُكبّرة َة الحاليّة إلى\n"
-"%1"
-
-#: kmag.cpp:601 kmag.cpp:614
-msgid "Information"
-msgstr ""
-
-#: kmag.cpp:610
-msgid ""
-"Unable to save file. Please check if you have permission to write to the "
-"directory."
-msgstr ""
-"تعذر حفظ الملف. الرجاءً تَفَقَّد إذا كان لديك أذن الكِتابة في المجلد."
-
-#: kmag.cpp:629
-msgid "Stop"
-msgstr ""
-
-#: kmag.cpp:630
-msgid "Click to stop window update"
-msgstr "أنقر لإيقاف تحديث النَّافذة"
-
-#: kmag.cpp:633
-msgctxt "Start updating the window"
-msgid "Start"
-msgstr ""
-
-#: kmag.cpp:634
-msgid "Click to start window update"
-msgstr "أنقر لبدء تحديث النَّافذة"
-
-#: kmagselrect.cpp:217
-msgid "Selection Window"
-msgstr "نافذة إختيار المنطقة"
-
-#: kmagselrect.cpp:217 main.cpp:39
-msgid "KMagnifier"
-msgstr "KMagnifier"
-
-#: kmagzoomview.cpp:132
-msgid ""
-"This is the main window which shows the contents of the selected region. The "
-"contents will be magnified according to the zoom level that is set."
-msgstr ""
-"هذه هي النَّافذة الرَّئيسيّة التِّي تُظْهِر مُحتويات المنطقة المُحددةَاة. سي "
-"مكبير يم المحتوينسبتً إلى حدّ التكبير المعيين.حجيم."
-
-#: main.cpp:40
-msgid "Screen magnifier for the K Desktop Environment (KDE)"
-msgstr "عدسة مكبرة للشَّاشة لدى محيط سطح مكتب K"
-
-#: main.cpp:42
-msgid ""
-"Copyright 2001-2003 Sarang Lakare\n"
-"Copyright 2003-2004 Olaf Schmidt\n"
-"Copyright 2008 Matthew Woehlke"
-msgstr ""
-
-#: main.cpp:46
-msgid "Sarang Lakare"
-msgstr ""
-
-#: main.cpp:47
-msgid "Rewrite"
-msgstr ""
-
-#: main.cpp:49
-msgid "Michael Forster"
-msgstr ""
-
-#: main.cpp:50
-msgid "Original idea and author (KDE1)"
-msgstr "الفكرة الأصلية والمؤلف  (KDE1)"
-
-#: main.cpp:51
-msgid "Olaf Schmidt"
-msgstr ""
-
-#: main.cpp:51
-msgid ""
-"Rework of the user interface, improved selection window, speed optimization, "
-"rotation, bug fixes"
-msgstr ""
-
-#: main.cpp:52
-msgid "Matthew Woehlke"
-msgstr ""
-
-#: main.cpp:52
-msgid "Color-blindness simulation"
-msgstr ""
-
-#: main.cpp:53
-msgid "Sebastian Sauer"
-msgstr ""
-
-#: main.cpp:53
-msgid "Focus tracking"
-msgstr ""
-
-#: main.cpp:54
-msgid "Claudiu Costin"
-msgstr ""
-
-#: main.cpp:54
-msgid "Some tips"
-msgstr "بعض التَّلميحات"
-
-#: main.cpp:59
-msgid "File to open"
-msgstr "الملف المبغي فتحه"
-
-#: rc.cpp:28
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr ""
-"Hafid BENHADRIA, Mohamed SAAD محمد سعد, ,Launchpad Contributions:,Hafid "
-"BENHADRIA"
-
-#: rc.cpp:29
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr "ghosn@php4arab.info,metehyi@free.fr,,,"
-
-#. i18n: file: kmagui.rc:3
-#. i18n: ectx: ToolBar (mainToolBar)
-#: rc.cpp:3 rc.cpp:32
-msgid "Main Toolbar"
-msgstr ""
-
-#. i18n: file: kmagui.rc:11
-#. i18n: ectx: ToolBar (viewToolBar)
-#: rc.cpp:6 rc.cpp:35
-msgid "View Toolbar"
-msgstr ""
-
-#. i18n: file: kmagui.rc:21
-#. i18n: ectx: ToolBar (settingsToolBar)
-#: rc.cpp:9 rc.cpp:38
-msgid "Settings Toolbar"
-msgstr ""
-
-#. i18n: file: kmagui.rc:31
-#. i18n: ectx: Menu (file)
-#: rc.cpp:12 rc.cpp:41
-msgid "&File"
-msgstr ""
-
-#. i18n: file: kmagui.rc:38
-#. i18n: ectx: Menu (edit)
-#: rc.cpp:15 rc.cpp:44
-msgid "&Edit"
-msgstr ""
-
-#. i18n: file: kmagui.rc:41
-#. i18n: ectx: Menu (view)
-#. i18n: file: kmagui.rc:78
-#. i18n: ectx: Menu (view)
-#. i18n: file: kmagui.rc:41
-#. i18n: ectx: Menu (view)
-#. i18n: file: kmagui.rc:78
-#. i18n: ectx: Menu (view)
-#: rc.cpp:18 rc.cpp:24 rc.cpp:47 rc.cpp:53
-msgid "&View"
-msgstr ""
-
-#. i18n: file: kmagui.rc:53
-#. i18n: ectx: Menu (settings)
-#. i18n: file: kmagui.rc:88
-#. i18n: ectx: Menu (settings)
-#. i18n: file: kmagui.rc:53
-#. i18n: ectx: Menu (settings)
-#. i18n: file: kmagui.rc:88
-#. i18n: ectx: Menu (settings)
-#: rc.cpp:21 rc.cpp:27 rc.cpp:50 rc.cpp:56
-msgid "&Settings"
-msgstr ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmahjongg.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmahjongg.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmahjongg.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmahjongg.po	2012-03-23 06:41:39.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:48+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:49+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: Editor.cpp:81
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmailcvt.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmailcvt.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmailcvt.po	2012-02-23 06:20:10.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmailcvt.po	2012-03-23 06:41:42.000000000 +0000
@@ -16,8 +16,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:30+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:13+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kmailcvt.cpp:39
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmail.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmail.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmail.po	2012-02-23 06:20:10.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmail.po	2012-03-23 06:41:42.000000000 +0000
@@ -19,8 +19,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:28+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:11+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: configagentdelegate.cpp:232
 msgid "Retrieval Options"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmenuedit.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmenuedit.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmenuedit.po	2012-02-23 06:20:30.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmenuedit.po	2012-03-23 06:42:03.000000000 +0000
@@ -16,14 +16,14 @@
 "Project-Id-Version: kmenuedit\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:16+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-14 17:16+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:03+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:09+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: basictab.cpp:81
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmimetypefinder.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmimetypefinder.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmimetypefinder.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmimetypefinder.po	2012-03-23 06:41:58.000000000 +0000
@@ -19,8 +19,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:08+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:01+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: kmimetypefinder.cpp:32
 msgid "MimeType Finder"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmines.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmines.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmines.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmines.po	2012-03-23 06:41:39.000000000 +0000
@@ -3,20 +3,21 @@
 #
 # Isam Bayazidi <bayazidi@arabeyes.org>, 2002.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kmines\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:39+0000\n"
-"PO-Revision-Date: 2012-01-25 07:27+0000\n"
-"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
+"PO-Revision-Date: 2012-03-12 22:56+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:49+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:50+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: \n"
 
 #: main.cpp:29
 msgid "KMines is a classic minesweeper game"
@@ -76,7 +77,7 @@
 
 #: main.cpp:47
 msgid "Brian Croom"
-msgstr ""
+msgstr "Brian Croom"
 
 #: main.cpp:47
 msgid "Port to use KGameRenderer"
@@ -120,13 +121,13 @@
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
 msgstr ""
-"Mohamed SAAD محمد سعد,زايد السعيدي, ,Launchpad Contributions:,Youssef "
-"Chahibi,abd el rahman Ghareeb"
+"Mohamed SAAD محمد سعد,زايد السعيدي, ,Launchpad Contributions:,Abdalrahim G. "
+"Fakhouri,Youssef Chahibi,abd el rahman Ghareeb"
 
 #: rc.cpp:35
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "metehyi@free.fr,zayed.alsaidi@gmail.com,,,,"
+msgstr "metehyi@free.fr,zayed.alsaidi@gmail.com,,,,,"
 
 #. i18n: file: kminesui.rc:12
 #. i18n: ectx: ToolBar (mainToolBar)
@@ -200,7 +201,7 @@
 
 #: scene.cpp:109
 msgid "Congratulations! You have won!"
-msgstr ""
+msgstr "تهانينا! لقد فزت!"
 
 #: scene.cpp:111
 msgid "You have lost."
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmix.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmix.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmix.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmix.po	2012-03-23 06:41:40.000000000 +0000
@@ -13,14 +13,14 @@
 "Project-Id-Version: kmix\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:45+0000\n"
-"PO-Revision-Date: 2011-12-12 19:13+0000\n"
+"PO-Revision-Date: 2012-03-14 17:37+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:05+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:57+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: apps/main.cpp:33
 msgid "KMix - KDE's full featured mini mixer"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmousetool.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmousetool.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmousetool.po	2012-02-23 06:20:06.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmousetool.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,221 +0,0 @@
-# translation of kmousetool.po to
-# Copyright (C) 2003, 2004, 2007 Free Software Foundation, Inc.
-#
-# Hafid BENHADRIA <ghosn@php4arab.info>, 2003.
-# Ahmad M. Zawawi <azawawi@emirates.net.ae>, 2004.
-# Youssef Chahibi <chahibi@gmail.com>, 2007.
-msgid ""
-msgstr ""
-"Project-Id-Version: kmousetool\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 04:10+0000\n"
-"PO-Revision-Date: 2011-12-12 17:47+0000\n"
-"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: <en@li.org>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:30+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"Language: \n"
-
-#: kmousetool.cpp:428
-msgid "The drag time must be less than or equal to the dwell time."
-msgstr "يجب على مدة السّحب أن يكون أقل أو مساويّاً لمدة النَّقرة."
-
-#: kmousetool.cpp:428
-msgid "Invalid Value"
-msgstr "قيمة غير صالحة"
-
-#: kmousetool.cpp:498 kmousetool.cpp:646
-msgid "&Stop"
-msgstr "&إيقاف"
-
-#: kmousetool.cpp:500 kmousetool.cpp:626 kmousetool.cpp:650
-msgctxt "Start tracking the mouse"
-msgid "&Start"
-msgstr ""
-
-#: kmousetool.cpp:569
-msgid ""
-"There are unsaved changes in the active module.\n"
-"Do you want to apply the changes before closing the configuration window or "
-"discard the changes?"
-msgstr ""
-
-#: kmousetool.cpp:570
-msgid "Closing Configuration Window"
-msgstr "جاري إغلاق نافذة الإعدادات"
-
-#: kmousetool.cpp:589
-msgid ""
-"There are unsaved changes in the active module.\n"
-"Do you want to apply the changes before quitting KMousetool or discard the "
-"changes?"
-msgstr ""
-
-#: kmousetool.cpp:590
-msgid "Quitting KMousetool"
-msgstr "جاري الخروج من KMouseTool"
-
-#: kmousetool.cpp:629
-msgid "&Configure KMouseTool..."
-msgstr "&تهيئة KMouseTool..."
-
-#: kmousetool.cpp:632
-msgid "KMousetool &Handbook"
-msgstr "&كُتيب KMouseTool"
-
-#: kmousetool.cpp:634
-msgid "&About KMouseTool"
-msgstr "&عن KMouseTool"
-
-#. i18n: file: kmousetoolui.ui:13
-#. i18n: ectx: property (windowTitle), widget (QWidget, KMouseToolUI)
-#: main.cpp:33 main.cpp:39 rc.cpp:3 rc.cpp:56
-msgid "KMouseTool"
-msgstr "KMouseTool"
-
-#: main.cpp:41
-msgid ""
-"(c) 2002-2003, Jeff Roush\n"
-"(c) 2003, Gunnar Schmi Dt"
-msgstr ""
-
-#: main.cpp:43
-msgid "Gunnar Schmi Dt"
-msgstr ""
-
-#: main.cpp:43
-msgid "Current maintainer"
-msgstr "الرَّاعي الحاليّ"
-
-#: main.cpp:44
-msgid "Olaf Schmidt"
-msgstr ""
-
-#: main.cpp:44
-msgid "Usability improvements"
-msgstr "تحسينات سهولة الإستخدام"
-
-#: main.cpp:45
-msgid "Jeff Roush"
-msgstr ""
-
-#: main.cpp:45
-msgid "Original author"
-msgstr "المؤلف الأصليّ"
-
-#: main.cpp:47
-msgid "Joe Betts"
-msgstr ""
-
-#: rc.cpp:52
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr "Hafid BENHADRIA, ,Launchpad Contributions:"
-
-#: rc.cpp:53
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr "ghosn@php4arab.info,,"
-
-#. i18n: file: kmousetoolui.ui:41
-#. i18n: ectx: property (title), widget (QGroupBox, groupBox1)
-#: rc.cpp:6 rc.cpp:59
-msgid "Settings"
-msgstr "إعدادات"
-
-#. i18n: file: kmousetoolui.ui:83
-#. i18n: ectx: property (text), widget (QLabel, dragTimeLabel)
-#: rc.cpp:9 rc.cpp:62
-msgid "Drag t&ime (1/10 sec):"
-msgstr "مدة السّ&حب (1/10 sec):"
-
-#. i18n: file: kmousetoolui.ui:133
-#. i18n: ectx: property (text), widget (QLabel, movementLabel)
-#: rc.cpp:12 rc.cpp:65
-msgid "&Minimum movement:"
-msgstr "&الحركة الدُّنيا:"
-
-#. i18n: file: kmousetoolui.ui:159
-#. i18n: ectx: property (text), widget (QCheckBox, cbStroke)
-#: rc.cpp:15 rc.cpp:68
-msgid "&Enable strokes"
-msgstr "&تفعيل الضّرب على المفاتيح"
-
-#. i18n: file: kmousetoolui.ui:172
-#. i18n: ectx: property (text), widget (QLabel, dwellTimeLabel)
-#: rc.cpp:18 rc.cpp:71
-msgid "D&well time (1/10 sec):"
-msgstr "م&دة النَّقرة (1/10 sec):"
-
-#. i18n: file: kmousetoolui.ui:182
-#. i18n: ectx: property (text), widget (QCheckBox, cbDrag)
-#: rc.cpp:21 rc.cpp:74
-msgid "Smar&t drag"
-msgstr "سحب ذ&كيّ"
-
-#. i18n: file: kmousetoolui.ui:200
-#. i18n: ectx: property (text), widget (KPushButton, buttonDefault)
-#: rc.cpp:24 rc.cpp:77
-msgid "&Defaults"
-msgstr ""
-
-#. i18n: file: kmousetoolui.ui:207
-#. i18n: ectx: property (text), widget (KPushButton, buttonReset)
-#: rc.cpp:27 rc.cpp:80
-msgid "&Reset"
-msgstr "&إعادة التَّعيين"
-
-#. i18n: file: kmousetoolui.ui:230
-#. i18n: ectx: property (text), widget (KPushButton, buttonApply)
-#: rc.cpp:30 rc.cpp:83
-msgid "&Apply"
-msgstr ""
-
-#. i18n: file: kmousetoolui.ui:239
-#. i18n: ectx: property (text), widget (QCheckBox, cbStart)
-#: rc.cpp:33 rc.cpp:86
-msgid "Start with &KDE"
-msgstr "البدء مع &KDE"
-
-#. i18n: file: kmousetoolui.ui:246
-#. i18n: ectx: property (text), widget (QCheckBox, cbClick)
-#: rc.cpp:36 rc.cpp:89
-msgid "A&udible click"
-msgstr "نقرة م&سموعة"
-
-#. i18n: file: kmousetoolui.ui:270
-#. i18n: ectx: property (text), widget (QLabel, textLabel1)
-#: rc.cpp:39 rc.cpp:92
-msgid ""
-"KMouseTool will run as a background application after you close this dialog. "
-"To change the settings again, restart KMouseTool or use the KDE system tray."
-msgstr ""
-"سيعمل KMouseTool كتطبيق خلفيَّ بعد أن تقوم بإغلاق هذا الحوار.لتغيير "
-"الإعدادات من جديد، اعد تشغيل KMouseTool أو استخدم صينية نِظام KDE."
-
-#. i18n: file: kmousetoolui.ui:308
-#. i18n: ectx: property (text), widget (KPushButton, buttonStartStop)
-#: rc.cpp:42 rc.cpp:95
-msgid "&Start"
-msgstr ""
-
-#. i18n: file: kmousetoolui.ui:325
-#. i18n: ectx: property (text), widget (KPushButton, buttonHelp)
-#: rc.cpp:45 rc.cpp:98
-msgid "&Help"
-msgstr ""
-
-#. i18n: file: kmousetoolui.ui:348
-#. i18n: ectx: property (text), widget (KPushButton, buttonClose)
-#: rc.cpp:48 rc.cpp:101
-msgid "&Close"
-msgstr ""
-
-#. i18n: file: kmousetoolui.ui:355
-#. i18n: ectx: property (text), widget (KPushButton, buttonQuit)
-#: rc.cpp:51 rc.cpp:104
-msgid "&Quit"
-msgstr ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmouth.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmouth.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmouth.po	2012-02-23 06:20:06.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmouth.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,1252 +0,0 @@
-# translation of kmouth.po to
-# Copyright (C) 2003, 2004, 2006, 2007 Free Software Foundation, Inc.
-#
-# Hafid BENHADRIA <ghosn@php4arab.info>, 2003.
-# Ahmad M. Zawawi <azawawi@emirates.net.ae>, 2004.
-# Ammar Tabbaa <atabba@kacst.edu.sa>, 2004.
-# محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
-# Youssef Chahibi <chahibi@gmail.com>, 2007.
-msgid ""
-msgstr ""
-"Project-Id-Version: kmouth\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 04:10+0000\n"
-"PO-Revision-Date: 2011-12-12 17:46+0000\n"
-"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: <en@li.org>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
-"3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:30+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"Language: \n"
-
-#: phraselist.cpp:60
-msgid ""
-"This list contains the history of spoken sentences. You can select sentences "
-"and press the speak button for re-speaking."
-msgstr ""
-"تحتوي هذه اللائحة على تأريخ الجمل المنطوقة. بإمكانك انتقاء جُمل والضَّغط على "
-"زر النُّطق بغرض إعادة نُطقِها."
-
-#: phraselist.cpp:78
-msgid ""
-"Into this edit field you can type a phrase. Click on the speak button in "
-"order to speak the entered phrase."
-msgstr ""
-"يمكنك رقن تعبير داخل حقل التَّحرير هذا. آنقر على زُر النُّطق بغرض نُطق "
-"التَّعبير المُدْخَل."
-
-#: phraselist.cpp:83 kmouth.cpp:194
-msgid "&Speak"
-msgstr "&نُطق"
-
-#: phraselist.cpp:86 kmouth.cpp:157
-msgid ""
-"Speaks the currently active sentence(s). If there is some text in the edit "
-"field it is spoken. Otherwise the selected sentences in the history (if any) "
-"are spoken."
-msgstr ""
-"ينطق الجملة/الجمل النّشطة حالياً. إن كان هناك بعض نصٍ في حقل التَّحرير، "
-"فإنّه يُنْطَق. فيما عدا ذلك، فإنّ الجمل المنتقاة بالتَّأريخ (إن وُجِدَت) يتم "
-"نطقها."
-
-#: phraselist.cpp:453
-msgid "Save As"
-msgstr ""
-
-#: phraselist.cpp:454 phrasebook/phrasebookdialog.cpp:809
-#, kde-format
-msgid ""
-"There was an error saving file\n"
-"%1"
-msgstr ""
-"طرأ خطأ عند حفظ ملف\n"
-"%1"
-
-#: phraselist.cpp:459
-msgid ""
-"*|All Files\n"
-"*.phrasebook|Phrase Books (*.phrasebook)\n"
-"*.txt|Plain Text Files (*.txt)"
-msgstr ""
-"*|كافة الملفات\n"
-"*.phrasebook|دفاتر تعابير (*.phrasebook)\n"
-"*.txt|ملفات نص خام (*.txt)"
-
-#: phraselist.cpp:459
-msgid "Open File as History"
-msgstr "فتح الملف على أنَّه تأريخ"
-
-#: phraselist.cpp:480 phrasebook/phrasebookdialog.cpp:799
-#, kde-format
-msgid ""
-"There was an error loading file\n"
-"%1"
-msgstr ""
-"طرأ خطأ عند تعبئة ملف\n"
-"%1"
-
-#: texttospeechconfigurationwidget.cpp:48
-#: wordcompletion/dictionarycreationwizard.cpp:100
-msgctxt "Local characterset"
-msgid "Local"
-msgstr ""
-
-#: texttospeechconfigurationwidget.cpp:51
-msgctxt "Latin1 characterset"
-msgid "Latin1"
-msgstr ""
-
-#: texttospeechconfigurationwidget.cpp:52
-#: wordcompletion/dictionarycreationwizard.cpp:104
-msgid "Unicode"
-msgstr "Unicode"
-
-#: main.cpp:28
-msgid "A type-and-say front end for speech synthesizers"
-msgstr "الوُجهة الخلفيّة آكتب-و-قل لموالفات النُّطق"
-
-#: main.cpp:35
-msgid "KMouth"
-msgstr "KMouth"
-
-#: main.cpp:37
-msgid "(c) 2002/2003, Gunnar Schmi Dt"
-msgstr ""
-
-#: main.cpp:38
-msgid "Gunnar Schmi Dt"
-msgstr ""
-
-#: main.cpp:42
-msgid "History file to open"
-msgstr "ملف التَّأريخ الواجب فتحه"
-
-#: main.cpp:45
-msgid "Olaf Schmidt"
-msgstr ""
-
-#: main.cpp:45
-msgid "Tips, extended phrase books"
-msgstr "تلميحات، دفاتر تعابير مُوَسَّعة"
-
-#: phrasebook/phrasebook.cpp:263 phrasebook/phrasebookdialog.cpp:788
-msgid ""
-"*.phrasebook|Phrase Books (*.phrasebook)\n"
-"*.txt|Plain Text Files (*.txt)\n"
-"*|All Files"
-msgstr ""
-"*.phrasebook|دفاتر تعابير (*.phrasebook)\n"
-"*.txt|ملفات نص خام (*.txt)\n"
-"*|كافة الملفات"
-
-#: phrasebook/phrasebook.cpp:265
-msgid ""
-"*.txt|Plain Text Files (*.txt)\n"
-"*.phrasebook|Phrase Books (*.phrasebook)\n"
-"*|All Files"
-msgstr ""
-"*.txt|ملفات نص خام (*.txt)\n"
-"*.phrasebook|دفاتر تعابير (*.phrasebook)\n"
-"*|كافة الملفات"
-
-#: phrasebook/phrasebook.cpp:283 wordcompletion/wordcompletionwidget.cpp:259
-#, kde-format
-msgid "The file %1 already exists. Do you want to overwrite it?"
-msgstr ""
-
-#: phrasebook/phrasebook.cpp:284 wordcompletion/wordcompletionwidget.cpp:260
-msgid "File Exists"
-msgstr ""
-
-#: phrasebook/phrasebook.cpp:284 wordcompletion/wordcompletionwidget.cpp:260
-msgid "&Overwrite"
-msgstr ""
-
-#: phrasebook/phrasebook.cpp:295
-#, kde-format
-msgid ""
-"Your chosen filename <i>%1</i> has a different extension than "
-"<i>.phrasebook</i>. Do you wish to add <i>.phrasebook</i> to the filename?"
-msgstr ""
-
-#: phrasebook/phrasebook.cpp:296 phrasebook/phrasebook.cpp:312
-msgid "File Extension"
-msgstr ""
-
-#: phrasebook/phrasebook.cpp:296
-msgid "Add"
-msgstr ""
-
-#: phrasebook/phrasebook.cpp:296
-msgid "Do Not Add"
-msgstr ""
-
-#: phrasebook/phrasebook.cpp:311
-#, kde-format
-msgid ""
-"Your chosen filename <i>%1</i> has the extension <i>.phrasebook</i>. Do you "
-"wish to save in phrasebook format?"
-msgstr ""
-
-#: phrasebook/phrasebook.cpp:312
-msgid "As Phrasebook"
-msgstr "كدفتر تعبير"
-
-#: phrasebook/phrasebook.cpp:312
-msgid "As Plain Text"
-msgstr ""
-
-#: phrasebook/phrasetree.cpp:471
-#, kde-format
-msgid ""
-"The '%1' key combination has already been allocated to %2.\n"
-"Please choose a unique key combination."
-msgstr ""
-
-#: phrasebook/phrasetree.cpp:493
-#, kde-format
-msgid "the standard \"%1\" action"
-msgstr ""
-
-#: phrasebook/phrasetree.cpp:494
-msgid "Conflict with Standard Application Shortcut"
-msgstr ""
-
-#: phrasebook/phrasetree.cpp:511
-#, kde-format
-msgid "the global \"%1\" action"
-msgstr ""
-
-#: phrasebook/phrasetree.cpp:512
-msgid "Conflict with Global Shortcuts"
-msgstr ""
-
-#: phrasebook/phrasetree.cpp:527
-msgid "an other phrase"
-msgstr "تعبير آخر"
-
-#: phrasebook/phrasetree.cpp:528
-msgid "Key Conflict"
-msgstr ""
-
-#: phrasebook/phrasebookdialog.cpp:143
-#, kde-format
-msgid " (%2 of 1 book selected)"
-msgid_plural " (%2 of %1 books selected)"
-msgstr[0] ""
-msgstr[1] ""
-
-#: phrasebook/phrasebookdialog.cpp:157
-msgid "Please decide which phrase books you need:"
-msgstr ""
-
-#: phrasebook/phrasebookdialog.cpp:166
-msgid "Book"
-msgstr ""
-
-#: phrasebook/phrasebookdialog.cpp:262
-msgid ""
-"By clicking on this button you can select the keyboard shortcut associated "
-"with the selected phrase."
-msgstr ""
-
-#: phrasebook/phrasebookdialog.cpp:284
-msgid "Phrase Book"
-msgstr "دفتر التَّعابير"
-
-#: phrasebook/phrasebookdialog.cpp:325
-msgid "Phrase"
-msgstr "تعبير"
-
-#: phrasebook/phrasebookdialog.cpp:326
-msgid "Shortcut"
-msgstr ""
-
-#: phrasebook/phrasebookdialog.cpp:330
-msgid ""
-"This list contains the current phrase book in a tree structure. You can "
-"select and modify individual phrases and sub phrase books"
-msgstr ""
-
-#: phrasebook/phrasebookdialog.cpp:352
-msgid "&New Phrase"
-msgstr ""
-
-#: phrasebook/phrasebookdialog.cpp:354 phrasebook/phrasebookdialog.cpp:355
-msgid "Adds a new phrase"
-msgstr ""
-
-#: phrasebook/phrasebookdialog.cpp:359
-msgid "New Phrase &Book"
-msgstr "دفتر &تعابير جديد"
-
-#: phrasebook/phrasebookdialog.cpp:361 phrasebook/phrasebookdialog.cpp:362
-msgid ""
-"Adds a new phrase book into which other books and phrases can be placed"
-msgstr ""
-
-#: phrasebook/phrasebookdialog.cpp:365 phrasebook/phrasebookdialog.cpp:366
-msgid "Saves the phrase book onto the hard disk"
-msgstr ""
-
-#: phrasebook/phrasebookdialog.cpp:370 phrasebook/phrasebookdialog.cpp:375
-msgid "&Import..."
-msgstr ""
-
-#: phrasebook/phrasebookdialog.cpp:372 phrasebook/phrasebookdialog.cpp:373
-#: phrasebook/phrasebookdialog.cpp:378 phrasebook/phrasebookdialog.cpp:379
-msgid "Imports a file and adds its contents to the phrase book"
-msgstr ""
-
-#: phrasebook/phrasebookdialog.cpp:383
-msgid "I&mport Standard Phrase Book"
-msgstr "إ&ستيراد دفتر تَعابير مِمعياريّ"
-
-#: phrasebook/phrasebookdialog.cpp:384 phrasebook/phrasebookdialog.cpp:385
-msgid ""
-"Imports a standard phrase book and adds its contents to the phrase book"
-msgstr ""
-
-#: phrasebook/phrasebookdialog.cpp:389
-msgid "&Export..."
-msgstr "&تصدير..."
-
-#: phrasebook/phrasebookdialog.cpp:391 phrasebook/phrasebookdialog.cpp:392
-msgid ""
-"Exports the currently selected phrase(s) or phrase book(s) into a file"
-msgstr "يُصدِّر الجملة/الجمل أو دفتر/دفاتر التَّعابير المنتقاة حاليا إلى ملف"
-
-#: phrasebook/phrasebookdialog.cpp:395 phrasebook/phrasebookdialog.cpp:396
-msgid "Prints the currently selected phrase(s) or phrase book(s)"
-msgstr "يطبع الجملة/الجمل أو دفتر/دفاتر التَّعابير المنتقاة حاليا"
-
-#: phrasebook/phrasebookdialog.cpp:399 phrasebook/phrasebookdialog.cpp:400
-msgid "Closes the window"
-msgstr ""
-
-#: phrasebook/phrasebookdialog.cpp:404 phrasebook/phrasebookdialog.cpp:405
-msgid ""
-"Cuts the currently selected entries from the phrase book and puts it to the "
-"clipboard"
-msgstr ""
-"يقُص المُدْخَلات المنتقاة حاليا من دفتر التَّعابير ويضعها بحافظة القُصاصات"
-
-#: phrasebook/phrasebookdialog.cpp:408 phrasebook/phrasebookdialog.cpp:409
-msgid ""
-"Copies the currently selected entry from the phrase book to the clipboard"
-msgstr ""
-"ينسخ المُدْخَل المنتقى حاليا من دفتر التَّعابير باتجاه حافظة القُصاصات"
-
-#: phrasebook/phrasebookdialog.cpp:412 kmouth.cpp:149
-msgid "Pastes the clipboard contents to current position"
-msgstr ""
-
-#: phrasebook/phrasebookdialog.cpp:413 kmouth.cpp:150
-msgid ""
-"Pastes the clipboard contents at the current cursor position into the edit "
-"field."
-msgstr ""
-"يُلصِق محتويات حافظة القُصاصات عند الموضع الحاليّ للمؤشر داخل حقل التَّحرير."
-
-#: phrasebook/phrasebookdialog.cpp:417 kmouth.cpp:201
-msgid "&Delete"
-msgstr ""
-
-#: phrasebook/phrasebookdialog.cpp:419 phrasebook/phrasebookdialog.cpp:420
-msgid "Deletes the selected entries from the phrase book"
-msgstr "يحذف المُدْخَلات المنتقاة من على دفتر التَّعابير"
-
-#. i18n: file: phrasebook/buttonboxui.ui:77
-#. i18n: ectx: property (text), widget (QLabel, textLabel)
-#: phrasebook/phrasebookdialog.cpp:542 phrasebook/phrasebookdialog.cpp:556
-#: rc.cpp:214
-msgid "Text of the &phrase:"
-msgstr "نص &التَّعبير:"
-
-#: phrasebook/phrasebookdialog.cpp:580
-msgid "Name of the &phrase book:"
-msgstr "إسم دفتر &التَّعابير:"
-
-#: phrasebook/phrasebookdialog.cpp:599
-msgid ""
-"<qt>There are unsaved changes.<br />Do you want to apply the changes before "
-"closing the \"phrase book\" window or discard the changes?</qt>"
-msgstr ""
-
-#: phrasebook/phrasebookdialog.cpp:600
-msgid "Closing \"Phrase Book\" Window"
-msgstr "إغلاق نافذة \"دفتر التَّعابير\""
-
-#: phrasebook/phrasebookdialog.cpp:660
-#, kde-format
-msgid ""
-"In order to use the '%1' key as a shortcut, it must be combined with the "
-"Win, Alt, Ctrl, and/or Shift keys."
-msgstr ""
-
-#: phrasebook/phrasebookdialog.cpp:663
-msgid "Invalid Shortcut Key"
-msgstr ""
-
-#: phrasebook/phrasebookdialog.cpp:760
-msgid "(New Phrase Book)"
-msgstr ""
-
-#: phrasebook/phrasebookdialog.cpp:771
-msgid "(New Phrase)"
-msgstr ""
-
-#: phrasebook/phrasebookdialog.cpp:788
-msgid "Import Phrasebook"
-msgstr "إستيراد دفتر التَّعابير"
-
-#: phrasebook/phrasebookdialog.cpp:808
-msgid "Export Phrase Book"
-msgstr "تصدير دفتر تعابير"
-
-#: wordcompletion/wordlist.cpp:114
-msgid "Creating Word List"
-msgstr "جاري إنشاء لائحة الكلمات"
-
-#: wordcompletion/wordlist.cpp:114 wordcompletion/wordlist.cpp:296
-msgid "Parsing the KDE documentation..."
-msgstr "جاري تفسير توثيق KDE"
-
-#: wordcompletion/wordlist.cpp:243
-msgid "Merging dictionaries..."
-msgstr "جاري دمج القواميس..."
-
-#: wordcompletion/wordlist.cpp:314
-msgid "Parsing file..."
-msgstr "جاري تفسير الملف..."
-
-#: wordcompletion/wordlist.cpp:325
-msgid "Parsing directory..."
-msgstr "جاري تفسير المجلد..."
-
-#: wordcompletion/wordlist.cpp:517
-msgid "Performing spell check..."
-msgstr ""
-
-#: wordcompletion/dictionarycreationwizard.cpp:49
-msgid "Source of New Dictionary (1)"
-msgstr ""
-
-#: wordcompletion/dictionarycreationwizard.cpp:54
-#: wordcompletion/dictionarycreationwizard.cpp:58
-#: wordcompletion/dictionarycreationwizard.cpp:66
-#: wordcompletion/dictionarycreationwizard.cpp:71
-#: wordcompletion/dictionarycreationwizard.cpp:116
-#: wordcompletion/dictionarycreationwizard.cpp:132
-#: wordcompletion/dictionarycreationwizard.cpp:141
-#: wordcompletion/dictionarycreationwizard.cpp:150
-msgid "Source of New Dictionary (2)"
-msgstr ""
-
-#: wordcompletion/dictionarycreationwizard.cpp:59
-msgctxt "In which directory is the file located?"
-msgid "&Directory:"
-msgstr ""
-
-#: wordcompletion/dictionarycreationwizard.cpp:60
-#: wordcompletion/dictionarycreationwizard.cpp:62
-msgid ""
-"With this input field you specify which directory you want to load for "
-"creating the new dictionary."
-msgstr ""
-
-#: wordcompletion/dictionarycreationwizard.cpp:103
-msgctxt "Latin characterset"
-msgid "Latin1"
-msgstr ""
-
-#: wordcompletion/dictionarycreationwizard.cpp:237
-msgid "Merge result"
-msgstr ""
-
-#: wordcompletion/dictionarycreationwizard.cpp:240
-msgctxt "In the sense of a blank word list"
-msgid "Empty list"
-msgstr ""
-
-#: wordcompletion/dictionarycreationwizard.cpp:249
-msgid "KDE Documentation"
-msgstr "توثيق KDE"
-
-#: wordcompletion/dictionarycreationwizard.cpp:371
-msgctxt "Default dictionary"
-msgid "Default"
-msgstr ""
-
-#: wordcompletion/wordcompletionwidget.cpp:75
-#: wordcompletion/wordcompletionwidget.cpp:144
-#: wordcompletion/wordcompletionwidget.cpp:208
-msgid "without name"
-msgstr "بلا إسم"
-
-#: wordcompletion/wordcompletionwidget.cpp:254
-msgid "Export Dictionary"
-msgstr "تصدير القاموس"
-
-#: optionsdialog.cpp:120
-msgid "Configuration"
-msgstr ""
-
-#: optionsdialog.cpp:133
-msgid "&Preferences"
-msgstr "&تفضيلات"
-
-#: optionsdialog.cpp:137
-msgid "&Text-to-Speech"
-msgstr "&نطق النّص"
-
-#: optionsdialog.cpp:139 optionsdialog.cpp:140
-msgid "General Options"
-msgstr "خيارات عامة"
-
-#: optionsdialog.cpp:145 optionsdialog.cpp:146 configwizard.cpp:103
-msgid "Word Completion"
-msgstr "تكملة الكلمات"
-
-#: optionsdialog.cpp:152
-msgid "Jovie Speech Service"
-msgstr ""
-
-#: optionsdialog.cpp:154
-msgid "KDE Text-to-Speech Daemon Configuration"
-msgstr ""
-
-#: kmouth.cpp:113
-msgid "&Open as History..."
-msgstr "&الفتح كتأريخ"
-
-#: kmouth.cpp:116 kmouth.cpp:117
-msgid "Opens an existing file as history"
-msgstr "فتح ملف موجود كتأريخ"
-
-#: kmouth.cpp:121
-msgid "Save &History As..."
-msgstr "حفظ &التّأريخ كـ..."
-
-#: kmouth.cpp:124 kmouth.cpp:125
-msgid "Saves the actual history as..."
-msgstr "يحفظ التّأريخ الحاليّ كـ..."
-
-#: kmouth.cpp:129
-msgid "&Print History..."
-msgstr "&طباعة التّأريخ..."
-
-#: kmouth.cpp:132 kmouth.cpp:133
-msgid "Prints out the actual history"
-msgstr "يطبع التّأريخ الحاليّ"
-
-#: kmouth.cpp:136 kmouth.cpp:137
-msgid "Quits the application"
-msgstr "يغادر التَّطبيق"
-
-#: kmouth.cpp:141
-msgid "Cuts the selected section and puts it to the clipboard"
-msgstr "يقُصُ المقطع المُنتقَى ويضعه في حافظة القُصاصات"
-
-#: kmouth.cpp:142
-msgid ""
-"Cuts the selected section and puts it to the clipboard. If there is some "
-"text selected in the edit field it is placed it on the clipboard. Otherwise "
-"the selected sentences in the history (if any) are placed on the clipboard."
-msgstr ""
-"يقُصُ المقطع المُنتقَى ويضعه في حافظة القُصاصات. إن وُجد بعض نصٍ مُنتقى في "
-"حقل التَّحرير، فإنَّه يتم وضعه في حافظة القُصاصات. فيما عدا ذلك، فإنّ "
-"الجُمَل المُنتقاة في التَّأريخ (إن وُجدت) يتم وضعها في حافظة القُصاصات."
-
-#: kmouth.cpp:145
-msgid "Copies the selected section to the clipboard"
-msgstr "ينسخ المقطع المُنتقى إلى حافظة القُصاصات"
-
-#: kmouth.cpp:146
-msgid ""
-"Copies the selected section to the clipboard. If there is some text selected "
-"in the edit field it is copied to the clipboard. Otherwise the selected "
-"sentences in the history (if any) are copied to the clipboard."
-msgstr ""
-"ينسخ المقطع المُنتقى إلى حافظة القُصاصات. إن وُجد بعض نصٍ مُنتقى في حقل "
-"التَّحرير، فإنَّه يتم نسخه في حافظة القُصاصات. فيما عدا ذلك، فإنّ الجُمَل "
-"المُنتقاة في التَّأريخ (إن وُجدت) يتم نسخها في حافظة القُصاصات."
-
-#: kmouth.cpp:154
-msgctxt "Start speaking"
-msgid "&Speak"
-msgstr ""
-
-#: kmouth.cpp:156
-msgid "Speaks the currently active sentence(s)"
-msgstr "ينطق الجملة/الجمل النّشطة حالياً"
-
-#: kmouth.cpp:161
-msgid "&Edit..."
-msgstr "&تحرير..."
-
-#: kmouth.cpp:172
-msgid "Show P&hrasebook Bar"
-msgstr ""
-
-#: kmouth.cpp:174 kmouth.cpp:175
-msgid "Enables/disables the phrasebook bar"
-msgstr ""
-
-#: kmouth.cpp:178 kmouth.cpp:179
-msgid "Enables/disables the statusbar"
-msgstr "يُفَعِّل/يُعَطِّل شريط الحالة"
-
-#: kmouth.cpp:183
-msgid "&Configure KMouth..."
-msgstr "&تهيئة KMouth..."
-
-#: kmouth.cpp:185 kmouth.cpp:186
-msgid "Opens the configuration dialog"
-msgstr "يفتح حوار التَّهيئة"
-
-#: kmouth.cpp:195 kmouth.cpp:197
-msgid "Speaks the currently selected phrases in the history"
-msgstr "ينطق التَّعابير المنتقاة حالياً بالتَّأريخ"
-
-#: kmouth.cpp:203 kmouth.cpp:204
-msgid "Deletes the currently selected phrases from the history"
-msgstr ""
-
-#: kmouth.cpp:208
-msgid "Cu&t"
-msgstr "ق&ص"
-
-#: kmouth.cpp:210 kmouth.cpp:211
-msgid ""
-"Cuts the currently selected phrases from the history and puts them to the "
-"clipboard"
-msgstr ""
-"يقُص التَّعابير المنتقاة حاليا من التَّأريخ ويضعها في حافظة القُصاصات"
-
-#: kmouth.cpp:215
-msgid "&Copy"
-msgstr ""
-
-#: kmouth.cpp:217 kmouth.cpp:218
-msgid ""
-"Copies the currently selected phrases from the history to the clipboard"
-msgstr "ينسخ التَّعابير المنتقاة حالياً من التَّأريخ باتجاه حافظة القُصاصات"
-
-#: kmouth.cpp:221
-msgid "Select &All Entries"
-msgstr "إنتقاء &كافة المُدْخَلات"
-
-#: kmouth.cpp:223 kmouth.cpp:224
-msgid "Selects all phrases in the history"
-msgstr "ينتقي كافة التَّعابير في التَّأريخ"
-
-#: kmouth.cpp:227
-msgid "D&eselect All Entries"
-msgstr ""
-
-#: kmouth.cpp:229 kmouth.cpp:230
-msgid "Deselects all phrases in the history"
-msgstr "يُزيلُ إنتقاء كافة التَّعابير في التَّأريخ"
-
-#: kmouth.cpp:244 kmouth.cpp:262 kmouth.cpp:370 kmouth.cpp:378 kmouth.cpp:396
-#: kmouth.cpp:446 kmouth.cpp:463 kmouth.cpp:480 kmouth.cpp:497
-msgctxt "The job is done"
-msgid "Ready."
-msgstr ""
-
-#: kmouth.cpp:259 kmouth.cpp:366
-msgid "Opening file..."
-msgstr "جاري فتح الملف..."
-
-#: kmouth.cpp:374
-msgid "Saving history with a new filename..."
-msgstr "جاري حفظ التَّأريخ باسم ملف جديد..."
-
-#: kmouth.cpp:383
-msgid "Printing..."
-msgstr "جاري الطِّباعة..."
-
-#: kmouth.cpp:401
-msgctxt "Shutting down the application"
-msgid "Exiting..."
-msgstr ""
-
-#: kmouth.cpp:439
-msgid "Toggling menubar..."
-msgstr ""
-
-#: kmouth.cpp:451
-msgid "Toggling toolbar..."
-msgstr "جاري تبديل شريط الأدوات..."
-
-#: kmouth.cpp:468
-msgid "Toggling phrasebook bar..."
-msgstr ""
-
-#: kmouth.cpp:485
-msgid "Toggle the statusbar..."
-msgstr "تبديل شريط الحالة..."
-
-#: configwizard.cpp:38
-msgid "Initial Configuration - KMouth"
-msgstr "تهيئة أوليّة - KMouth"
-
-#: configwizard.cpp:57
-msgid "Text-to-Speech Configuration"
-msgstr "تهيئة نطق النّص"
-
-#: configwizard.cpp:71
-msgid "Initial Phrase Book"
-msgstr "دفتر التَّعابير الأوليّ"
-
-#: rc.cpp:92
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr "Hafid BENHADRIA, ,Launchpad Contributions:"
-
-#: rc.cpp:93
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr "ghosn@php4arab.info,,"
-
-#. i18n: file: kmouthui.rc:4
-#. i18n: ectx: Menu (file)
-#: rc.cpp:3 rc.cpp:96
-msgid "&File"
-msgstr ""
-
-#. i18n: file: kmouthui.rc:11
-#. i18n: ectx: Menu (edit)
-#: rc.cpp:6 rc.cpp:99
-msgid "&Edit"
-msgstr ""
-
-#. i18n: file: kmouthui.rc:14
-#. i18n: ectx: Menu (phrasebooks)
-#: rc.cpp:9 rc.cpp:102
-msgid "&Phrase Books"
-msgstr "&دفاتر تعابير"
-
-#. i18n: file: kmouthui.rc:17
-#. i18n: ectx: Menu (settings)
-#: rc.cpp:12 rc.cpp:105
-msgid "&Settings"
-msgstr ""
-
-#. i18n: file: preferencesui.ui:21
-#. i18n: ectx: property (windowTitle), widget (QWidget, PreferencesUI)
-#: rc.cpp:15 rc.cpp:108
-msgid "Preferences"
-msgstr "تفضيلات"
-
-#. i18n: file: preferencesui.ui:49
-#. i18n: ectx: property (whatsThis), widget (QLabel, speakLabel)
-#. i18n: file: preferencesui.ui:62
-#. i18n: ectx: property (whatsThis), widget (KComboBox, speakCombo)
-#. i18n: file: preferencesui.ui:49
-#. i18n: ectx: property (whatsThis), widget (QLabel, speakLabel)
-#. i18n: file: preferencesui.ui:62
-#. i18n: ectx: property (whatsThis), widget (KComboBox, speakCombo)
-#: rc.cpp:18 rc.cpp:24 rc.cpp:111 rc.cpp:117
-msgid ""
-"This combo box specifies whether selected phrases of the phrase book are "
-"immediately spoken or just inserted into the edit field."
-msgstr ""
-"مربع التَّراكيب هذا يُحدِّد إذا ما يتم نطق التَّعابير المنتقاة من دفتر "
-"التَّعابير في الحال أو يتم فقط إدراجها ضمن حقل التَّحرير."
-
-#. i18n: file: preferencesui.ui:52
-#. i18n: ectx: property (text), widget (QLabel, speakLabel)
-#: rc.cpp:21 rc.cpp:114
-msgid "&Selection of phrases in the phrase book:"
-msgstr "&إنتقاء تعابير في دفتر التَّعابير:"
-
-#. i18n: file: preferencesui.ui:66
-#. i18n: ectx: property (text), item, widget (KComboBox, speakCombo)
-#: rc.cpp:27 rc.cpp:120
-msgid "Speak Immediately"
-msgstr "النّطق في الحال"
-
-#. i18n: file: preferencesui.ui:71
-#. i18n: ectx: property (text), item, widget (KComboBox, speakCombo)
-#: rc.cpp:30 rc.cpp:123
-msgid "Insert Into Edit Field"
-msgstr "الإدراج ضمن حقل التَّحرير"
-
-#. i18n: file: preferencesui.ui:97
-#. i18n: ectx: property (whatsThis), widget (QLabel, closeLabel)
-#. i18n: file: preferencesui.ui:110
-#. i18n: ectx: property (whatsThis), widget (KComboBox, closeCombo)
-#. i18n: file: preferencesui.ui:97
-#. i18n: ectx: property (whatsThis), widget (QLabel, closeLabel)
-#. i18n: file: preferencesui.ui:110
-#. i18n: ectx: property (whatsThis), widget (KComboBox, closeCombo)
-#: rc.cpp:33 rc.cpp:39 rc.cpp:126 rc.cpp:132
-msgid ""
-"This combo box specifies whether the phrase book is automatically saved when "
-"the edit window is closed."
-msgstr ""
-"مربع التَّراكيب هذا يُحدِّد إذا ما يتم حفظ دفتر التَّعابير آليا عند إغلاق "
-"نافذة التَّحرير."
-
-#. i18n: file: preferencesui.ui:100
-#. i18n: ectx: property (text), widget (QLabel, closeLabel)
-#: rc.cpp:36 rc.cpp:129
-msgid "Closing the phrase &book edit window:"
-msgstr "إغلاق نافذة تحرير &دفتر التَّعابير:"
-
-#. i18n: file: preferencesui.ui:114
-#. i18n: ectx: property (text), item, widget (KComboBox, closeCombo)
-#: rc.cpp:42 rc.cpp:135
-msgid "Save Phrase Book"
-msgstr "حفظ دفتر التَّعابير"
-
-#. i18n: file: preferencesui.ui:119
-#. i18n: ectx: property (text), item, widget (KComboBox, closeCombo)
-#: rc.cpp:45 rc.cpp:138
-msgid "Discard Changes"
-msgstr "التَّخلص من التَّغييرات"
-
-#. i18n: file: preferencesui.ui:124
-#. i18n: ectx: property (text), item, widget (KComboBox, closeCombo)
-#: rc.cpp:48 rc.cpp:141
-msgid "Ask Whether to Save"
-msgstr "السّؤال إن توجب الحفظ"
-
-#. i18n: file: texttospeechconfigurationui.ui:13
-#. i18n: ectx: property (windowTitle), widget (QWidget, texttospeechconfigurationui)
-#: rc.cpp:51 rc.cpp:144
-msgid "Text-to-Speech"
-msgstr "نطق النّص"
-
-#. i18n: file: texttospeechconfigurationui.ui:41
-#. i18n: ectx: property (text), widget (QLabel, urlLabel)
-#: rc.cpp:54 rc.cpp:147
-msgid "C&ommand for speaking texts:"
-msgstr "الأ&مر بنطق النُّصوص:"
-
-#. i18n: file: texttospeechconfigurationui.ui:51
-#. i18n: ectx: property (whatsThis), widget (QLabel, urlLabel)
-#. i18n: file: texttospeechconfigurationui.ui:70
-#. i18n: ectx: property (whatsThis), widget (KUrlRequester, urlReq)
-#. i18n: file: texttospeechconfigurationui.ui:51
-#. i18n: ectx: property (whatsThis), widget (QLabel, urlLabel)
-#. i18n: file: texttospeechconfigurationui.ui:70
-#. i18n: ectx: property (whatsThis), widget (KUrlRequester, urlReq)
-#: rc.cpp:58 rc.cpp:66 rc.cpp:151 rc.cpp:159
-#, no-c-format
-msgid ""
-"This field specifies both the command used for speaking texts and its "
-"parameters. KMouth knows the following placeholders:\n"
-"%t -- the text that should be spoken\n"
-"%f -- the name of a file containing the text\n"
-"%l -- the language code\n"
-"%% -- a percent sign"
-msgstr ""
-
-#. i18n: file: texttospeechconfigurationui.ui:95
-#. i18n: ectx: property (text), widget (QLabel, characterCodingLabel)
-#. i18n: file: wordcompletion/creationsourcedetailsui.ui:46
-#. i18n: ectx: property (text), widget (QLabel, encodingLabel)
-#: rc.cpp:73 rc.cpp:166 rc.cpp:226
-msgid "Character &encoding:"
-msgstr "&تشفير الحروف:"
-
-#. i18n: file: texttospeechconfigurationui.ui:101
-#. i18n: ectx: property (whatsThis), widget (QLabel, characterCodingLabel)
-#. i18n: file: texttospeechconfigurationui.ui:108
-#. i18n: ectx: property (whatsThis), widget (KComboBox, characterCodingBox)
-#. i18n: file: texttospeechconfigurationui.ui:101
-#. i18n: ectx: property (whatsThis), widget (QLabel, characterCodingLabel)
-#. i18n: file: texttospeechconfigurationui.ui:108
-#. i18n: ectx: property (whatsThis), widget (KComboBox, characterCodingBox)
-#: rc.cpp:76 rc.cpp:79 rc.cpp:169 rc.cpp:172
-msgid ""
-"This combo box specifies which character encoding is used for passing the "
-"text."
-msgstr ""
-"مربع التَّراكيب هذا يُحدِّد أي تشفير للحروف يتم استخدامه بغرض تمرير النَّص."
-
-#. i18n: file: texttospeechconfigurationui.ui:117
-#. i18n: ectx: property (text), widget (QCheckBox, stdInButton)
-#: rc.cpp:82 rc.cpp:175
-msgid "Send the data as standard &input"
-msgstr "إرسال البيانات على أنّها &مُدْخَل ممعياريّ"
-
-#. i18n: file: texttospeechconfigurationui.ui:120
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, stdInButton)
-#: rc.cpp:85 rc.cpp:178
-msgid ""
-"This check box specifies whether the text is sent as standard input to the "
-"speech synthesizer."
-msgstr ""
-"مربع التَّراكيب هذا يُحدِّد إذا ما يتم إرسال النَّص على أنَّه مُدْخَل "
-"ممعياريّ إلى موالف النُّطق."
-
-#. i18n: file: texttospeechconfigurationui.ui:127
-#. i18n: ectx: property (text), widget (QCheckBox, useKttsd)
-#: rc.cpp:88 rc.cpp:181
-msgid "&Use Jovie speech service if possible"
-msgstr ""
-
-#. i18n: file: texttospeechconfigurationui.ui:130
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, useKttsd)
-#: rc.cpp:91 rc.cpp:184
-msgid ""
-"This check box specifies KMouth tries to use the Jovie speech service prior "
-"to calling the speech synthesizer directly. The Jovie speech service is a "
-"KDE daemon which gives KDE applications a standardized interface for speech "
-"synthesis and is currently developed in SVN."
-msgstr ""
-
-#. i18n: file: phrasebook/buttonboxui.ui:13
-#. i18n: ectx: property (windowTitle), widget (QWidget, ButtonBoxUI)
-#: rc.cpp:187
-msgid "Currently Selected Phrase or Phrase Book"
-msgstr "التَّعبير أو دفتر التَّعابير المنتقى حاليا"
-
-#. i18n: file: phrasebook/buttonboxui.ui:25
-#. i18n: ectx: property (title), widget (QGroupBox, phrasebox)
-#: rc.cpp:190
-msgid "&Currently Selected Phrase or Phrase Book"
-msgstr "&التَّعبير أو دفتر التَّعابير المنتقى حاليا"
-
-#. i18n: file: phrasebook/buttonboxui.ui:40
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, lineEdit)
-#. i18n: file: phrasebook/buttonboxui.ui:74
-#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel)
-#: rc.cpp:193 rc.cpp:211
-msgid ""
-"With this line edit you define the name of a sub-phrasebook or the contents "
-"of a phrase."
-msgstr ""
-
-#. i18n: file: phrasebook/buttonboxui.ui:47
-#. i18n: ectx: property (whatsThis), widget (QRadioButton, noKey)
-#: rc.cpp:196
-msgid ""
-"If you select this option then the selected phrase will not be reachable by "
-"a keyboard shortcut."
-msgstr ""
-
-#. i18n: file: phrasebook/buttonboxui.ui:50
-#. i18n: ectx: property (text), widget (QRadioButton, noKey)
-#: rc.cpp:199
-msgid "&None"
-msgstr "&لا أحد"
-
-#. i18n: file: phrasebook/buttonboxui.ui:57
-#. i18n: ectx: property (whatsThis), widget (QRadioButton, customKey)
-#: rc.cpp:202
-msgid ""
-"If you select this option then the selected phrase will be reachable by a "
-"keyboard shortcut. You can change the shortcut with the button next to this "
-"option."
-msgstr ""
-
-#. i18n: file: phrasebook/buttonboxui.ui:60
-#. i18n: ectx: property (text), widget (QRadioButton, customKey)
-#: rc.cpp:205
-msgid "C&ustom"
-msgstr "مُ&خصَّص"
-
-#. i18n: file: phrasebook/buttonboxui.ui:67
-#. i18n: ectx: property (text), widget (QLabel, shortcutLabel)
-#: rc.cpp:208
-msgid "Shortcut for the phrase:"
-msgstr "إختصار التَّعبير:"
-
-#. i18n: file: wordcompletion/creationsourcedetailsui.ui:22
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, spellCheckBox)
-#: rc.cpp:217
-msgid ""
-"If you select this check box the words are spell-checked before they are "
-"inserted into the new dictionary."
-msgstr ""
-
-#. i18n: file: wordcompletion/creationsourcedetailsui.ui:25
-#. i18n: ectx: property (text), widget (QCheckBox, spellCheckBox)
-#. i18n: file: wordcompletion/kdedocsourceui.ui:25
-#. i18n: ectx: property (text), widget (QCheckBox, spellCheckBox)
-#: rc.cpp:220 rc.cpp:289
-msgid "C&ompare to OpenOffice.org dictionary:"
-msgstr ""
-
-#. i18n: file: wordcompletion/creationsourcedetailsui.ui:43
-#. i18n: ectx: property (whatsThis), widget (QLabel, encodingLabel)
-#. i18n: file: wordcompletion/creationsourcedetailsui.ui:100
-#. i18n: ectx: property (whatsThis), widget (KComboBox, encodingCombo)
-#: rc.cpp:223 rc.cpp:238
-msgid ""
-"With this combo box you select the character encoding used to load text "
-"files. This combo box is not used for XML files or for dictionary files."
-msgstr ""
-
-#. i18n: file: wordcompletion/creationsourcedetailsui.ui:64
-#. i18n: ectx: property (whatsThis), widget (QLabel, urlLabel)
-#. i18n: file: wordcompletion/creationsourcedetailsui.ui:85
-#. i18n: ectx: property (whatsThis), widget (KUrlRequester, url)
-#: rc.cpp:229 rc.cpp:235
-msgid ""
-"With this input field you specify which file you want to load for creating "
-"the new dictionary."
-msgstr ""
-
-#. i18n: file: wordcompletion/creationsourcedetailsui.ui:67
-#. i18n: ectx: property (text), widget (QLabel, urlLabel)
-#: rc.cpp:232
-msgid "&Filename:"
-msgstr "&إسم الملف:"
-
-#. i18n: file: wordcompletion/creationsourcedetailsui.ui:118
-#. i18n: ectx: property (whatsThis), widget (KUrlRequester, ooDictURL)
-#. i18n: file: wordcompletion/kdedocsourceui.ui:44
-#. i18n: ectx: property (whatsThis), widget (KUrlRequester, ooDictURL)
-#: rc.cpp:241 rc.cpp:292
-msgid ""
-"With this input field you select the OpenOffice.org directory that will be "
-"used to spellcheck the words of the new dictionary."
-msgstr ""
-
-#. i18n: file: wordcompletion/creationsourcedetailsui.ui:136
-#. i18n: ectx: property (whatsThis), widget (QLabel, languageLabel)
-#: rc.cpp:244
-msgid ""
-"With this combo box you decide which language should be associated with the "
-"new dictionary."
-msgstr ""
-
-#. i18n: file: wordcompletion/creationsourcedetailsui.ui:139
-#. i18n: ectx: property (text), widget (QLabel, languageLabel)
-#. i18n: file: wordcompletion/kdedocsourceui.ui:67
-#. i18n: ectx: property (text), widget (QLabel, languageLabel)
-#. i18n: file: wordcompletion/wordcompletionui.ui:51
-#. i18n: ectx: property (text), widget (QLabel, languageLabel)
-#: rc.cpp:247 rc.cpp:298 rc.cpp:307
-msgid "&Language:"
-msgstr "&اللُّغة:"
-
-#. i18n: file: wordcompletion/creationsourceui.ui:16
-#. i18n: ectx: property (text), widget (QRadioButton, createButton)
-#: rc.cpp:250
-msgid "C&reate new dictionary:"
-msgstr "&إنشاء قاموس جديد:"
-
-#. i18n: file: wordcompletion/creationsourceui.ui:22
-#. i18n: ectx: property (whatsThis), widget (QRadioButton, createButton)
-#: rc.cpp:253
-msgid ""
-"If you select this box a new dictionary is created by either loading a "
-"dictionary file or by counting the individual words in a text."
-msgstr ""
-
-#. i18n: file: wordcompletion/creationsourceui.ui:29
-#. i18n: ectx: property (text), widget (QRadioButton, mergeButton)
-#: rc.cpp:256
-msgid "&Merge dictionaries"
-msgstr "&دمج القواميس"
-
-#. i18n: file: wordcompletion/creationsourceui.ui:32
-#. i18n: ectx: property (whatsThis), widget (QRadioButton, mergeButton)
-#: rc.cpp:259
-msgid ""
-"If you select this box a new dictionary is created by merging existing "
-"dictionaries."
-msgstr ""
-
-#. i18n: file: wordcompletion/creationsourceui.ui:50
-#. i18n: ectx: property (text), widget (QRadioButton, fileButton)
-#: rc.cpp:262
-msgid "From &file"
-msgstr "إنطلاقاً من &الملف"
-
-#. i18n: file: wordcompletion/creationsourceui.ui:53
-#. i18n: ectx: property (whatsThis), widget (QRadioButton, fileButton)
-#: rc.cpp:265
-msgid ""
-"If you select this box a new dictionary is created by loading a file. You "
-"may either select an XML file, a standard text file or a file containing a "
-"word completion dictionary. If you select a standard text file or an XML "
-"file the frequentness of the individual words is detected by simply counting "
-"the occurrences of each word."
-msgstr ""
-
-#. i18n: file: wordcompletion/creationsourceui.ui:71
-#. i18n: ectx: property (text), widget (QRadioButton, kdeDocButton)
-#: rc.cpp:268
-msgid "From &KDE documentation"
-msgstr "من توثيق &KDE"
-
-#. i18n: file: wordcompletion/creationsourceui.ui:77
-#. i18n: ectx: property (whatsThis), widget (QRadioButton, kdeDocButton)
-#: rc.cpp:271
-msgid ""
-"If you select this box a new dictionary is created by parsing the KDE "
-"documentation. The frequentness of the individual words is detect by simply "
-"counting the occurrences of each word."
-msgstr ""
-
-#. i18n: file: wordcompletion/creationsourceui.ui:95
-#. i18n: ectx: property (text), widget (QRadioButton, directoryButton)
-#: rc.cpp:274
-msgid "From f&older"
-msgstr "من &الدليل"
-
-#. i18n: file: wordcompletion/creationsourceui.ui:98
-#. i18n: ectx: property (whatsThis), widget (QRadioButton, directoryButton)
-#: rc.cpp:277
-msgid ""
-"If you select this box a new dictionary is created by loading all files in a "
-"folder and its subdirectories."
-msgstr ""
-
-#. i18n: file: wordcompletion/creationsourceui.ui:121
-#. i18n: ectx: property (text), widget (QRadioButton, emptyButton)
-#: rc.cpp:280
-msgid "Create an &empty wordlist"
-msgstr ""
-
-#. i18n: file: wordcompletion/creationsourceui.ui:124
-#. i18n: ectx: property (whatsThis), widget (QRadioButton, emptyButton)
-#: rc.cpp:283
-msgid ""
-"If you select this box a blank dictionary without any entries is created. As "
-"KMouth automatically adds newly typed words to the dictionaries it will "
-"learn your vocabulary with the time."
-msgstr ""
-
-#. i18n: file: wordcompletion/kdedocsourceui.ui:22
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, spellCheckBox)
-#: rc.cpp:286
-msgid ""
-"If you select this check box the words from the KDE documentation are spell-"
-"checked before they are inserted into the new dictionary."
-msgstr ""
-
-#. i18n: file: wordcompletion/kdedocsourceui.ui:64
-#. i18n: ectx: property (whatsThis), widget (QLabel, languageLabel)
-#: rc.cpp:295
-msgid ""
-"With this combo box you select which of the installed languages is used for "
-"creating the new dictionary. KMouth will only parse documentation files of "
-"this language."
-msgstr ""
-
-#. i18n: file: wordcompletion/wordcompletionui.ui:33
-#. i18n: ectx: property (title), widget (QGroupBox, selectedDictionaryDetails)
-#: rc.cpp:301
-msgid "&Selected Dictionary"
-msgstr "&القاموس المُنتقى"
-
-#. i18n: file: wordcompletion/wordcompletionui.ui:48
-#. i18n: ectx: property (whatsThis), widget (QLabel, languageLabel)
-#: rc.cpp:304
-msgid ""
-"With this combo box you select the language associated with the selected "
-"dictionary."
-msgstr ""
-
-#. i18n: file: wordcompletion/wordcompletionui.ui:61
-#. i18n: ectx: property (whatsThis), widget (QLabel, dictionaryNameLabel)
-#. i18n: file: wordcompletion/wordcompletionui.ui:74
-#. i18n: ectx: property (whatsThis), widget (KLineEdit, dictionaryName)
-#: rc.cpp:310 rc.cpp:316
-msgid ""
-"With this input field you specify the name of the selected dictionary."
-msgstr ""
-
-#. i18n: file: wordcompletion/wordcompletionui.ui:64
-#. i18n: ectx: property (text), widget (QLabel, dictionaryNameLabel)
-#: rc.cpp:313
-msgid "&Name:"
-msgstr "&الإسم:"
-
-#. i18n: file: wordcompletion/wordcompletionui.ui:100
-#. i18n: ectx: property (whatsThis), widget (KPushButton, addButton)
-#: rc.cpp:319
-msgid ""
-"With this button you can add a new dictionary to the list of available "
-"dictionaries."
-msgstr ""
-
-#. i18n: file: wordcompletion/wordcompletionui.ui:103
-#. i18n: ectx: property (text), widget (KPushButton, addButton)
-#: rc.cpp:322
-msgid "Add D&ictionary..."
-msgstr "إضافة قا&موس..."
-
-#. i18n: file: wordcompletion/wordcompletionui.ui:121
-#. i18n: ectx: property (whatsThis), widget (KPushButton, deleteButton)
-#: rc.cpp:325
-msgid "With this button you delete the selected dictionary."
-msgstr ""
-
-#. i18n: file: wordcompletion/wordcompletionui.ui:124
-#. i18n: ectx: property (text), widget (KPushButton, deleteButton)
-#: rc.cpp:328
-msgid "&Delete Dictionary"
-msgstr "&حذف قاموس"
-
-#. i18n: file: wordcompletion/wordcompletionui.ui:142
-#. i18n: ectx: property (whatsThis), widget (KPushButton, moveUpButton)
-#: rc.cpp:331
-msgid "With this button you move the selected dictionary up."
-msgstr ""
-
-#. i18n: file: wordcompletion/wordcompletionui.ui:145
-#. i18n: ectx: property (text), widget (KPushButton, moveUpButton)
-#: rc.cpp:334
-msgid "Move &Up"
-msgstr "التَّحريك &صعوداً"
-
-#. i18n: file: wordcompletion/wordcompletionui.ui:163
-#. i18n: ectx: property (whatsThis), widget (KPushButton, moveDownButton)
-#: rc.cpp:337
-msgid "With this button you move the selected dictionary down."
-msgstr ""
-
-#. i18n: file: wordcompletion/wordcompletionui.ui:166
-#. i18n: ectx: property (text), widget (KPushButton, moveDownButton)
-#: rc.cpp:340
-msgid "&Move Down"
-msgstr "التَّحريك &نزولاً"
-
-#. i18n: file: wordcompletion/wordcompletionui.ui:184
-#. i18n: ectx: property (whatsThis), widget (KPushButton, exportButton)
-#: rc.cpp:343
-msgid "With this button you export the selected dictionary to a file."
-msgstr ""
-
-#. i18n: file: wordcompletion/wordcompletionui.ui:187
-#. i18n: ectx: property (text), widget (KPushButton, exportButton)
-#: rc.cpp:346
-msgid "&Export Dictionary..."
-msgstr "&تصدير القاموس..."
-
-#. i18n: file: wordcompletion/wordcompletionui.ui:212
-#. i18n: ectx: property (whatsThis), widget (K3ListView, dictionaryList)
-#: rc.cpp:349
-msgid ""
-"This list contains all available dictionaries for the word completion. "
-"KMouth will display a combo box next to the edit field in the main window if "
-"this list contains more than one dictionary. You can use this combo box in "
-"order to select the dictionary that actually gets used for the word "
-"completion."
-msgstr ""
-
-#. i18n: file: wordcompletion/wordcompletionui.ui:219
-#. i18n: ectx: property (text), widget (K3ListView, dictionaryList)
-#: rc.cpp:352
-msgid "Dictionary"
-msgstr "القاموس"
-
-#. i18n: file: wordcompletion/wordcompletionui.ui:224
-#. i18n: ectx: property (text), widget (K3ListView, dictionaryList)
-#: rc.cpp:355
-msgid "Language"
-msgstr "اللُّغة"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmplot.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmplot.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kmplot.po	2012-02-23 06:20:34.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kmplot.po	2012-03-23 06:42:07.000000000 +0000
@@ -8,17 +8,15 @@
 "Project-Id-Version: kmplot\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-10 03:49+0000\n"
-"PO-Revision-Date: 2012-01-25 11:02+0000\n"
+"PO-Revision-Date: 2012-03-12 23:08+0000\n"
 "Last-Translator: محمد الحرقان <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:34+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Poedit-Country: SAUDI ARABIA\n"
+"X-Launchpad-Export-Date: 2012-03-23 01:04+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: parameteranimator.cpp:62
 msgid "Parameter Animator"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/knetattach.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/knetattach.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/knetattach.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/knetattach.po	2012-03-23 06:41:58.000000000 +0000
@@ -5,21 +5,21 @@
 # AbdulAziz AlSharif <a.a-a.s@hotmail.com>, 2007.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: knetattach\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2011-12-12 19:28+0000\n"
+"PO-Revision-Date: 2012-03-14 17:29+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:09+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:01+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: knetattach.cpp:89
 msgid ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/knetwalk.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/knetwalk.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/knetwalk.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/knetwalk.po	2012-03-23 06:41:39.000000000 +0000
@@ -2,22 +2,23 @@
 #
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: knetwalk\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:39+0000\n"
-"PO-Revision-Date: 2012-01-25 07:27+0000\n"
-"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
+"PO-Revision-Date: 2012-03-12 22:56+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:49+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:50+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: \n"
 
 #: main.cpp:30
 msgid "KNetWalk, a game for system administrators."
@@ -69,11 +70,11 @@
 
 #: main.cpp:57
 msgid "Brian Croom"
-msgstr ""
+msgstr "Brian Croom"
 
 #: main.cpp:58
 msgid "Port to use the QGraphicsView framework"
-msgstr ""
+msgstr "نقل إلى إطار العمل QGraphicsView"
 
 #: main.cpp:64
 msgid "Start with Easy difficulty level"
@@ -158,12 +159,13 @@
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
 msgstr ""
-"Mohamed SAAD محمد سعد,زايد السعيدي, ,Launchpad Contributions:,metehyi"
+"Mohamed SAAD محمد سعد,زايد السعيدي, ,Launchpad Contributions:,Abdalrahim G. "
+"Fakhouri,metehyi"
 
 #: rc.cpp:14
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "metehyi@free.fr,zayed.alsaidi@gmail.com,,,"
+msgstr "metehyi@free.fr,zayed.alsaidi@gmail.com,,,,"
 
 #. i18n: file: knetwalkui.rc:9
 #. i18n: ectx: ToolBar (mainToolBar)
@@ -191,7 +193,7 @@
 
 #: scene.cpp:93
 msgid "Game is paused."
-msgstr ""
+msgstr "اللعبة متوقفة مؤقتا"
 
 #: scene.cpp:101
 msgid ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/knetworkmanager.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/knetworkmanager.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/knetworkmanager.po	2012-02-23 06:20:24.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/knetworkmanager.po	2012-03-23 06:41:56.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:22+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:32+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 "X-Poedit-Language: Arabic\n"
 "X-Poedit-SourceCharset: utf-8\n"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/knode.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/knode.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/knode.po	2012-02-23 06:20:10.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/knode.po	2012-03-23 06:41:42.000000000 +0000
@@ -8,7 +8,7 @@
 "Project-Id-Version: knode\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 03:45+0000\n"
-"PO-Revision-Date: 2012-01-25 07:13+0000\n"
+"PO-Revision-Date: 2012-03-14 17:38+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
@@ -16,8 +16,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:31+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:13+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: knarticlemanager.cpp:86
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/knotes.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/knotes.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/knotes.po	2012-02-23 06:20:10.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/knotes.po	2012-03-23 06:41:42.000000000 +0000
@@ -8,7 +8,7 @@
 "Project-Id-Version: knotes\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 03:45+0000\n"
-"PO-Revision-Date: 2012-01-26 05:39+0000\n"
+"PO-Revision-Date: 2012-03-14 02:54+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
@@ -16,8 +16,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:31+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:14+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: knote.cpp:135
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/knotify4.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/knotify4.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/knotify4.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/knotify4.po	2012-03-23 06:41:58.000000000 +0000
@@ -14,15 +14,14 @@
 "Project-Id-Version: knotify4\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:44+0000\n"
+"PO-Revision-Date: 2012-03-12 22:37+0000\n"
 "Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:09+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:02+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: ksolidnotify.cpp:148
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kolf.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kolf.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kolf.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kolf.po	2012-03-23 06:41:39.000000000 +0000
@@ -8,7 +8,7 @@
 "Project-Id-Version: kolf\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:39+0000\n"
-"PO-Revision-Date: 2012-01-25 07:27+0000\n"
+"PO-Revision-Date: 2012-03-12 21:56+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
@@ -16,8 +16,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:49+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:50+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: game.cpp:252
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kolourpaint.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kolourpaint.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kolourpaint.po	2012-02-23 06:20:34.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kolourpaint.po	2012-03-23 06:42:07.000000000 +0000
@@ -12,7 +12,7 @@
 "Project-Id-Version: kolourpaint\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-10 03:57+0000\n"
-"PO-Revision-Date: 2011-12-12 17:59+0000\n"
+"PO-Revision-Date: 2012-03-14 17:02+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
@@ -20,8 +20,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:36+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 01:05+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 "X-Poedit-SourceCharset: utf-8\n"
 
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kommander.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kommander.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kommander.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kommander.po	2012-03-23 06:41:43.000000000 +0000
@@ -8,7 +8,7 @@
 "Project-Id-Version: kommander\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 15:07+0000\n"
-"PO-Revision-Date: 2012-01-25 08:38+0000\n"
+"PO-Revision-Date: 2012-03-13 11:18+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
@@ -16,8 +16,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:20+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:36+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: editor/formfile.cpp:114
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kompare.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kompare.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kompare.po	2012-02-23 06:20:11.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kompare.po	2012-03-23 06:41:43.000000000 +0000
@@ -4,21 +4,22 @@
 # Nuriddin S. Aminagha <nuriddin@haydarlinux.org>, 2003.
 # Ahmad M. Zawawi <azawawi@emirates.net.ae>, 2004.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kompare\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 16:09+0000\n"
-"PO-Revision-Date: 2011-01-06 03:03+0000\n"
-"Last-Translator: Youssef Chahibi <Unknown>\n"
-"Language-Team: <en@li.org>\n"
+"PO-Revision-Date: 2012-03-12 22:59+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:52+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:24+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kompare_shell.cpp:81
@@ -1000,13 +1001,13 @@
 msgid "Your names"
 msgstr ""
 "Isam Bayazidi, Nuriddin Aminagha,أحمد محمد زواوي, ,Launchpad "
-"Contributions:,Ahmad M. Zawawi"
+"Contributions:,Abdalrahim G. Fakhouri,Ahmad M. Zawawi"
 
 #: rc.cpp:11
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
 msgstr ""
-"bayazidi@arabeyes.org, nuriddin@haydarlinux.org,azawawi@emirates.net.ae,,,"
+"bayazidi@arabeyes.org, nuriddin@haydarlinux.org,azawawi@emirates.net.ae,,,,"
 
 #. i18n: file: kompareui.rc:4
 #. i18n: ectx: Menu (file)
@@ -1112,4 +1113,4 @@
 #. i18n: ectx: property (text), widget (QRadioButton, m_SideBySideRB)
 #: rc.cpp:89
 msgid "Side-by-side"
-msgstr "جنبًا إلى جنبًا"
+msgstr "جنبًا إلى جنب"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/konqueror.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/konqueror.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/konqueror.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/konqueror.po	2012-03-23 06:42:00.000000000 +0000
@@ -1,6 +1,8 @@
 # translation of konqueror.po to Arabic
 # translation of konqueror.po to
 # Copyright (C) 2001,2002,2003, 2004, 2006, 2007, 2008, 2009 Free Software Foundation, Inc.
+#
+#
 # Mohammed Gamal <f2c2001@yahoo.com>, 2001.
 # Sayed Jaffer Al-Mosawi <mosawi@arabeyes.org>, 2002.
 # Isam Bayazidi <bayazidi@arabeyes.org>, 2002.
@@ -11,26 +13,23 @@
 # عبدالعزيز الشريف <a.a-a.s@hotmail.com>, 2007.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008, 2009.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-#
-#
+# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: konqueror\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2012-01-25 11:01+0000\n"
+"PO-Revision-Date: 2012-03-12 22:33+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:47+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:24+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: src/konqmainwindow.cpp:577
 msgctxt "@title:tab"
@@ -55,7 +54,7 @@
 #: src/konqmainwindow.cpp:4987 src/konqviewmanager.cpp:1427
 msgctxt "@title:window"
 msgid "Discard Changes?"
-msgstr ""
+msgstr "إهمال التغييرات؟"
 
 #: src/konqmainwindow.cpp:1679 src/konqmainwindow.cpp:2401
 #: src/konqmainwindow.cpp:2425 src/konqmainwindow.cpp:2515
@@ -139,7 +138,7 @@
 #: src/konqmainwindow.cpp:2487
 msgctxt "@title:window"
 msgid "Close Other Tabs Confirmation"
-msgstr ""
+msgstr "تأكيد إغلاق الألسنة الأخرى"
 
 #: src/konqmainwindow.cpp:2589 src/konqmainwindow.cpp:3710
 #: src/konqtabs.cpp:357
@@ -165,7 +164,7 @@
 #: src/konqmainwindow.cpp:2567
 msgctxt "@title:window"
 msgid "Enter Target"
-msgstr ""
+msgstr "أدخل الهدف"
 
 #: src/konqmainwindow.cpp:2693
 #, kde-format
@@ -354,7 +353,7 @@
 
 #: src/konqmainwindow.cpp:3669
 msgid "Throbber"
-msgstr ""
+msgstr "الشعار"
 
 #: src/konqmainwindow.cpp:3811 src/konqmainwindow.cpp:3814
 msgid "L&ocation: "
@@ -577,7 +576,7 @@
 #: src/konqmainwindow.cpp:4374
 msgctxt "@title:window"
 msgid "Open bookmarks folder in new tabs"
-msgstr ""
+msgstr "افتح مجلد العلامات في ألسنة جديدة"
 
 #: src/konqmainwindow.cpp:4642
 msgid "Open in T&his Window"
@@ -627,7 +626,7 @@
 #: src/konqmainwindow.cpp:4952 src/konqviewmanager.cpp:1413
 msgctxt "@title:window"
 msgid "Confirmation"
-msgstr ""
+msgstr "تأكيد"
 
 #: src/konqmainwindow.cpp:5051
 msgid "C&lose Current Tab"
@@ -662,7 +661,7 @@
 #: src/konqmainwindow.cpp:5152 src/konqmainwindow.cpp:5159
 msgctxt "@title:window"
 msgid "Web Sidebar"
-msgstr ""
+msgstr "شريط الوب الجانبي"
 
 #: src/konqmainwindow.cpp:5258
 #, kde-format
@@ -689,15 +688,15 @@
 #: src/konqprofiledlg.cpp:111
 msgctxt "@title:window"
 msgid "Profile Management"
-msgstr ""
+msgstr "إدارة التشكيلة"
 
 #: src/konqprofiledlg.cpp:115
 msgid "&Rename Profile"
-msgstr "أعد ت&سمية الملف الشخصي"
+msgstr "أعد ت&سمية التشكيلة"
 
 #: src/konqprofiledlg.cpp:116
 msgid "&Delete Profile"
-msgstr "اح&ذف الملف الشخصي"
+msgstr "اح&ذف التشكيلة"
 
 #: src/konqsessionmanager.cpp:343
 msgid ""
@@ -708,7 +707,7 @@
 #: src/konqsessionmanager.cpp:332
 msgctxt "@title:window"
 msgid "Restore Session?"
-msgstr ""
+msgstr "استعد الجلسة؟"
 
 #: src/konqsessionmanager.cpp:346
 msgid "Restore Session"
@@ -754,7 +753,7 @@
 
 #: src/konqmain.cpp:110
 msgid "Part to use (e.g. khtml or kwebkitpart)"
-msgstr ""
+msgstr "الجزء المستعمل (khtml أو kwebkitpart)"
 
 #: src/konqmain.cpp:66
 msgid ""
@@ -771,7 +770,7 @@
 #: src/konqextensionmanager.cpp:54
 msgctxt "@title:window"
 msgid "Configure"
-msgstr ""
+msgstr "اضبط"
 
 #: src/konqextensionmanager.cpp:75 src/konqextensionmanager.cpp:78
 #: src/konqextensionmanager.cpp:79
@@ -855,7 +854,7 @@
 #: src/konqview.cpp:1205
 msgctxt "@title:window"
 msgid "Warning"
-msgstr ""
+msgstr "تحذير"
 
 #: src/konqview.cpp:1235
 msgid "Resend"
@@ -881,7 +880,7 @@
 #: src/konqsessiondlg.cpp:77
 msgctxt "@title:window"
 msgid "Manage Sessions"
-msgstr ""
+msgstr "أدر الجلسات"
 
 #: src/konqsessiondlg.cpp:83
 msgid "&Open"
@@ -890,12 +889,12 @@
 #: src/konqsessiondlg.cpp:175
 msgctxt "@title:window"
 msgid "Rename Session"
-msgstr ""
+msgstr "أعد تسمية الجلسة"
 
 #: src/konqsessiondlg.cpp:223
 msgctxt "@title:window"
 msgid "Save Session"
-msgstr ""
+msgstr "احفظ الجلسة"
 
 #: src/konqsessiondlg.cpp:253
 #, kde-format
@@ -906,7 +905,7 @@
 #: src/konqsessiondlg.cpp:248
 msgctxt "@title:window"
 msgid "Session exists. Overwrite?"
-msgstr ""
+msgstr "الجلسة موجودة. أأكتب عليها؟"
 
 #: src/konqguiclients.cpp:66
 #, kde-format
@@ -958,7 +957,7 @@
 #: src/konqhistoryview.cpp:172 sidebar/history_module/kcmhistory.cpp:256
 msgctxt "@title:window"
 msgid "Clear History?"
-msgstr ""
+msgstr "أأمحو التاريخ؟"
 
 #: src/konqfactory.cpp:90
 #, kde-format
@@ -1298,19 +1297,27 @@
 #: sidebar/web_module/web_module.cpp:137
 msgctxt "@title:window"
 msgid "Set Refresh Timeout (0 disables)"
-msgstr ""
+msgstr "عيّن مهلة الإنعاش (0 يعطله)"
 
 #: sidebar/web_module/web_module.cpp:145
 msgid " minute"
 msgid_plural " minutes"
 msgstr[0] ""
-msgstr[1] ""
+msgstr[1] " دقيقة"
+msgstr[2] " دقيقتان"
+msgstr[3] " دقائق"
+msgstr[4] " دقيقةً"
+msgstr[5] " دقيقة"
 
 #: sidebar/web_module/web_module.cpp:148
 msgid " second"
 msgid_plural " seconds"
-msgstr[0] ""
-msgstr[1] ""
+msgstr[0] " ث"
+msgstr[1] " ث"
+msgstr[2] " ث"
+msgstr[3] " ث"
+msgstr[4] " ث"
+msgstr[5] " ث"
 
 #: sidebar/web_module/web_module.cpp:280
 msgctxt "@action:inmenu Add"
@@ -1386,7 +1393,7 @@
 #: sidebar/trees/konq_sidebartree.cpp:955
 msgctxt "@title:window"
 msgid "Create New Folder"
-msgstr ""
+msgstr "أنشئ مجلدًا جديدًا"
 
 #: sidebar/trees/konq_sidebartree.cpp:959
 msgid "Enter folder name:"
@@ -1430,17 +1437,17 @@
 #: sidebar/trees/bookmark_module/bookmark_module.cpp:337
 msgctxt "@title:window"
 msgid "Bookmark Folder Deletion"
-msgstr ""
+msgstr "حذف مجلد العلامات"
 
 #: sidebar/trees/bookmark_module/bookmark_module.cpp:338
 msgctxt "@title:window"
 msgid "Bookmark Deletion"
-msgstr ""
+msgstr "حذف العلامة"
 
 #: sidebar/trees/bookmark_module/bookmark_module.cpp:380
 msgctxt "@title:window"
 msgid "Bookmark Properties"
-msgstr ""
+msgstr "خصائص العلامة"
 
 #: sidebar/trees/bookmark_module/bookmark_module.cpp:565
 msgid "&Update"
@@ -1457,7 +1464,7 @@
 #: sidebar/trees/bookmark_module/bookmark_module.h:88
 msgctxt "@title:window"
 msgid "Add Bookmark"
-msgstr ""
+msgstr "أضف علامة"
 
 #: sidebar/sidebar_widget.cpp:94
 msgid "Rollback to System Default"
@@ -1507,7 +1514,7 @@
 #: sidebar/sidebar_widget.cpp:287
 msgctxt "@title:window"
 msgid "Set Name"
-msgstr ""
+msgstr "عيّن اسم"
 
 #: sidebar/sidebar_widget.cpp:287
 msgid "Enter the name:"
@@ -1671,7 +1678,7 @@
 
 #: about/konq_aboutpage.cc:118
 msgid "Bookmarks"
-msgstr ""
+msgstr "العلامات"
 
 #: about/konq_aboutpage.cc:104
 msgid "Quick access to your bookmarks"
@@ -1824,6 +1831,8 @@
 "JDK 1.2.0 (Java 2) compatible VM (<A HREF=\"%1\">IBM</A> or <A "
 "HREF=\"%2\">Sun/Oracle</A>)"
 msgstr ""
+"JDK 1.2.0 (Java 2) compatible VM (<A HREF=\"%1\">IBM</A> or <A "
+"HREF=\"%2\">Sun/Oracle</A>)"
 
 #: about/konq_aboutpage.cc:234
 #, kde-format
@@ -1884,7 +1893,7 @@
 
 #: about/konq_aboutpage.cc:237
 msgid "PNG<br />JPG<br />GIF"
-msgstr ""
+msgstr "PNG<br />JPG<br />GIF"
 
 #: about/konq_aboutpage.cc:252
 msgid "Transfer protocols"
@@ -1902,6 +1911,7 @@
 #, kde-format
 msgid "and <A HREF=\"%1\">many more (see Kioslaves in KHelpcenter)...</A>"
 msgstr ""
+"و<A HREF=\"%1\">غيرها الكثير (انظر Kioslaves في KHelpcenter ) ...</A>"
 
 #: about/konq_aboutpage.cc:256
 msgctxt "A feature of Konqueror"
@@ -1952,6 +1962,8 @@
 "Use the magnifier button <img width='16' height='16' src=\"%1\"></img> in "
 "the HTML toolbar to increase the font size on your web page."
 msgstr ""
+"استعمل زر المكبر <img width='16' height='16' src=\"%1\"></img> في  شريط "
+"الأدوات لتزيد من مقاس الخط في صفحة الوب."
 
 #: about/konq_aboutpage.cc:318
 #, kde-format
@@ -1970,6 +1982,8 @@
 "the icon (favicon) that is to the left of the Location toolbar, drop it on "
 "to the desktop, and choose \"Icon\"."
 msgstr ""
+"لإنشاء وصلة في سطح مكتبك للصفحة الحالية، اسحب بكل بساطة لصيقة \"الموقع\"، "
+"الموجودة على يسار شريط أدوات الموقع، ثم ألقها على سطح مكتبك واختر \"أيقونة\"."
 
 #: about/konq_aboutpage.cc:325
 #, kde-format
@@ -2011,6 +2025,8 @@
 "The <img width='16' height='16' src=\"%1\"></img> History in your Sidebar "
 "ensures that you can keep track of the pages you have visited recently."
 msgstr ""
+"<img width='16' height='16' src=\"%1\"></img> التاريخ في الشريط الجانبي يضمن "
+"لك أن تتبع صفحات التي قمت بزيارتها مؤخرا."
 
 #: about/konq_aboutpage.cc:338
 #, kde-format
@@ -2057,7 +2073,7 @@
 #: about/konq_aboutpage.cc:465
 msgctxt "@title:window"
 msgid "Faster Startup?"
-msgstr ""
+msgstr "بدء تشغيل أسرع؟"
 
 #: about/konq_aboutpage.cc:489
 msgid "Disable"
@@ -2365,6 +2381,9 @@
 "and in the file manager's menus and context menus. You can always delete "
 "files when hidden by holding the Shift key while calling 'Move to Trash'."
 msgstr ""
+"اختياره إذا رغبت أن تعرض أمر القائمة 'احذف' في سطح المكتب وقوائم مدير "
+"الملفات وقوائم السياق. سوف تتمكن من حذف الملفات بضغط زر Shift أثناء نقر "
+"'انقل إلى المهملات'."
 
 #. i18n: file: src/konqueror.kcfg:149
 #. i18n: ectx: label, entry, group (FMSettings)
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/konquest.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/konquest.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/konquest.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/konquest.po	2012-03-23 06:41:39.000000000 +0000
@@ -10,7 +10,7 @@
 "Project-Id-Version: konquest\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:39+0000\n"
-"PO-Revision-Date: 2012-01-25 07:27+0000\n"
+"PO-Revision-Date: 2012-03-12 21:56+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
@@ -18,8 +18,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:50+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:51+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: Konquest.cc:30
 msgid "Galactic Strategy KDE Game"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/konsolekalendar.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/konsolekalendar.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/konsolekalendar.po	2012-02-23 06:20:10.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/konsolekalendar.po	2012-03-23 06:41:42.000000000 +0000
@@ -9,14 +9,14 @@
 "Project-Id-Version: konsolekalendar\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 03:45+0000\n"
-"PO-Revision-Date: 2012-01-25 07:25+0000\n"
+"PO-Revision-Date: 2012-03-14 02:46+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:32+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:14+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: konsolekalendar.cpp:85
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/konsole.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/konsole.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/konsole.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/konsole.po	2012-03-23 06:42:01.000000000 +0000
@@ -1,6 +1,8 @@
 # translation of konsole.po to Arabic
 # translation of konsole.po to
 # Copyright (C) 2001,2002, 2004, 2006, 2007, 2008 Free Software Foundation, Inc.
+#
+#
 # Mohammed Gamal <f2c2001@yahoo.com>, 2001.
 # Sayed Jaffer Al-Mosawi <mosawi@arabeyes.org>, 2002.
 # Isam Bayazidi <bayazidi@arabeyes.org>, 2002.
@@ -9,23 +11,22 @@
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
 # Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-#
-#
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: konsole\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 17:24+0000\n"
-"PO-Revision-Date: 2012-01-25 10:58+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-12 22:32+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:16+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:41+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: BookmarkHandler.cpp:134
@@ -386,7 +387,7 @@
 #: ManageProfilesDialog.cpp:219
 msgctxt "@title:column Profile shortcut text"
 msgid "Shortcut"
-msgstr "إختصار"
+msgstr "اختصار"
 
 #: ManageProfilesDialog.cpp:347
 msgctxt "@item This will be used as part of the file name"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kontactinterfaces.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kontactinterfaces.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kontactinterfaces.po	2012-02-23 06:20:17.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kontactinterfaces.po	2012-03-23 06:41:47.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:04+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:18+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: rc.cpp:1
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kontact.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kontact.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kontact.po	2012-02-23 06:20:10.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kontact.po	2012-03-23 06:41:42.000000000 +0000
@@ -9,7 +9,7 @@
 "Project-Id-Version: kontact\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 03:45+0000\n"
-"PO-Revision-Date: 2011-12-12 18:09+0000\n"
+"PO-Revision-Date: 2012-03-14 17:38+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
@@ -17,8 +17,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:33+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:14+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: rc.cpp:1
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/konversation.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/konversation.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/konversation.po	2012-02-23 06:20:13.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/konversation.po	2012-03-23 06:41:44.000000000 +0000
@@ -17,8 +17,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:44+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:37+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: src/queuetuner.cpp:241
 msgid "Reset..."
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kopete.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kopete.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kopete.po	2012-02-23 06:20:09.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kopete.po	2012-03-23 06:41:41.000000000 +0000
@@ -7,21 +7,22 @@
 # OsamaKhalid <osamak.wfm@gmail.com>, 2009.
 # zayed <zayed.alsaidi@gmail.com>, 2009.
 # محمد الحرقان <malham1@gmail.com>, 2010.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kopete\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 21:45+0000\n"
-"PO-Revision-Date: 2011-01-26 03:54+0000\n"
-"Last-Translator: Youssef Chahibi <Unknown>\n"
-"Language-Team: Arabeyes\n"
+"PO-Revision-Date: 2012-03-12 22:59+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:12+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:01+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: plugins/privacy/privacyplugin.cpp:52
@@ -174,7 +175,7 @@
 
 #: plugins/otr/authenticationwizard.cpp:78
 msgid "Close"
-msgstr ""
+msgstr "أغلق"
 
 #: plugins/otr/authenticationwizard.cpp:102
 msgctxt "@title"
@@ -1772,7 +1773,7 @@
 
 #: protocols/wlm/wlmchatsessioninkarea.cpp:54
 msgid "Select the pen's color"
-msgstr ""
+msgstr "اختر لون القلم"
 
 #: protocols/wlm/wlmcontact.cpp:59
 msgid "Block Contact"
@@ -1878,7 +1879,7 @@
 #: libkopete/private/kopeteviewmanager.cpp:412
 msgctxt "@action"
 msgid "Close"
-msgstr ""
+msgstr "أغلق"
 
 #: protocols/wlm/wlmaccount.cpp:1173
 #, kde-format
@@ -9321,7 +9322,7 @@
 
 #: libkopete/avdevice/dummy-V4L2apiCustomStrings.cpp:137
 msgid "Color Filter"
-msgstr ""
+msgstr "مرشّح الألوان"
 
 #. i18n: Transaction Time (msec)
 #: libkopete/avdevice/dummy-V4L2apiCustomStrings.cpp:139
@@ -9344,7 +9345,7 @@
 
 #: libkopete/avdevice/dummy-V4L2apiCustomStrings.cpp:152
 msgid "Quality"
-msgstr ""
+msgstr "الجودة"
 
 #: libkopete/avdevice/dummy-V4L2apiCustomStrings.cpp:157
 msgid "Off"
@@ -9362,7 +9363,7 @@
 
 #: libkopete/avdevice/dummy-V4L2apiCustomStrings.cpp:163
 msgid "On"
-msgstr ""
+msgstr "يعمل"
 
 #: libkopete/avdevice/videodevice.cpp:128
 #: libkopete/avdevice/videodevice.cpp:3043
@@ -11128,16 +11129,17 @@
 msgstr ""
 "فريق عرب آيز <www.arabeyes.org>\n"
 "محمد سعد\n"
-"أسامة خالد, ,Launchpad Contributions:,Ahmad Farghal,Khalid Al-"
-"Musaihij,Myamen,Osama Khalid,Youssef Chahibi,Zayed Amer Al-Saidi"
+"أسامة خالد, ,Launchpad Contributions:,Abdalrahim G. Fakhouri,Ahmad "
+"Farghal,Khalid Al-Musaihij,Myamen,Osama Khalid,Youssef Chahibi,Zayed Amer Al-"
+"Saidi"
 
 #: kopete/main.cpp:83 rc.cpp:2 rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
 msgstr ""
 "metehyi@free.fr\n"
-"osamak.wfm@gmail.com,,,,khalid@linux4me.org,yamencss@gmail.com,osamak.wfm@gma"
-"il.com,,zayed.alsaidi@gmail.com"
+"osamak.wfm@gmail.com,,,,,khalid@linux4me.org,yamencss@gmail.com,osamak.wfm@gm"
+"ail.com,,zayed.alsaidi@gmail.com"
 
 #: kopete/main.cpp:88
 msgid "Do not load plugins. This option overrides all other options."
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/korganizer.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/korganizer.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/korganizer.po	2012-02-23 06:20:10.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/korganizer.po	2012-03-23 06:41:42.000000000 +0000
@@ -19,8 +19,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:33+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:15+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kdatenavigator.cpp:202
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kpartsaver.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kpartsaver.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kpartsaver.po	2012-02-23 06:20:06.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kpartsaver.po	2012-03-23 06:41:38.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:36+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:42+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kpartsaver.cpp:86
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kpasswdserver.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kpasswdserver.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kpasswdserver.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kpasswdserver.po	2012-03-23 06:41:58.000000000 +0000
@@ -14,10 +14,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:10+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:02+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
-"X-Poedit-Language: Arabic\n"
 
 #: kpasswdserver.cpp:535
 msgid "Do you want to retry?"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kpat.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kpat.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kpat.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kpat.po	2012-03-23 06:41:39.000000000 +0000
@@ -17,8 +17,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:51+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:51+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: clock.cpp:150
 msgid "Grandfather's Clock"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kppplogview.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kppplogview.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kppplogview.po	2012-02-23 06:20:09.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kppplogview.po	2012-03-23 06:41:41.000000000 +0000
@@ -21,8 +21,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:16+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:04+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: export.cpp:39
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kppp.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kppp.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kppp.po	2012-02-23 06:20:09.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kppp.po	2012-03-23 06:41:41.000000000 +0000
@@ -20,11 +20,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:15+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:04+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
-"X-Poedit-SourceCharset: utf-8\n"
 
 #: accounts.cpp:77 modems.cpp:78
 msgid "&Edit..."
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kquitapp.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kquitapp.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kquitapp.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kquitapp.po	2012-03-23 06:41:58.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:11+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:03+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kquitapp.cpp:28
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/krandr.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/krandr.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/krandr.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/krandr.po	2012-03-23 06:42:03.000000000 +0000
@@ -14,16 +14,16 @@
 "Project-Id-Version: krandr\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:15+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-14 17:06+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:04+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:10+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: krandrmodule.cpp:46
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/krcdnotifieritem.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/krcdnotifieritem.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/krcdnotifieritem.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/krcdnotifieritem.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,101 +0,0 @@
-# Copyright (C) YEAR This_file_is_part_of_KDE
-# This file is distributed under the same license as the PACKAGE package.
-#
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-msgid ""
-msgstr ""
-"Project-Id-Version: \n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 13:31+0000\n"
-"PO-Revision-Date: 2010-08-09 20:07+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:10+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-
-#: krcdnotifieritem.cpp:52
-msgid "Remote Controls\n"
-msgstr "أجهزة التحكم عن بعد\n"
-
-#: krcdnotifieritem.cpp:56
-msgctxt "The state of kremotecontrol"
-msgid "Stopped"
-msgstr "موقوف"
-
-#: krcdnotifieritem.cpp:57
-msgid "No Remote Control is currently available."
-msgstr "لا يوجد جهاز تحكم عن بعد حاليا."
-
-#: krcdnotifieritem.cpp:61
-msgctxt "The state of kremotecontrol"
-msgid "Ready"
-msgstr "جاهز"
-
-#: krcdnotifieritem.cpp:74
-msgid "Remote Controls"
-msgstr ""
-
-#: krcdnotifieritem.cpp:75
-msgid "&Configure..."
-msgstr "ا&ضبط..."
-
-#: krcdnotifieritem.cpp:81
-msgid "Switch mode to"
-msgstr "بدل النمط إلى"
-
-#: krcdnotifieritem.cpp:93
-msgid "Pause remote"
-msgstr "أوقف مؤقتا التحكم"
-
-#: main.cpp:67
-msgid "Remote Control"
-msgstr "التحكم عن بعد"
-
-#: main.cpp:67
-msgid "The KDE Infrared Remote Control Server"
-msgstr "خادم كدى للتحكم عن بعد بالأشعة تحت الحمراء"
-
-#: main.cpp:67
-msgid "(c) 2010 Michael Zanetti, (c) 2010 Frank Scheffold"
-msgstr "(c) 2010 Michael Zanetti, (c) 2010 Frank Scheffold"
-
-#: main.cpp:67
-msgid "Control your desktop with your remote."
-msgstr "تحكم بسطح مكتب عن بعد"
-
-#: main.cpp:68
-msgid "Michael Zanetti"
-msgstr "Michael Zanetti"
-
-#: main.cpp:68
-msgid "Maintainer"
-msgstr "المشرف"
-
-#: main.cpp:69
-msgid "Frank Scheffold"
-msgstr "Frank Scheffold"
-
-#: main.cpp:69
-msgid "KDeveloper"
-msgstr "KDeveloper"
-
-#: main.cpp:70
-msgid "Gav Wood"
-msgstr "Gav Wood"
-
-#: main.cpp:70
-msgid "Original KDELirc Author"
-msgstr "المؤلف الأصلي لKDELirc"
-
-#: rc.cpp:1
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr "زايد السعيدي, ,Launchpad Contributions:,Zayed Amer Al-Saidi"
-
-#: rc.cpp:2
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr "zayed.alsaidi@gmail.com,,,zayed.alsaidi@gmail.com"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/krdc.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/krdc.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/krdc.po	2012-02-23 06:20:09.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/krdc.po	2012-03-23 06:41:41.000000000 +0000
@@ -13,7 +13,7 @@
 "Project-Id-Version: krdc\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 21:45+0000\n"
-"PO-Revision-Date: 2012-01-25 07:33+0000\n"
+"PO-Revision-Date: 2012-03-12 21:58+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
@@ -21,8 +21,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:17+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:04+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: bookmarkmanager.cpp:53
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kreadconfig.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kreadconfig.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kreadconfig.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kreadconfig.po	2012-03-23 06:41:58.000000000 +0000
@@ -12,16 +12,15 @@
 "Project-Id-Version: kreadconfig\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-26 13:03+0000\n"
+"PO-Revision-Date: 2012-03-14 17:31+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:12+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:03+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kreadconfig.cpp:54
 msgid "KReadConfig"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kremotecontroldaemon.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kremotecontroldaemon.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kremotecontroldaemon.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kremotecontroldaemon.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,92 +0,0 @@
-# Copyright (C) YEAR This_file_is_part_of_KDE
-# This file is distributed under the same license as the PACKAGE package.
-#
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-msgid ""
-msgstr ""
-"Project-Id-Version: \n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 13:31+0000\n"
-"PO-Revision-Date: 2010-08-09 20:06+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:10+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-
-#: kremotecontroldaemon.cpp:51
-msgid "K Remote Control Daemon"
-msgstr "رقيب التحكم عن بعد ك"
-
-#: kremotecontroldaemon.cpp:52
-msgid "Remote Control Daemon for KDE4"
-msgstr "رقيب التحكم عن بعد لكدي 4"
-
-#: kremotecontroldaemon.cpp:53
-msgid "(c) 2010 Frank Scheffold"
-msgstr "(c) 2010 Frank Scheffold"
-
-#: kremotecontroldaemon.cpp:56
-msgid "Michael Zanetti"
-msgstr "Michael Zanetti"
-
-#: kremotecontroldaemon.cpp:56
-msgid "Maintainer"
-msgstr "المشرف"
-
-#: kremotecontroldaemon.cpp:57
-msgid "Frank Scheffold"
-msgstr "Frank Scheffold"
-
-#: kremotecontroldaemon.cpp:57
-msgid "Developer"
-msgstr "المطور"
-
-#: kremotecontroldaemon.cpp:58
-msgid "Gav Wood"
-msgstr "Gav Wood"
-
-#: kremotecontroldaemon.cpp:58
-msgid "Original KDELirc Developer"
-msgstr "المطور الأصلي لـKDELirc"
-
-#: kremotecontroldaemon.cpp:160
-msgid "Configuration reloaded."
-msgstr "أعيد تحميل الضبط."
-
-#: kremotecontroldaemon.cpp:201
-#, kde-format
-msgid "The remote control %1 is now available."
-msgstr "جهاز التحكم عن بعد %1 متوفر."
-
-#: kremotecontroldaemon.cpp:204
-#, kde-format
-msgid "An unconfigured remote control %1 is now available."
-msgstr "جهاز التحكم عن بعد %1 غير المضبوط متوفر."
-
-#: kremotecontroldaemon.cpp:206
-msgctxt "Configure the remote"
-msgid "Configure remote"
-msgstr "اضبط جهاز التحكم"
-
-#: kremotecontroldaemon.cpp:218
-#, kde-format
-msgid "The remote %1 was removed from system."
-msgstr "جهاز التحكم %1 أزيل من النظام."
-
-#: kremotecontroldaemon.cpp:257 kremotecontroldaemon.cpp:263
-#, kde-format
-msgid "Mode switched to %1"
-msgstr "بدل النمط إلى %1"
-
-#: rc.cpp:1
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr "زايد السعيدي, ,Launchpad Contributions:,Zayed Amer Al-Saidi"
-
-#: rc.cpp:2
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr "zayed.alsaidi@gmail.com,,,zayed.alsaidi@gmail.com"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kres_groupwise.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kres_groupwise.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kres_groupwise.po	2012-02-23 06:20:10.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kres_groupwise.po	2012-03-23 06:41:42.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:35+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:16+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kabc_resourcegroupwise.cpp:208
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kres_remote.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kres_remote.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kres_remote.po	2012-02-23 06:20:10.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kres_remote.po	2012-03-23 06:41:42.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:36+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:17+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: resourceremote.cpp:205
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kreversi.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kreversi.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kreversi.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kreversi.po	2012-03-23 06:41:39.000000000 +0000
@@ -8,14 +8,14 @@
 "Project-Id-Version: kreversi\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:39+0000\n"
-"PO-Revision-Date: 2012-01-25 07:26+0000\n"
+"PO-Revision-Date: 2012-03-12 21:55+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:51+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:51+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: highscores.cpp:48
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/krfb.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/krfb.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/krfb.po	2012-02-23 06:20:09.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/krfb.po	2012-03-23 06:41:41.000000000 +0000
@@ -20,8 +20,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:17+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:05+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: connectiondialog.cpp:35
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kruler.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kruler.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kruler.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kruler.po	2012-03-23 06:42:00.000000000 +0000
@@ -6,27 +6,27 @@
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # hayig2000 <hayig2000@gmail.com>, 2008.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
 # OsamaKhalid <osamak.wfm@gmail.com>, 2009.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
 msgid ""
 msgstr ""
 "Project-Id-Version: kruler\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-10 04:01+0000\n"
-"PO-Revision-Date: 2011-12-12 18:01+0000\n"
+"PO-Revision-Date: 2012-03-14 17:01+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:58+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:30+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: \n"
 
 #: klineal.cpp:96
 msgctxt "@title:window"
 msgid "KRuler"
-msgstr ""
+msgstr "مسطرة ك"
 
 #: klineal.cpp:99
 msgid ""
@@ -168,7 +168,7 @@
 #: klineal.cpp:587
 msgctxt "@title:window"
 msgid "Scale Offset"
-msgstr ""
+msgstr "إزاحة القياس"
 
 #: klineal.cpp:587
 msgid "Offset:"
@@ -177,7 +177,7 @@
 #: klineal.cpp:604
 msgctxt "@title:window"
 msgid "Ruler Length"
-msgstr ""
+msgstr "طول المسطرة"
 
 #: klineal.cpp:604
 msgid "Length:"
@@ -207,7 +207,7 @@
 
 #: main.cpp:29
 msgid "A screen ruler for KDE"
-msgstr ""
+msgstr "مسطرة شاشة لكدي"
 
 #: main.cpp:31
 msgid ""
@@ -245,12 +245,14 @@
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
 msgstr ""
-"hayig2000,زايد السعيدي, ,Launchpad Contributions:,Munzir Taha,metehyi"
+"hayig2000,زايد السعيدي, ,Launchpad Contributions:,Munzir Taha,Zayed Amer Al-"
+"Saidi,metehyi"
 
 #: rc.cpp:59
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "hayig2000@gmail.com,zayed.alsaidi@gmail.com,,,,"
+msgstr ""
+"hayig2000@gmail.com,zayed.alsaidi@gmail.com,,,,zayed.alsaidi@gmail.com,"
 
 #. i18n: file: cfg_advanced.ui:23
 #. i18n: ectx: property (toolTip), widget (QCheckBox, kcfg_NativeMoving)
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/krunner.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/krunner.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/krunner.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/krunner.po	2012-03-23 06:42:03.000000000 +0000
@@ -11,7 +11,7 @@
 "Project-Id-Version: krunner\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:16+0000\n"
+"PO-Revision-Date: 2012-03-12 22:24+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
@@ -19,8 +19,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:06+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:11+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: lock/main.cc:61
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksaneplugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksaneplugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksaneplugin.po	2012-02-23 06:20:34.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksaneplugin.po	2012-03-23 06:42:07.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:39+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 01:07+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: sanedialog.cpp:70
 msgid "Opening the selected scanner failed."
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kscd.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kscd.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kscd.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kscd.po	2012-03-23 06:41:40.000000000 +0000
@@ -14,14 +14,14 @@
 "Project-Id-Version: kscd\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:45+0000\n"
-"PO-Revision-Date: 2011-12-12 19:14+0000\n"
+"PO-Revision-Date: 2012-03-14 17:37+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:06+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:58+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: kscd.cpp:41
 msgid "KDE CD player"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kscreensaver.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kscreensaver.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kscreensaver.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kscreensaver.po	2012-03-23 06:42:03.000000000 +0000
@@ -16,10 +16,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:07+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:11+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
-"X-Poedit-Language: Arabic\n"
 
 #: random.cpp:45
 #, kde-format
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksendemail.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksendemail.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksendemail.po	2012-02-23 06:20:10.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksendemail.po	2012-03-23 06:41:42.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:36+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:17+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: mailerservice.cpp:207
 msgid "Cannot connect to email service."
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kshellcmdplugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kshellcmdplugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kshellcmdplugin.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kshellcmdplugin.po	2012-03-23 06:42:00.000000000 +0000
@@ -1,6 +1,8 @@
 # translation of konqueror.po to Arabic
 # translation of konqueror.po to
 # Copyright (C) 2001,2002,2003, 2004, 2006, 2007, 2008, 2009 Free Software Foundation, Inc.
+#
+#
 # Mohammed Gamal <f2c2001@yahoo.com>, 2001.
 # Sayed Jaffer Al-Mosawi <mosawi@arabeyes.org>, 2002.
 # Isam Bayazidi <bayazidi@arabeyes.org>, 2002.
@@ -12,23 +14,21 @@
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008, 2009.
 # Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-#
-#
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: konqueror\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2012-01-26 00:02+0000\n"
+"PO-Revision-Date: 2012-03-14 00:11+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:49+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:25+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kshellcmdexecutor.cpp:124
 msgid "Input Required:"
@@ -51,7 +51,7 @@
 #: kshellcmdplugin.cpp:76
 msgctxt "@title:window"
 msgid "Execute Shell Command"
-msgstr ""
+msgstr "ن&فذ أمر الصدَفة"
 
 #: kshellcmdplugin.cpp:77
 msgid "Execute shell command in current directory:"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kshisen.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kshisen.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kshisen.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kshisen.po	2012-03-23 06:41:39.000000000 +0000
@@ -8,14 +8,14 @@
 "Project-Id-Version: kshisen\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:39+0000\n"
-"PO-Revision-Date: 2012-01-25 07:27+0000\n"
+"PO-Revision-Date: 2012-03-12 21:56+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:52+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:51+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: src/app.cpp:90 src/app.cpp:329
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kshorturifilter.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kshorturifilter.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kshorturifilter.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kshorturifilter.po	2012-03-23 06:41:58.000000000 +0000
@@ -9,14 +9,14 @@
 "Project-Id-Version: kshorturifilter\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:44+0000\n"
+"PO-Revision-Date: 2012-03-12 22:38+0000\n"
 "Last-Translator: Youssef Chahibi <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:13+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:03+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kshorturifilter.cpp:294
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksirk.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksirk.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksirk.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksirk.po	2012-03-23 06:41:39.000000000 +0000
@@ -16,8 +16,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:52+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:52+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kgamewin.cpp:156 kgamewin.cpp:741
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksmserver.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksmserver.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksmserver.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksmserver.po	2012-03-23 06:42:03.000000000 +0000
@@ -16,16 +16,16 @@
 "Project-Id-Version: ksmserver\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:13+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-14 17:15+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:08+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:12+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: main.cpp:52
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksnapshot.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksnapshot.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksnapshot.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksnapshot.po	2012-03-23 06:42:01.000000000 +0000
@@ -6,23 +6,23 @@
 # Munzir Taha <munzir@kacst.edu.sa>, 2004.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # majed <gmajedli@gmail.com>, 2008.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: ksnapshot\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-09 05:03+0000\n"
-"PO-Revision-Date: 2012-01-25 10:55+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-14 17:02+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:15+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:39+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: ksnapshot_options.h:30
 msgid ""
@@ -39,7 +39,7 @@
 
 #: ksnapshot_options.h:33
 msgid "Captures a free region (not rectangular)"
-msgstr ""
+msgstr "تلتقط مناطق غير منتظمة(ليست مستطيل)"
 
 #: ksnapshot_options.h:33
 msgid "Captures a part of windows"
@@ -50,6 +50,8 @@
 "Select a region using the mouse. To take the snapshot, press the Enter key "
 "or double click. Press Esc to quit."
 msgstr ""
+"اختر منطقة بالفأرة . اضغط مفتاح الإدخال لأخذ اللقطة أو نقر مزدوج.  اضغط Esc "
+"للخروج ."
 
 #: kbackgroundsnapshot.cpp:91 ksnapshot.cpp:166
 msgid "snapshot"
@@ -72,26 +74,34 @@
 msgctxt "%1 is collection name, %2 is image count in collection"
 msgid "%1 (%2 image)"
 msgid_plural "%1 (%2 images)"
-msgstr[0] ""
-msgstr[1] ""
+msgstr[0] "%1 (%2)"
+msgstr[1] "%1 (صورة واحدة)"
+msgstr[2] "%1 (صورتان)"
+msgstr[3] "%1 (%2 صور)"
+msgstr[4] "%1 (%2 صورة)"
+msgstr[5] "%1 (%2 صورة)"
 
 #: ksnapshot.cpp:99
 msgid "untitled"
-msgstr ""
+msgstr "بدون عنوان"
 
 #: ksnapshot.cpp:105
 msgid "Copy"
-msgstr ""
+msgstr "انسخ"
 
 #: ksnapshot.cpp:106
 msgid "Send To..."
-msgstr ""
+msgstr "أرسل إلى..."
 
 #: ksnapshot.cpp:111
 msgid " second"
 msgid_plural " seconds"
-msgstr[0] ""
-msgstr[1] ""
+msgstr[0] " ث"
+msgstr[1] " ث"
+msgstr[2] " ث"
+msgstr[3] " ث"
+msgstr[4] " ث"
+msgstr[5] " ث"
 
 #: ksnapshot.cpp:180
 msgid "Quick Save Snapshot &As..."
@@ -215,11 +225,11 @@
 
 #: main.cpp:48
 msgid "Pau Garcia i Quiles"
-msgstr ""
+msgstr "Pau Garcia i Quiles"
 
 #: main.cpp:48
 msgid "Free region grabbing, KIPI plugins support, port to Windows"
-msgstr ""
+msgstr "إلتقاط المناطق الحر، دعم ملحقات KIPI ، النقل إلى ويندوز"
 
 #: rc.cpp:85
 msgctxt "NAME OF TRANSLATORS"
@@ -261,7 +271,7 @@
 #. i18n: ectx: property (text), widget (KPushButton, btnNew)
 #: rc.cpp:13 rc.cpp:87
 msgid "Take a &New Snapshot"
-msgstr ""
+msgstr "خذ لقطة &جديدة"
 
 #. i18n: file: ksnapshotwidget.ui:85
 #. i18n: ectx: property (text), widget (QLabel, textLabel1)
@@ -318,13 +328,13 @@
 #. i18n: ectx: property (text), item, widget (QComboBox, comboMode)
 #: rc.cpp:35 rc.cpp:109
 msgid "Rectangular Region"
-msgstr ""
+msgstr "منطقة مستطيلة"
 
 #. i18n: file: ksnapshotwidget.ui:134
 #. i18n: ectx: property (text), item, widget (QComboBox, comboMode)
 #: rc.cpp:38 rc.cpp:112
 msgid "Freehand Region"
-msgstr ""
+msgstr "منطقة حرة"
 
 #. i18n: file: ksnapshotwidget.ui:153
 #. i18n: ectx: property (text), item, widget (QComboBox, comboMode)
@@ -388,7 +398,7 @@
 #. i18n: ectx: property (text), widget (QLabel, lblIncludeDecorations)
 #: rc.cpp:66 rc.cpp:140
 msgid "Include &window decorations:"
-msgstr ""
+msgstr "تضمين إطار ال&نافذة:"
 
 #. i18n: file: ksnapshotwidget.ui:114
 #. i18n: ectx: property (whatsThis), widget (QCheckBox, cbIncludeDecorations)
@@ -401,7 +411,7 @@
 #. i18n: ectx: property (text), widget (QLabel, lblIncludePointer)
 #: rc.cpp:72 rc.cpp:146
 msgid "Include mouse &pointer:"
-msgstr ""
+msgstr "تضمين &مؤشر الفأرة:"
 
 #: snapshottimer.cpp:35 snapshottimer.cpp:89
 #, kde-format
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kspaceduel.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kspaceduel.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kspaceduel.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kspaceduel.po	2012-03-23 06:41:39.000000000 +0000
@@ -9,14 +9,14 @@
 "Project-Id-Version: kspaceduel\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:39+0000\n"
-"PO-Revision-Date: 2012-01-25 07:28+0000\n"
+"PO-Revision-Date: 2012-03-12 21:57+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:53+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:52+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: dialogs.cpp:77
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksplashthemes.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksplashthemes.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksplashthemes.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksplashthemes.po	2012-03-23 06:42:03.000000000 +0000
@@ -14,16 +14,15 @@
 "Project-Id-Version: ksplashthemes\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2011-12-12 19:24+0000\n"
+"PO-Revision-Date: 2012-03-14 17:06+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:08+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:12+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: installer.cpp:127
 msgid "Get New Themes..."
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksquares.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksquares.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksquares.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksquares.po	2012-03-23 06:41:39.000000000 +0000
@@ -3,19 +3,20 @@
 # This file is distributed under the same license as the PACKAGE package.
 #
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: ksquares\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:39+0000\n"
-"PO-Revision-Date: 2008-09-29 12:33+0000\n"
-"Last-Translator: Youssef Chahibi <chahibi@gmail.com>\n"
-"Language-Team: <en@li.org>\n"
+"PO-Revision-Date: 2012-03-12 22:56+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:53+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:52+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: ksquaresdemowindow.cpp:42 ksquareswindow.cpp:74
@@ -25,47 +26,47 @@
 #: ksquaresdemowindow.cpp:70
 #, kde-format
 msgid "Player %1"
-msgstr ""
+msgstr "اللاعب %1"
 
 #. i18n: file: prefs_ai.ui:54
 #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_Difficulty)
 #: ksquareswindow.cpp:88 ksquareswindow.cpp:280 ksquareswindow.cpp:285
 #: rc.cpp:143 rc.cpp:255
 msgid "Easy"
-msgstr ""
+msgstr "سهل"
 
 #. i18n: file: prefs_ai.ui:59
 #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_Difficulty)
 #: ksquareswindow.cpp:89 ksquareswindow.cpp:281 ksquareswindow.cpp:284
 #: rc.cpp:146 rc.cpp:258
 msgid "Medium"
-msgstr ""
+msgstr "متوسط"
 
 #. i18n: file: scoreswidget.ui:13
 #. i18n: ectx: property (windowTitle), widget (QWidget, ScoresWidget)
 #: ksquareswindow.cpp:249 rc.cpp:182 rc.cpp:369
 msgid "Scores"
-msgstr ""
+msgstr "النتائج"
 
 #: ksquareswindow.cpp:254
 msgid "Player Name"
-msgstr ""
+msgstr "اسم اللاعب"
 
 #: ksquareswindow.cpp:255
 msgid "Completed Squares"
-msgstr ""
+msgstr "مربعات مكتملة"
 
 #: ksquareswindow.cpp:337
 msgid "Online rankings"
-msgstr ""
+msgstr "التصنيف على الإنترنت"
 
 #: ksquareswindow.cpp:341
 msgid "List of seats"
-msgstr ""
+msgstr "قائمة المقاعد"
 
 #: ksquareswindow.cpp:347
 msgid "Start a new game with the current settings"
-msgstr ""
+msgstr "ابدأ لعبة جديدة بالإعدادات الحالية"
 
 #: ksquareswindow.cpp:356
 msgid "Request to start a new game with the current settings"
@@ -73,27 +74,27 @@
 
 #: ksquareswindow.cpp:376
 msgid "Display"
-msgstr ""
+msgstr "العرض"
 
 #: ksquareswindow.cpp:380
 msgid "Computer Player"
-msgstr ""
+msgstr "اللاعب الحاسوبي"
 
 #: ksquareswindow.cpp:442
 msgid "The game has finished"
-msgstr ""
+msgstr "انتهت اللعبة"
 
 #: ksquareswindow.cpp:446
 msgid "It is your turn"
-msgstr ""
+msgstr "إنّه دورك"
 
 #: ksquareswindow.cpp:468
 msgid "Waiting for opponent..."
-msgstr ""
+msgstr "بانتظار المنافس..."
 
 #: ksquareswindow.cpp:510
 msgid "Waiting for move result..."
-msgstr ""
+msgstr "بانتظار نتيجة الحركة"
 
 #: main.cpp:23
 msgid ""
@@ -103,107 +104,107 @@
 
 #: main.cpp:29
 msgid "KSquares"
-msgstr ""
+msgstr "KSquares"
 
 #: main.cpp:30
 msgid "(C) 2006-2007 Matt Williams"
-msgstr ""
+msgstr "(C) 2006-2007 Matt Williams"
 
 #: main.cpp:32
 msgid "Matt Williams"
-msgstr ""
+msgstr "Matt Williams"
 
 #: main.cpp:32
 msgid "Original creator and maintainer"
-msgstr ""
+msgstr "المنشئ والمشرف الأصلي"
 
 #: main.cpp:33
 msgid "Fela Winkelmolen"
-msgstr ""
+msgstr "Fela Winkelmolen"
 
 #: main.cpp:33
 msgid "Many patches and bugfixes"
-msgstr ""
+msgstr "العديد من الترقيعات والإصلاحات"
 
 #: main.cpp:38
 msgid "Run game in demo (autoplay) mode"
-msgstr ""
+msgstr "شغل اللعبة في النمط الاستعراضي (لعب تلقائي)"
 
 #: main.cpp:50 main.cpp:51 main.cpp:52
 #, kde-format
 msgctxt "default name of player"
 msgid "Player %1"
-msgstr ""
+msgstr "اللاعب %1"
 
 #. i18n: file: newgamewidget.ui:13
 #. i18n: ectx: property (windowTitle), widget (QWidget, NewGameWidget)
 #: newgamedialog.cpp:20 rc.cpp:44 rc.cpp:267
 msgid "New Game"
-msgstr ""
+msgstr "لعبة جديدة"
 
 #: rc.cpp:186
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
-msgstr " ,Launchpad Contributions:"
+msgstr "عبدالرحيم الفاخوري, ,Launchpad Contributions:,Abdalrahim G. Fakhouri"
 
 #: rc.cpp:187
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr ","
+msgstr "abdilra7eem@yahoo.com,,,"
 
 #. i18n: file: ksquares.kcfg:10
 #. i18n: ectx: label, entry (NumOfPlayers), group (Game Settings)
 #: rc.cpp:3 rc.cpp:190
 msgid "Number of Players"
-msgstr ""
+msgstr "عدد اللاعبين"
 
 #. i18n: file: ksquares.kcfg:14
 #. i18n: ectx: label, entry (PlayerNames), group (Game Settings)
 #: rc.cpp:6 rc.cpp:193
 msgid "Player Names"
-msgstr ""
+msgstr "أسماء اللاعبين"
 
 #. i18n: file: ksquares.kcfg:17
 #. i18n: ectx: label, entry (HumanList), group (Game Settings)
 #: rc.cpp:9 rc.cpp:196
 msgid "Human or AI"
-msgstr ""
+msgstr "إنسان أم الحاسوب"
 
 #. i18n: file: ksquares.kcfg:21
 #. i18n: ectx: label, entry (BoardWidth), group (Game Settings)
 #: rc.cpp:12 rc.cpp:199
 msgid "Width of board"
-msgstr ""
+msgstr "عرض اللوحة"
 
 #. i18n: file: ksquares.kcfg:25
 #. i18n: ectx: label, entry (BoardHeight), group (Game Settings)
 #: rc.cpp:15 rc.cpp:202
 msgid "Height of board"
-msgstr ""
+msgstr "ارتفاع اللوحة"
 
 #. i18n: file: ksquares.kcfg:29
 #. i18n: ectx: label, entry (QuickStart), group (Game Settings)
 #: rc.cpp:18 rc.cpp:205
 msgid "Quick start the game"
-msgstr ""
+msgstr "البدء السريع للّعبة"
 
 #. i18n: file: ksquares.kcfg:35
 #. i18n: ectx: label, entry (Difficulty), group (AI)
 #: rc.cpp:21 rc.cpp:208
 msgid "Difficulty"
-msgstr ""
+msgstr "الصعوبة"
 
 #. i18n: file: ksquares.kcfg:36
 #. i18n: ectx: whatsthis, entry (Difficulty), group (AI)
 #: rc.cpp:24 rc.cpp:211
 msgid "How difficult the AI should be"
-msgstr ""
+msgstr "مدى صعوبة الذكاء الاصطناعي"
 
 #. i18n: file: ksquares.kcfg:42
 #. i18n: ectx: label, entry (LineColor), group (Display)
 #: rc.cpp:27 rc.cpp:214
 msgid "Line Color"
-msgstr ""
+msgstr "لون الخطّ"
 
 #. i18n: file: ksquares.kcfg:47
 #. i18n: ectx: label, entry (IndicatorLineColor), group (Display)
@@ -215,25 +216,25 @@
 #. i18n: ectx: label, entry (HighlightColor), group (Display)
 #: rc.cpp:35 rc.cpp:222
 msgid "Highlight Color"
-msgstr ""
+msgstr "لون الإبراز"
 
 #. i18n: file: prefs_display.ui:13
 #. i18n: ectx: property (windowTitle), widget (QWidget, prefs_display)
 #: rc.cpp:155 rc.cpp:225
 msgid "Display Settings"
-msgstr ""
+msgstr "إعدادات العرض"
 
 #. i18n: file: prefs_display.ui:19
 #. i18n: ectx: property (whatsThis), widget (QGroupBox, groupBox_2)
 #: rc.cpp:158 rc.cpp:228
 msgid "Settings for colors"
-msgstr ""
+msgstr "إعدادات الألوان"
 
 #. i18n: file: prefs_display.ui:22
 #. i18n: ectx: property (title), widget (QGroupBox, groupBox_2)
 #: rc.cpp:161 rc.cpp:231
 msgid "Colors"
-msgstr ""
+msgstr "الألوان"
 
 #. i18n: file: prefs_display.ui:28
 #. i18n: ectx: property (whatsThis), widget (QLabel, label)
@@ -269,49 +270,49 @@
 #. i18n: ectx: property (text), widget (QLabel, label_3)
 #: rc.cpp:179 rc.cpp:249
 msgid "Highlight color:"
-msgstr ""
+msgstr "لون الإبراز:"
 
 #. i18n: file: prefs_ai.ui:13
 #. i18n: ectx: property (windowTitle), widget (QWidget, prefs_ai)
 #: rc.cpp:140 rc.cpp:252
 msgid "AI Settings"
-msgstr ""
+msgstr "إعدادات الذكاء الاصطناعي"
 
 #. i18n: file: prefs_ai.ui:70
 #. i18n: ectx: property (whatsThis), widget (QLabel, label_difficulty)
 #: rc.cpp:149 rc.cpp:261
 msgid "How difficult it will be to beat the computer"
-msgstr ""
+msgstr "تحدد مدى صعوبة الفوز على الحاسوب"
 
 #. i18n: file: prefs_ai.ui:73
 #. i18n: ectx: property (text), widget (QLabel, label_difficulty)
 #: rc.cpp:152 rc.cpp:264
 msgid "AI difficulty:"
-msgstr ""
+msgstr "صعوبة الذكاء الاصطناعي"
 
 #. i18n: file: newgamewidget.ui:37
 #. i18n: ectx: property (whatsThis), widget (QGroupBox, groupBox)
 #: rc.cpp:47 rc.cpp:270
 msgid "Settings for the players in the game"
-msgstr ""
+msgstr "إعدادات متعلّقة باللاعبين"
 
 #. i18n: file: newgamewidget.ui:40
 #. i18n: ectx: property (title), widget (QGroupBox, groupBox)
 #: rc.cpp:50 rc.cpp:273
 msgid "Players"
-msgstr ""
+msgstr "اللاعبون"
 
 #. i18n: file: newgamewidget.ui:64
 #. i18n: ectx: property (whatsThis), widget (QLabel, labelPlayer4Name)
 #: rc.cpp:53 rc.cpp:276
 msgid "The name of the fourth player"
-msgstr ""
+msgstr "اسم اللاعب الرابع"
 
 #. i18n: file: newgamewidget.ui:67
 #. i18n: ectx: property (text), widget (QLabel, labelPlayer4Name)
 #: rc.cpp:56 rc.cpp:279
 msgid "Player 4:"
-msgstr ""
+msgstr "اللاعب الرابع:"
 
 #. i18n: file: newgamewidget.ui:80
 #. i18n: ectx: property (whatsThis), widget (QCheckBox, playerFourHuman)
@@ -338,43 +339,43 @@
 #. i18n: ectx: property (text), widget (QCheckBox, playerFourHuman)
 #: rc.cpp:62 rc.cpp:285
 msgid "Hum&an?"
-msgstr ""
+msgstr "إن&سان؟"
 
 #. i18n: file: newgamewidget.ui:99
 #. i18n: ectx: property (text), widget (QCheckBox, playerThreeHuman)
 #: rc.cpp:68 rc.cpp:291
 msgid "Hu&man?"
-msgstr ""
+msgstr "إن&سان؟"
 
 #. i18n: file: newgamewidget.ui:109
 #. i18n: ectx: property (whatsThis), widget (QLabel, labelPlayer3Name)
 #: rc.cpp:71 rc.cpp:294
 msgid "The name of the third player"
-msgstr ""
+msgstr "اسم اللاعب الثالث"
 
 #. i18n: file: newgamewidget.ui:112
 #. i18n: ectx: property (text), widget (QLabel, labelPlayer3Name)
 #: rc.cpp:74 rc.cpp:297
 msgid "Player 3:"
-msgstr ""
+msgstr "اللاعب الثالث:"
 
 #. i18n: file: newgamewidget.ui:131
 #. i18n: ectx: property (whatsThis), widget (QLabel, labelPlayer2Name)
 #: rc.cpp:77 rc.cpp:300
 msgid "The name of the second player"
-msgstr ""
+msgstr "اسم اللاعب الثاني"
 
 #. i18n: file: newgamewidget.ui:134
 #. i18n: ectx: property (text), widget (QLabel, labelPlayer2Name)
 #: rc.cpp:80 rc.cpp:303
 msgid "Player 2:"
-msgstr ""
+msgstr "اللاعب الثاني:"
 
 #. i18n: file: newgamewidget.ui:169
 #. i18n: ectx: property (text), widget (QCheckBox, playerOneHuman)
 #: rc.cpp:86 rc.cpp:309
 msgid "&Human?"
-msgstr ""
+msgstr "إن&سان؟"
 
 #. i18n: file: newgamewidget.ui:182
 #. i18n: ectx: property (whatsThis), widget (QLabel, numOfPlayersLabel)
@@ -394,37 +395,37 @@
 #. i18n: ectx: property (text), widget (QLabel, numOfPlayersLabel)
 #: rc.cpp:95 rc.cpp:318
 msgid "Number of players:"
-msgstr ""
+msgstr "عدد اللاعبين:"
 
 #. i18n: file: newgamewidget.ui:198
 #. i18n: ectx: property (whatsThis), widget (QLabel, labelPlayer1Name)
 #: rc.cpp:98 rc.cpp:321
 msgid "The name of the first player"
-msgstr ""
+msgstr "اسم اللاعب الأوّل"
 
 #. i18n: file: newgamewidget.ui:201
 #. i18n: ectx: property (text), widget (QLabel, labelPlayer1Name)
 #: rc.cpp:101 rc.cpp:324
 msgid "Player 1:"
-msgstr ""
+msgstr "اللاعب الأول:"
 
 #. i18n: file: newgamewidget.ui:217
 #. i18n: ectx: property (text), widget (QCheckBox, playerTwoHuman)
 #: rc.cpp:107 rc.cpp:330
 msgid "H&uman?"
-msgstr ""
+msgstr "إن&سان؟"
 
 #. i18n: file: newgamewidget.ui:230
 #. i18n: ectx: property (whatsThis), widget (QGroupBox, groupBox_2)
 #: rc.cpp:110 rc.cpp:333
 msgid "Settings for the game board"
-msgstr ""
+msgstr "إعدادات لوحة اللعب"
 
 #. i18n: file: newgamewidget.ui:233
 #. i18n: ectx: property (title), widget (QGroupBox, groupBox_2)
 #: rc.cpp:113 rc.cpp:336
 msgid "Game Board"
-msgstr ""
+msgstr "لوحة اللعب"
 
 #. i18n: file: newgamewidget.ui:257
 #. i18n: ectx: property (whatsThis), widget (QLabel, labelWidth)
@@ -436,7 +437,7 @@
 #. i18n: ectx: property (text), widget (QLabel, labelWidth)
 #: rc.cpp:119 rc.cpp:342
 msgid "Width:"
-msgstr ""
+msgstr "العرض:"
 
 #. i18n: file: newgamewidget.ui:289
 #. i18n: ectx: property (whatsThis), widget (QLabel, labelHeight)
@@ -448,19 +449,19 @@
 #. i18n: ectx: property (text), widget (QLabel, labelHeight)
 #: rc.cpp:125 rc.cpp:348
 msgid "Height:"
-msgstr ""
+msgstr "الارتفاع:"
 
 #. i18n: file: newgamewidget.ui:324
 #. i18n: ectx: property (whatsThis), widget (QGroupBox, groupBox_3)
 #: rc.cpp:128 rc.cpp:351
 msgid "Settings for the game"
-msgstr ""
+msgstr "إعدادات اللعبة"
 
 #. i18n: file: newgamewidget.ui:327
 #. i18n: ectx: property (title), widget (QGroupBox, groupBox_3)
 #: rc.cpp:131 rc.cpp:354
 msgid "Game Settings"
-msgstr ""
+msgstr "إعدادات اللعبة"
 
 #. i18n: file: newgamewidget.ui:351
 #. i18n: ectx: property (whatsThis), widget (QCheckBox, quickStartCheck)
@@ -472,22 +473,22 @@
 #. i18n: ectx: property (text), widget (QCheckBox, quickStartCheck)
 #: rc.cpp:137 rc.cpp:360
 msgid "Quick start"
-msgstr ""
+msgstr "البدء السريع"
 
 #. i18n: file: ksquaresui.rc:11
 #. i18n: ectx: Menu (onlinegame)
 #: rc.cpp:38 rc.cpp:363
 msgid "Online game"
-msgstr ""
+msgstr "لعبة عبر الشابكة"
 
 #. i18n: file: ksquaresui.rc:18
 #. i18n: ectx: ToolBar (mainToolBar)
 #: rc.cpp:41 rc.cpp:366
 msgid "Main Toolbar"
-msgstr ""
+msgstr "شريط الأدوات الرئيسي"
 
 #. i18n: file: scoreswidget.ui:19
 #. i18n: ectx: property (whatsThis), widget (QTableView, scoreTable)
 #: rc.cpp:185 rc.cpp:372
 msgid "Scoreboard"
-msgstr ""
+msgstr "لوحة النتائج"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kstars.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kstars.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kstars.po	2012-02-23 06:20:24.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kstars.po	2012-03-23 06:41:56.000000000 +0000
@@ -11,7 +11,7 @@
 "Project-Id-Version: kstars\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 20:15+0000\n"
-"PO-Revision-Date: 2012-01-25 11:03+0000\n"
+"PO-Revision-Date: 2012-03-12 23:06+0000\n"
 "Last-Translator: Youssef Chahibi <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
@@ -19,8 +19,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:25+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:34+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: colorscheme.cpp:43
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kstartperf.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kstartperf.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kstartperf.po	2012-02-23 06:20:11.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kstartperf.po	2012-03-23 06:41:43.000000000 +0000
@@ -4,19 +4,20 @@
 # Sayed Jaffer Al-Mosawi <mosawi@arabeyes.org>, 2002.
 # Ahmad M. Zawawi <azawawi@emirates.net.ae>, 2004.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kstartperf\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 16:09+0000\n"
-"PO-Revision-Date: 2007-10-25 08:59+0000\n"
-"Last-Translator: Ahmad M. Zawawi <Unknown>\n"
-"Language-Team: <en@li.org>\n"
+"PO-Revision-Date: 2012-03-12 22:59+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:53+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:24+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kstartperf.cpp:90
@@ -25,34 +26,36 @@
 
 #: kstartperf.cpp:91
 msgid "Measures start up time of a KDE application"
-msgstr "تقيس وقت بدء التشغيل لبرنامج KDE"
+msgstr "تقيس وقت بدء التشغيل لبرنامج في KDE"
 
 #: kstartperf.cpp:93
 msgid "Copyright (c) 2000 Geert Jansen and libkmapnotify authors"
-msgstr ""
+msgstr "Copyright (c) 2000 Geert Jansen and libkmapnotify authors"
 
 #: kstartperf.cpp:94
 msgid "Geert Jansen"
-msgstr ""
+msgstr "Geert Jansen"
 
 #: kstartperf.cpp:94
 msgid "Maintainer"
-msgstr "المتابع"
+msgstr "المشرف"
 
 #: kstartperf.cpp:100
 msgid "Specifies the command to run"
-msgstr ""
+msgstr "يحدد الأمر المطلوب تشغيله"
 
 #: kstartperf.cpp:101
 msgid "Arguments to 'command'"
-msgstr ""
+msgstr "المتغيرات للأمر"
 
 #: rc.cpp:1
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
-msgstr "السيد جعفر الموسوي, ,Launchpad Contributions:"
+msgstr ""
+"السيد جعفر الموسوي، عبدالرحيم الفاخوري, ,Launchpad Contributions:,Abdalrahim "
+"G. Fakhouri,Ahmad M. Zawawi"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "mosawi@arabeyes.org,,"
+msgstr "mosawi@arabeyes.org,abdilra7eem@yahoo.com,,,,"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kstart.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kstart.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kstart.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kstart.po	2012-03-23 06:41:58.000000000 +0000
@@ -15,14 +15,14 @@
 "Project-Id-Version: kstart\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2011-12-12 19:48+0000\n"
+"PO-Revision-Date: 2012-03-14 17:33+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:13+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:04+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: kstart.cpp:300
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kstyle_config.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kstyle_config.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kstyle_config.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kstyle_config.po	2012-03-23 06:42:04.000000000 +0000
@@ -7,14 +7,14 @@
 "Project-Id-Version: kstyle_config\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:13+0000\n"
-"Last-Translator: Mr Pirate <vantom287@yahoo.com>\n"
+"PO-Revision-Date: 2012-03-12 22:25+0000\n"
+"Last-Translator: Ahmad Hassan <vantom287@yahoo.com>\n"
 "Language-Team: arabeyes.org\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:09+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:13+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: web/plugin.cpp:9
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kstyle_keramik_config.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kstyle_keramik_config.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kstyle_keramik_config.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kstyle_keramik_config.po	2012-03-23 06:42:04.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:10+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:13+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 "X-Poedit-Language: Arabic\n"
 
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kstyle_phase_config.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kstyle_phase_config.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kstyle_phase_config.po	2012-02-23 06:20:06.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kstyle_phase_config.po	2012-03-23 06:41:38.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:36+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:42+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #. i18n: file: styledialog.ui:13
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksudoku.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksudoku.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksudoku.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksudoku.po	2012-03-23 06:41:39.000000000 +0000
@@ -6,22 +6,23 @@
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # OsamaKhalid <osamak.wfm@gmail.com>, 2009.
 # zayed <zayed.alsaidi@gmail.com>, 2009.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: ksudoku\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:39+0000\n"
-"PO-Revision-Date: 2009-07-24 13:47+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
+"PO-Revision-Date: 2012-03-12 22:56+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:54+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:53+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: src/main.cpp:37
 msgid "KSudoku - Sudokus and more"
@@ -492,13 +493,15 @@
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
 msgstr ""
-"أسامة خالد,زايد السعيدي, ,Launchpad Contributions:,Zayed Amer Al-Saidi"
+"أسامة خالد,زايد السعيدي, عبدالرحيم الفاخوري, ,Launchpad Contributions:,Zayed "
+"Amer Al-Saidi"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
 msgstr ""
-"osamak.wfm@gmail.com,zayed.alsaidi@gmail.com,,,zayed.alsaidi@gmail.com"
+"osamak.wfm@gmail.com,zayed.alsaidi@gmail.com, "
+"abdilra7eem@yahoo.com,,,zayed.alsaidi@gmail.com"
 
 #. i18n: file: src/gui/ksudokuui.rc:10
 #. i18n: ectx: Menu (game)
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksysguardlsofwidgets.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksysguardlsofwidgets.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksysguardlsofwidgets.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksysguardlsofwidgets.po	2012-03-23 06:42:04.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:12+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:14+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: LsofSearchWidget.cpp:36
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksysguard.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksysguard.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksysguard.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksysguard.po	2012-03-23 06:42:04.000000000 +0000
@@ -17,16 +17,16 @@
 "Project-Id-Version: ksysguard\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:15+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-14 17:15+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:11+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:14+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: TimerSettings.cc:38
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksystemlog.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksystemlog.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksystemlog.po	2012-02-23 06:20:06.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksystemlog.po	2012-03-23 06:41:38.000000000 +0000
@@ -8,7 +8,7 @@
 "Project-Id-Version: ksystemlog\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 02:38+0000\n"
-"PO-Revision-Date: 2012-01-25 23:49+0000\n"
+"PO-Revision-Date: 2012-03-13 07:42+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
@@ -16,8 +16,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:32+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:40+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: src/mainWindow.cpp:383
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksystraycmd.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksystraycmd.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ksystraycmd.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ksystraycmd.po	2012-03-23 06:42:04.000000000 +0000
@@ -13,16 +13,15 @@
 "Project-Id-Version: ksystraycmd\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2011-12-12 19:33+0000\n"
+"PO-Revision-Date: 2012-03-14 17:03+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:13+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:15+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: ksystraycmd.cpp:80
 #, kde-format
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kteatime.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kteatime.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kteatime.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kteatime.po	2012-03-23 06:41:43.000000000 +0000
@@ -6,32 +6,35 @@
 # Munzir Taha <munzir@kacst.edu.sa>, 2004.
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kteatime\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-09 04:38+0000\n"
-"PO-Revision-Date: 2011-12-12 17:58+0000\n"
+"PO-Revision-Date: 2012-03-14 17:37+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: <en@li.org>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:01+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:28+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: rc.cpp:1
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
-msgstr "Arabeyes.org, ,Launchpad Contributions:,Youssef Chahibi"
+msgstr ""
+"عبدالرحيم الفاخوري, ,Launchpad Contributions:,Abdalrahim G. Fakhouri,Youssef "
+"Chahibi"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "عناوبن بريدك الإلكترونية,,,"
+msgstr "abdilra7eem@yahoo.com,,,,"
 
 #. i18n: file: src/settings.ui:18
 #. i18n: ectx: property (title), widget (KButtonGroup, kbuttongroup1)
@@ -108,13 +111,13 @@
 #: rc.cpp:5 src/main.cpp:83 src/tea.cpp:40 src/timeedit.cpp:45
 #: src/timeedit.cpp:105
 msgid "Anonymous Tea"
-msgstr "شاي مجهول"
+msgstr "شاي شخص مجهول"
 
 #. i18n: file: src/timeedit.ui:32
 #. i18n: ectx: property (text), widget (QLabel, minutesLabel_2)
 #: rc.cpp:8
 msgid "Tea time:"
-msgstr "زمن الشاي:"
+msgstr "وقت الشاي:"
 
 #: src/main.cpp:28
 msgid "KTeaTime"
@@ -130,6 +133,9 @@
 " (c) 2002-2003, Martin Willers\n"
 " (c) 2007-2010, Stefan Böhmann"
 msgstr ""
+"(c) 1998-1999, Matthias Hoelzer-Kluepfel\n"
+" (c) 2002-2003, Martin Willers\n"
+" (c) 2007-2010, Stefan Böhmann"
 
 #: src/main.cpp:38
 msgid "Stefan Böhmann"
@@ -137,7 +143,7 @@
 
 #: src/main.cpp:39
 msgid "Current maintainer"
-msgstr ""
+msgstr "المشرف الحالي"
 
 #: src/main.cpp:46
 msgid "Matthias Hoelzer-Kluepfel"
@@ -162,7 +168,7 @@
 #: src/main.cpp:69
 #, kde-format
 msgid "Use this name for the tea started with %1."
-msgstr ""
+msgstr "استخدم هذا الاسم للشاي الذي يعدّه %1."
 
 #: src/settings.cpp:49
 msgid "Configure Tea Cooker"
@@ -170,11 +176,11 @@
 
 #: src/settings.cpp:52
 msgid "Configure &amp;Notifications..."
-msgstr ""
+msgstr "اضبط &amp;الإشعارات..."
 
 #: src/settings.cpp:53 src/settings.cpp:61
 msgid "Configure notifications"
-msgstr ""
+msgstr "اضبط الإِشعارات"
 
 #: src/settings.cpp:58
 msgid "Save changes and close dialog."
@@ -214,8 +220,12 @@
 #, kde-format
 msgid "%1 year"
 msgid_plural "%1 years"
-msgstr[0] ""
-msgstr[1] ""
+msgstr[0] "السنة"
+msgstr[1] "سنة واحدة"
+msgstr[2] "سنتان"
+msgstr[3] "%1 سنوات"
+msgstr[4] "%1 سنة"
+msgstr[5] "%1 سنة"
 
 #: src/tea.cpp:79
 #, kde-format
@@ -228,8 +238,12 @@
 #, kde-format
 msgid "%1 day"
 msgid_plural "%1 days"
-msgstr[0] ""
-msgstr[1] ""
+msgstr[0] "اليوم"
+msgstr[1] "يوم واحد"
+msgstr[2] "يومان"
+msgstr[3] "%1 أيّام"
+msgstr[4] "%1 يوماً"
+msgstr[5] "%1 يوم"
 
 #: src/tea.cpp:92
 #, kde-format
@@ -242,8 +256,12 @@
 #, kde-format
 msgid "%1 hour"
 msgid_plural "%1 hours"
-msgstr[0] ""
-msgstr[1] ""
+msgstr[0] "ساعة"
+msgstr[1] "ساعة واحدة"
+msgstr[2] "ساعتان"
+msgstr[3] "%1 ساعات"
+msgstr[4] "%1 ساعة"
+msgstr[5] "%1 ساعة"
 
 #: src/tea.cpp:105
 #, kde-format
@@ -256,22 +274,34 @@
 #, kde-format
 msgid "%1 minute"
 msgid_plural "%1 minutes"
-msgstr[0] ""
-msgstr[1] ""
+msgstr[0] "دقيقة"
+msgstr[1] "دقيقة واحدة"
+msgstr[2] "دقيقتان"
+msgstr[3] "%1 دقائق"
+msgstr[4] "%1 دقيقة"
+msgstr[5] "%1 دقيقة"
 
 #: src/tea.cpp:118
 #, kde-format
 msgid "%1 min"
 msgid_plural "%1 min"
-msgstr[0] ""
-msgstr[1] ""
+msgstr[0] "%1 دقيقة"
+msgstr[1] "دقيقة واحدة"
+msgstr[2] "دقيقتان"
+msgstr[3] "%1 دقائق"
+msgstr[4] "%1 دقيقة"
+msgstr[5] "%1 دقيقة"
 
 #: src/tea.cpp:128
 #, kde-format
 msgid "%1 second"
 msgid_plural "%1 seconds"
-msgstr[0] ""
-msgstr[1] ""
+msgstr[0] "ثانية"
+msgstr[1] "ثانية واحدة"
+msgstr[2] "ثانيتان"
+msgstr[3] "%1 ثوان"
+msgstr[4] "%1 ثانية"
+msgstr[5] "%1 ثانية"
 
 #: src/tea.cpp:131
 #, kde-format
@@ -336,7 +366,7 @@
 #, kde-format
 msgctxt "%1 - name of the tea, %2 - the predefined time for the tea"
 msgid "%1 (%2)"
-msgstr ""
+msgstr "%1 (%2)"
 
 #: src/toplevel.cpp:133 src/toplevel.cpp:134 src/toplevel.cpp:262
 msgid "The Tea Cooker"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ktexteditor_plugins.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ktexteditor_plugins.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ktexteditor_plugins.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ktexteditor_plugins.po	2012-03-23 06:42:01.000000000 +0000
@@ -8,14 +8,14 @@
 "Project-Id-Version: ktexteditor_plugins\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 17:20+0000\n"
-"PO-Revision-Date: 2012-01-25 11:02+0000\n"
+"PO-Revision-Date: 2012-03-12 22:33+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:13+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:38+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: autobrace/autobrace_config.cpp:37
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ktimer.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ktimer.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ktimer.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ktimer.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,341 +0,0 @@
-# translation of ktimer.po to
-# Copyright (C) 2003, 2006, 2007 Free Software Foundation, Inc.
-# Waseem Bakr <bakr@mit.edu>, 2001.
-# Nuriddin Aminagha <nuriddin@haydarlinux.org>, 2003.
-# Khaled Hosny <dr.khaled.hosny@gmail.com>, 2006.
-# محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
-# Fahad Al-Saidi <fahad.alsaidi@gmail.com>, 2007.
-# Youssef Chahibi <chahibi@gmail.com>, 2007.
-# Youness BOUTYOUR <niceboy@linuxac.org>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-#
-msgid ""
-msgstr ""
-"Project-Id-Version: ktimer\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 13:31+0000\n"
-"PO-Revision-Date: 2011-12-12 20:24+0000\n"
-"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:11+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"Language: ar\n"
-
-#: main.cpp:27
-msgid "KDE Timer"
-msgstr "مؤقّت كدي"
-
-#: main.cpp:33
-msgid "KTimer"
-msgstr "مؤقّت ك"
-
-#: main.cpp:35
-msgid "(c) 2001, Stefan Schimanski"
-msgstr "(c) 2001, Stefan Schimanski"
-
-#: main.cpp:37
-msgid "Stefan Schimanski"
-msgstr "Stefan Schimanski"
-
-#: rc.cpp:142
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr ""
-"خالد حسنى, فهد السعيدي, يونس بوطيور,زايد السعيدي, ,Launchpad "
-"Contributions:,Youssef Chahibi,Zayed Amer Al-Saidi,metehyi"
-
-#: rc.cpp:143
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr ""
-"dr.khaled.hosny@gmail.com, Fahad.alsaidi@gmail.com, "
-"niceboy120@gmail.com,zayed.alsaidi@gmail.com,,,,zayed.alsaidi@gmail.com,"
-
-#. i18n: file: prefwidget.ui:14
-#. i18n: ectx: property (windowTitle), widget (QDialog, PrefWidget)
-#: rc.cpp:3 rc.cpp:146
-msgid "Timer Settings"
-msgstr "إعدادات المؤقّت"
-
-#. i18n: file: prefwidget.ui:26
-#. i18n: ectx: property (toolTip), widget (QTreeWidget, m_list)
-#: rc.cpp:6 rc.cpp:149
-msgid "List of countdowns you have set"
-msgstr "قائمة المؤقتات التي تملكها"
-
-#. i18n: file: prefwidget.ui:29
-#. i18n: ectx: property (whatsThis), widget (QTreeWidget, m_list)
-#: rc.cpp:9 rc.cpp:152
-msgid ""
-"New countdowns are put here. You can add and remove them, and stop and start "
-"them."
-msgstr ""
-"المؤقتات الجديدة توضع هنا ، يمكنك إضافة أو إزالة أو توقيف أو بدء أي منها."
-
-#. i18n: file: prefwidget.ui:36
-#. i18n: ectx: property (text), widget (QTreeWidget, m_list)
-#: rc.cpp:12 rc.cpp:155
-msgid "Counter"
-msgstr "العدّاد"
-
-#. i18n: file: prefwidget.ui:41
-#. i18n: ectx: property (text), widget (QTreeWidget, m_list)
-#: rc.cpp:15 rc.cpp:158
-msgid "Delay"
-msgstr "التأخير"
-
-#. i18n: file: prefwidget.ui:46
-#. i18n: ectx: property (text), widget (QTreeWidget, m_list)
-#. i18n: file: prefwidget.ui:104
-#. i18n: ectx: property (title), widget (QGroupBox, m_state)
-#. i18n: file: prefwidget.ui:46
-#. i18n: ectx: property (text), widget (QTreeWidget, m_list)
-#. i18n: file: prefwidget.ui:104
-#. i18n: ectx: property (title), widget (QGroupBox, m_state)
-#: rc.cpp:18 rc.cpp:42 rc.cpp:161 rc.cpp:185
-msgid "State"
-msgstr "الحالة"
-
-#. i18n: file: prefwidget.ui:51
-#. i18n: ectx: property (text), widget (QTreeWidget, m_list)
-#: rc.cpp:21 rc.cpp:164
-msgid "Command"
-msgstr "الأمر"
-
-#. i18n: file: prefwidget.ui:59
-#. i18n: ectx: property (toolTip), widget (KPushButton, m_add)
-#: rc.cpp:24 rc.cpp:167
-msgid "Add a new task"
-msgstr "أضف مهمة جديدة"
-
-#. i18n: file: prefwidget.ui:62
-#. i18n: ectx: property (whatsThis), widget (KPushButton, m_add)
-#: rc.cpp:27 rc.cpp:170
-msgid "Add a new task to the list."
-msgstr "تضيف مهمة جديدة في القائمة"
-
-#. i18n: file: prefwidget.ui:65
-#. i18n: ectx: property (text), widget (KPushButton, m_add)
-#: rc.cpp:30 rc.cpp:173
-msgid "&New"
-msgstr "&جديد"
-
-#. i18n: file: prefwidget.ui:72
-#. i18n: ectx: property (toolTip), widget (KPushButton, m_remove)
-#: rc.cpp:33 rc.cpp:176
-msgid "Remove a task"
-msgstr "أ&زل مهمة"
-
-#. i18n: file: prefwidget.ui:75
-#. i18n: ectx: property (whatsThis), widget (KPushButton, m_remove)
-#: rc.cpp:36 rc.cpp:179
-msgid "Remove a task from the list."
-msgstr "تزيل مهمة من القائمة"
-
-#. i18n: file: prefwidget.ui:78
-#. i18n: ectx: property (text), widget (KPushButton, m_remove)
-#: rc.cpp:39 rc.cpp:182
-msgid "&Remove"
-msgstr "أ&زل"
-
-#. i18n: file: prefwidget.ui:116
-#. i18n: ectx: property (toolTip), widget (QSlider, m_slider)
-#: rc.cpp:45 rc.cpp:188
-msgid "Speed up or slow down your countdown"
-msgstr "سرع أو أبطئ مؤقتك"
-
-#. i18n: file: prefwidget.ui:119
-#. i18n: ectx: property (whatsThis), widget (QSlider, m_slider)
-#: rc.cpp:48 rc.cpp:191
-msgid "You can use this slider to adjust the time."
-msgstr "يمكنك استخدام المزلاق لتضبط الوقت."
-
-#. i18n: file: prefwidget.ui:129
-#. i18n: ectx: property (toolTip), widget (QLCDNumber, m_counter)
-#: rc.cpp:51 rc.cpp:194
-msgid "Time in seconds until command is executed"
-msgstr "الوقت بالثواني حتى تنفي الأمر"
-
-#. i18n: file: prefwidget.ui:132
-#. i18n: ectx: property (whatsThis), widget (QLCDNumber, m_counter)
-#: rc.cpp:54 rc.cpp:197
-msgid "This number is how many seconds are left for the selected countdown."
-msgstr "يمثل هذا الرقم الثواني المتبقية للمؤقت المختار."
-
-#. i18n: file: prefwidget.ui:142
-#. i18n: ectx: property (toolTip), widget (QToolButton, m_pause)
-#: rc.cpp:57 rc.cpp:200
-msgid "Pause a countdown"
-msgstr "أوقف مؤقتا"
-
-#. i18n: file: prefwidget.ui:145
-#. i18n: ectx: property (whatsThis), widget (QToolButton, m_pause)
-#: rc.cpp:60 rc.cpp:203
-msgid "Use this to pause a timer countdown."
-msgstr "استعمل هذه لتوقيف وقت العداد"
-
-#. i18n: file: prefwidget.ui:148
-#. i18n: ectx: property (text), widget (QToolButton, m_pause)
-#: rc.cpp:63 rc.cpp:206
-msgid "||"
-msgstr "||"
-
-#. i18n: file: prefwidget.ui:155
-#. i18n: ectx: property (toolTip), widget (QToolButton, m_start)
-#: rc.cpp:66 rc.cpp:209
-msgid "Start a countdown"
-msgstr "ابدأ المؤقت"
-
-#. i18n: file: prefwidget.ui:158
-#. i18n: ectx: property (whatsThis), widget (QToolButton, m_start)
-#: rc.cpp:69 rc.cpp:212
-msgid "Use this to start or restart a countdown."
-msgstr "استعمل هذه لبداية أو إعادة بدء العداد"
-
-#. i18n: file: prefwidget.ui:161
-#. i18n: ectx: property (text), widget (QToolButton, m_start)
-#: rc.cpp:72 rc.cpp:215
-msgid ">"
-msgstr ">"
-
-#. i18n: file: prefwidget.ui:168
-#. i18n: ectx: property (toolTip), widget (QToolButton, m_stop)
-#: rc.cpp:75 rc.cpp:218
-msgid "Stop a countdown"
-msgstr "أوقف المؤقت"
-
-#. i18n: file: prefwidget.ui:171
-#. i18n: ectx: property (whatsThis), widget (QToolButton, m_stop)
-#: rc.cpp:78 rc.cpp:221
-msgid "Use this to stop the countdown for a task."
-msgstr "استعمل هذه لإيقاف المؤقت"
-
-#. i18n: file: prefwidget.ui:174
-#. i18n: ectx: property (text), widget (QToolButton, m_stop)
-#: rc.cpp:81 rc.cpp:224
-msgid "="
-msgstr "="
-
-#. i18n: file: prefwidget.ui:184
-#. i18n: ectx: property (toolTip), widget (KPushButton, m_help)
-#: rc.cpp:84 rc.cpp:227
-msgid "Detailed help documentation"
-msgstr "توثيق المساعدة التفصيلية"
-
-#. i18n: file: prefwidget.ui:187
-#. i18n: ectx: property (whatsThis), widget (KPushButton, m_help)
-#: rc.cpp:87 rc.cpp:230
-msgid "Click here to open the help documentation viewer."
-msgstr "انقر هنا لفتح عارض توثيق المساعدة."
-
-#. i18n: file: prefwidget.ui:197
-#. i18n: ectx: property (title), widget (QGroupBox, m_settings)
-#: rc.cpp:90 rc.cpp:233
-msgid "Settings"
-msgstr "إعدادات"
-
-#. i18n: file: prefwidget.ui:209
-#. i18n: ectx: property (toolTip), widget (QCheckBox, m_loop)
-#. i18n: file: prefwidget.ui:212
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, m_loop)
-#. i18n: file: prefwidget.ui:209
-#. i18n: ectx: property (toolTip), widget (QCheckBox, m_loop)
-#. i18n: file: prefwidget.ui:212
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, m_loop)
-#: rc.cpp:93 rc.cpp:96 rc.cpp:236 rc.cpp:239
-msgid ""
-"Check this box if you want your countdown to start over after it finishes"
-msgstr "اختر هذا الصندوق إذا أردت أن تعيد تشغيل مؤقتك من جديد بعدما ينتهي"
-
-#. i18n: file: prefwidget.ui:215
-#. i18n: ectx: property (text), widget (QCheckBox, m_loop)
-#: rc.cpp:99 rc.cpp:242
-msgid "&Loop"
-msgstr "تك&رار دون توقف"
-
-#. i18n: file: prefwidget.ui:222
-#. i18n: ectx: property (text), widget (QLabel, TextLabel2)
-#: rc.cpp:102 rc.cpp:245
-msgid "Delay:"
-msgstr "التأخير:"
-
-#. i18n: file: prefwidget.ui:229
-#. i18n: ectx: property (toolTip), widget (QSpinBox, m_delay)
-#: rc.cpp:105 rc.cpp:248
-msgid "Enter the seconds here"
-msgstr "أدخل الثواني هنا"
-
-#. i18n: file: prefwidget.ui:232
-#. i18n: ectx: property (whatsThis), widget (QSpinBox, m_delay)
-#: rc.cpp:108 rc.cpp:251
-msgid "You can change the amount of time in the countdown here."
-msgstr "يمكنك تغير كمية الوقت مؤقت من هنا."
-
-#. i18n: file: prefwidget.ui:242
-#. i18n: ectx: property (toolTip), widget (QCheckBox, m_one)
-#: rc.cpp:111 rc.cpp:254
-msgid "Check this box if you only want to open one copy of your program"
-msgstr "اختر هذا الصندوق إذا كنت ترغب في فتح نسخة واحد فقط من برنامجك."
-
-#. i18n: file: prefwidget.ui:245
-#. i18n: ectx: property (whatsThis), widget (QCheckBox, m_one)
-#: rc.cpp:114 rc.cpp:257
-msgid "Check this box if you only want one instance to open"
-msgstr "اختر هذا الصندوق إذا كنت تريد فتح نسخة واحدة فقط."
-
-#. i18n: file: prefwidget.ui:248
-#. i18n: ectx: property (text), widget (QCheckBox, m_one)
-#: rc.cpp:117 rc.cpp:260
-msgid "Start only &one instance"
-msgstr "&شغل نسخة واحدة فقط"
-
-#. i18n: file: prefwidget.ui:255
-#. i18n: ectx: property (text), widget (QLabel, TextLabel3)
-#: rc.cpp:120 rc.cpp:263
-msgid "seconds"
-msgstr "ثواني"
-
-#. i18n: file: prefwidget.ui:271
-#. i18n: ectx: property (text), widget (QLabel, TextLabel1)
-#: rc.cpp:123 rc.cpp:266
-msgid "Command line:"
-msgstr "سطر الأوامر:"
-
-#. i18n: file: prefwidget.ui:278
-#. i18n: ectx: property (toolTip), widget (QSpinBox, m_delayH)
-#: rc.cpp:126 rc.cpp:269
-msgid "Enter the hours here"
-msgstr "أدخل الساعات هنا"
-
-#. i18n: file: prefwidget.ui:285
-#. i18n: ectx: property (toolTip), widget (QSpinBox, m_delayM)
-#: rc.cpp:129 rc.cpp:272
-msgid "Enter the minutes here"
-msgstr "أدخل الدقائق هنا"
-
-#. i18n: file: prefwidget.ui:295
-#. i18n: ectx: property (text), widget (QLabel, TextLabel4)
-#: rc.cpp:132 rc.cpp:275
-msgid "hours"
-msgstr "ساعة"
-
-#. i18n: file: prefwidget.ui:302
-#. i18n: ectx: property (text), widget (QLabel, TextLabel5)
-#: rc.cpp:135 rc.cpp:278
-msgid "minutes"
-msgstr "دقيقة"
-
-#. i18n: file: prefwidget.ui:337
-#. i18n: ectx: property (toolTip), widget (KUrlRequester, m_commandLine)
-#: rc.cpp:138 rc.cpp:281
-msgid "command you would like to run when time is up"
-msgstr "الأمر الذي تريد تشغيله عندما ينتهي الوقت"
-
-#. i18n: file: prefwidget.ui:340
-#. i18n: ectx: property (whatsThis), widget (KUrlRequester, m_commandLine)
-#: rc.cpp:141 rc.cpp:284
-msgid "Enter a program you would like to run when the countdown is zero"
-msgstr "أدخل البرنامج الذي تريد تشغيله عندما يصل المؤقت إلى الصفر"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ktimetracker.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ktimetracker.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ktimetracker.po	2012-02-23 06:20:10.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ktimetracker.po	2012-03-23 06:41:42.000000000 +0000
@@ -8,14 +8,14 @@
 "Project-Id-Version: karm\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 03:45+0000\n"
-"PO-Revision-Date: 2012-01-26 05:32+0000\n"
+"PO-Revision-Date: 2012-03-14 02:55+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:37+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:17+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: csvexportdialog.h:37
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ktorrent.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ktorrent.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ktorrent.po	2012-02-23 06:20:13.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ktorrent.po	2012-03-23 06:41:44.000000000 +0000
@@ -16,8 +16,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 22:00+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:44+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #. i18n: file: plasma/applet/appletconfig.ui:13
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ktouch.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ktouch.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ktouch.po	2012-02-23 06:20:34.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ktouch.po	2012-03-23 06:42:07.000000000 +0000
@@ -11,14 +11,14 @@
 "Project-Id-Version: ktouch\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-10 04:04+0000\n"
-"PO-Revision-Date: 2012-01-25 07:45+0000\n"
+"PO-Revision-Date: 2012-03-12 22:03+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:37+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 01:06+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: rc.cpp:1
 msgctxt "NAME OF TRANSLATORS"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ktraderclient.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ktraderclient.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ktraderclient.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ktraderclient.po	2012-03-23 06:41:58.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:14+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:04+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: ktraderclient.cpp:30
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ktron.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ktron.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ktron.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ktron.po	2012-03-23 06:41:39.000000000 +0000
@@ -7,7 +7,7 @@
 "Project-Id-Version: ktron\n"
 "Report-Msgid-Bugs-To: \n"
 "POT-Creation-Date: 2011-09-08 04:39+0000\n"
-"PO-Revision-Date: 2012-01-25 03:37+0000\n"
+"PO-Revision-Date: 2012-03-13 04:48+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
@@ -15,8 +15,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:54+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:53+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: ktron.cpp:72
 msgid "Right Player / KSnake: Up"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ktuberling.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ktuberling.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ktuberling.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ktuberling.po	2012-03-23 06:41:39.000000000 +0000
@@ -8,14 +8,14 @@
 "Project-Id-Version: ktuberling\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:39+0000\n"
-"PO-Revision-Date: 2012-01-25 07:28+0000\n"
+"PO-Revision-Date: 2012-03-12 21:56+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:55+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:53+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: main.cpp:20
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kturtle.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kturtle.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kturtle.po	2012-02-23 06:20:34.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kturtle.po	2012-03-23 06:42:07.000000000 +0000
@@ -10,16 +10,16 @@
 "Project-Id-Version: kturtle\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 20:07+0000\n"
-"PO-Revision-Date: 2012-01-25 11:07+0000\n"
-"Last-Translator: One <Unknown>\n"
+"PO-Revision-Date: 2012-03-14 18:17+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: amin\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:41+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 01:08+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: interpreter/executer.cpp:270
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ktux.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ktux.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/ktux.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/ktux.po	2012-03-23 06:41:43.000000000 +0000
@@ -6,50 +6,53 @@
 # Ahmad M. Zawawi <zawawi@arabeyes.org>, 2004.
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: ktux\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-09 04:38+0000\n"
-"PO-Revision-Date: 2011-01-05 22:33+0000\n"
-"Last-Translator: Youssef Chahibi <Unknown>\n"
-"Language-Team: <en@li.org>\n"
+"PO-Revision-Date: 2012-03-12 22:44+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:02+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:28+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: src/sprite.cpp:54
 msgid "KTux"
-msgstr ""
+msgstr "KTux"
 
 #: src/sprite.cpp:55
 msgid "Tux Screen Saver"
-msgstr "مدخر الشاشة Tux"
+msgstr "حافظة الشاشة Tux"
 
 #: src/sprite.cpp:57
 msgid ""
 "1999 by Martin R. Jones\n"
 "2010 by Stefan Böhmann"
 msgstr ""
+"1999 by Martin R. Jones\n"
+"2010 by Stefan Böhmann"
 
 #: src/sprite.cpp:60
 msgid "Stefan Böhmann"
-msgstr ""
+msgstr "Stefan Böhmann"
 
 #: src/sprite.cpp:61
 msgid "Current maintainer"
-msgstr ""
+msgstr "المشرف الحالي"
 
 #: src/sprite.cpp:68
 msgid "Martin R. Jones"
-msgstr ""
+msgstr "Martin R. Jones"
 
 #: src/sprite.cpp:106
 msgid "A&bout"
-msgstr ""
+msgstr "حول"
 
 #: src/sprite.cpp:113
 msgid "Setup KTux"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kuiserver.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kuiserver.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kuiserver.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kuiserver.po	2012-03-23 06:41:58.000000000 +0000
@@ -11,7 +11,7 @@
 "Project-Id-Version: kuiserver\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:43+0000\n"
+"PO-Revision-Date: 2012-03-12 22:38+0000\n"
 "Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
@@ -19,9 +19,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:14+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:04+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: uiserver.cpp:125 uiserver.cpp:141
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kuiviewer.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kuiviewer.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kuiviewer.po	2012-02-23 06:20:11.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kuiviewer.po	2012-03-23 06:41:43.000000000 +0000
@@ -3,24 +3,25 @@
 #
 # Automatically generated, 2007.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kuiviewer\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 16:09+0000\n"
-"PO-Revision-Date: 2008-09-29 16:18+0000\n"
-"Last-Translator: Youssef Chahibi <Unknown>\n"
-"Language-Team: <en@li.org>\n"
+"PO-Revision-Date: 2012-03-12 22:59+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:53+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:24+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kuiviewer.cpp:81
 msgid "Unable to locate Kuiviewer kpart."
-msgstr ""
+msgstr "تعذّر تحديد موقع Kuiviewer kpart"
 
 #: kuiviewer.cpp:111
 msgid "*.ui *.UI|User Interface Files"
@@ -28,7 +29,7 @@
 
 #: kuiviewer_part.cpp:48
 msgid "KUIViewerPart"
-msgstr ""
+msgstr "KUIViewerPart"
 
 #: kuiviewer_part.cpp:50 main.cpp:32
 msgid "Displays Designer's UI files"
@@ -36,55 +37,57 @@
 
 #: kuiviewer_part.cpp:52 main.cpp:34
 msgid "Richard Moore"
-msgstr ""
+msgstr "Richard Moore"
 
 #: kuiviewer_part.cpp:53 main.cpp:35
 msgid "Ian Reinhart Geiser"
-msgstr ""
+msgstr "Ian Reinhart Geiser"
 
 #. i18n: file: kuiviewer_part.rc:14
 #. i18n: ectx: ToolBar (styleBar)
 #: kuiviewer_part.cpp:75 rc.cpp:12 rc.cpp:35
 msgid "Style"
-msgstr ""
+msgstr "النمط"
 
 #: kuiviewer_part.cpp:95
 msgid "Set the current style to view."
-msgstr ""
+msgstr "ضبط النمط الحاليّ للعرض."
 
 #: main.cpp:31
 msgid "KUIViewer"
-msgstr ""
+msgstr "KUIViewer"
 
 #: main.cpp:37
 msgid "Benjamin C. Meyer"
-msgstr ""
+msgstr "Benjamin C. Meyer"
 
 #: main.cpp:42
 msgid "Document to open"
-msgstr ""
+msgstr "المستند للفتح"
 
 #: main.cpp:44
 msgid "Save screenshot to file and exit"
-msgstr ""
+msgstr "احفظ إلى ملفّ و اخرج"
 
 #: main.cpp:46
 msgid "Screenshot width"
-msgstr ""
+msgstr "عرض صورة الشاشة"
 
 #: main.cpp:48
 msgid "Screenshot height"
-msgstr ""
+msgstr "ارتفاع صورة الشاشة"
 
 #: rc.cpp:22
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
-msgstr " ,Launchpad Contributions:"
+msgstr ""
+"Mohamed SAAD محمد سعد, Abdalrahim Fakhouri, ,Launchpad "
+"Contributions:,Abdalrahim G. Fakhouri"
 
 #: rc.cpp:23
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr ","
+msgstr "metehyi@free.fr,abdilra7eem@yahoo.com,,,"
 
 #. i18n: file: kuiviewer_part.rc:4
 #. i18n: ectx: Menu (file)
@@ -96,7 +99,7 @@
 #. i18n: ectx: Menu (file)
 #: rc.cpp:3 rc.cpp:15 rc.cpp:26 rc.cpp:38
 msgid "&File"
-msgstr ""
+msgstr "&ملف"
 
 #. i18n: file: kuiviewer_part.rc:7
 #. i18n: ectx: Menu (edit)
@@ -108,7 +111,7 @@
 #. i18n: ectx: Menu (edit)
 #: rc.cpp:6 rc.cpp:18 rc.cpp:29 rc.cpp:41
 msgid "&Edit"
-msgstr ""
+msgstr "&حرّر"
 
 #. i18n: file: kuiviewer_part.rc:10
 #. i18n: ectx: Menu (view)
@@ -120,4 +123,4 @@
 #. i18n: ectx: Menu (view)
 #: rc.cpp:9 rc.cpp:21 rc.cpp:32 rc.cpp:44
 msgid "&View"
-msgstr ""
+msgstr "ا&عرض"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kurifilter.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kurifilter.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kurifilter.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kurifilter.po	2012-03-23 06:41:58.000000000 +0000
@@ -11,15 +11,14 @@
 "Project-Id-Version: kurifilter\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:41+0000\n"
+"PO-Revision-Date: 2012-03-12 22:38+0000\n"
 "Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:15+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:05+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: ikwsopts.cpp:51
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kuser.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kuser.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kuser.po	2012-02-23 06:20:06.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kuser.po	2012-03-23 06:41:38.000000000 +0000
@@ -13,7 +13,7 @@
 "Project-Id-Version: kuser\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 02:38+0000\n"
-"PO-Revision-Date: 2012-01-26 12:39+0000\n"
+"PO-Revision-Date: 2012-03-13 01:07+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
@@ -21,11 +21,9 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:33+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:41+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
-"X-Poedit-Language: Arabic\n"
-"X-Poedit-SourceCharset: utf-8\n"
 
 #: ku_adduser.cpp:47
 msgid "New Account Options"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwalletd.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwalletd.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwalletd.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwalletd.po	2012-03-23 06:41:58.000000000 +0000
@@ -3,24 +3,25 @@
 # This file is distributed under the same license as the PACKAGE package.
 #
 # zayed <zayed.alsaidi@gmail.com>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kwalletd\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2009-07-24 13:29+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
+"PO-Revision-Date: 2012-03-12 22:42+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:16+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:06+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: kwalletwizard.cpp:39
 msgid "KWallet"
-msgstr ""
+msgstr "KWallet"
 
 #: kwalletwizard.cpp:147
 msgid "<qt>Password is empty.  <b>(WARNING: Insecure)</b></qt>"
@@ -253,13 +254,15 @@
 #: rc.cpp:49
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
-msgstr "زايد السعيدي, ,Launchpad Contributions:,Hsn,Zayed Amer Al-Saidi"
+msgstr ""
+"زايد السعيدي, ,Launchpad Contributions:,Abdalrahim G. Fakhouri,Hsn,Zayed "
+"Amer Al-Saidi"
 
 #: rc.cpp:50
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
 msgstr ""
-"zayed.alsaidi@gmail.com,,,hh.alshawaf@gmail.com,zayed.alsaidi@gmail.com"
+"zayed.alsaidi@gmail.com,,,,hh.alshawaf@gmail.com,zayed.alsaidi@gmail.com"
 
 #. i18n: file: kwalletwizardpagepassword.ui:16
 #. i18n: ectx: property (text), widget (QLabel, textLabel3)
@@ -324,7 +327,7 @@
 #. i18n: ectx: property (comment), widget (KTitleWidget, ktitlewidget)
 #: rc.cpp:18 rc.cpp:77
 msgid "The KDE Wallet System"
-msgstr ""
+msgstr "نظام حافظة كدي"
 
 #. i18n: file: kwalletwizardpageintro.ui:30
 #. i18n: ectx: property (text), widget (QLabel, textLabel2)
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwalletmanager.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwalletmanager.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwalletmanager.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwalletmanager.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,499 +0,0 @@
-# translation of kwalletmanager.po to
-# Copyright (C) 2004, 2006, 2007 Free Software Foundation, Inc.
-#
-# Ahmad M. Zawawi <azawawi@emirates.net.ae>, 2004.
-# Munzir Taha <munzir@kacst.edu.sa>, 2004.
-# Khaled Hosny <dr.khaled.hosny@gmail.com>, 2006.
-# Khaled Hosny <khaledhosny@eglug.org>, 2007.
-# Fahad Al-Saidi <fahad.alsaidi@gmail.com>, 2007.
-# Youssef Chahibi <chahibi@gmail.com>, 2007.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
-msgid ""
-msgstr ""
-"Project-Id-Version: kwalletmanager\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 13:31+0000\n"
-"PO-Revision-Date: 2012-01-27 00:19+0000\n"
-"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:11+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-
-#: allyourbase.cpp:213
-#, kde-format
-msgid "An entry by the name '%1' already exists. Would you like to continue?"
-msgstr "يوجد مُدخلة باسم '%1' . ماذا تريد أن تواصل؟"
-
-#: allyourbase.cpp:236
-#, kde-format
-msgid "A folder by the name '%1' already exists.  What would you like to do?"
-msgstr "يوجد مجلد باسم '%1' . ماذا تريد أن تعمل؟"
-
-#: allyourbase.cpp:236
-msgid "Replace"
-msgstr "استبدل"
-
-#: allyourbase.cpp:370
-msgid "Folders"
-msgstr "المجلدات"
-
-#: allyourbase.cpp:414
-msgid "An unexpected error occurred trying to drop the item"
-msgstr "حدث خطأ غير متوقع عند محاولة اسقاط العنصر"
-
-#: allyourbase.cpp:497
-msgid "An unexpected error occurred trying to drop the entry"
-msgstr "حدث خطأ غير متوقع عند محاولة اسقاط المُدخلة"
-
-#: allyourbase.cpp:526
-msgid ""
-"An unexpected error occurred trying to delete the original folder, but the "
-"folder has been copied successfully"
-msgstr ""
-"حدث خطأ غير متوقع عند محاولة حذف المجلد الأصلى، لكن  نُسخ المجلد بنجاح"
-
-#: allyourbase.cpp:686
-msgid "That wallet file already exists.  You cannot overwrite wallets."
-msgstr "ملف المحفظة موجود. لا يمكنك الكتابة فوق الَمحافِظ."
-
-#: kwalleteditor.cpp:89
-msgid "&Show values"
-msgstr "أ&ظهر القيم"
-
-#: kwalleteditor.cpp:174
-msgid "&New Folder..."
-msgstr "م&جلد جديد..."
-
-#: kwalleteditor.cpp:181
-msgid "&Delete Folder"
-msgstr "ا&حذف المجلد"
-
-#: kwalleteditor.cpp:189 kwalletpopup.cpp:51
-msgid "Change &Password..."
-msgstr "&غيّر كلمة السر..."
-
-#: kwalleteditor.cpp:195
-msgid "&Merge Wallet..."
-msgstr "ا&دمج المحفظة..."
-
-#: kwalleteditor.cpp:201
-msgid "&Import XML..."
-msgstr "ا&ستورد XML..."
-
-#: kwalleteditor.cpp:207
-msgid "&Export..."
-msgstr "&صدّر..."
-
-#: kwalleteditor.cpp:219
-msgid "&New..."
-msgstr "ج&ديد..."
-
-#: kwalleteditor.cpp:225
-msgid "&Rename"
-msgstr "أعد ت&سمية"
-
-#: kwalleteditor.cpp:231 kwalletpopup.cpp:79
-msgid "&Delete"
-msgstr "ا&حذف"
-
-#: kwalleteditor.cpp:253
-msgid ""
-"This wallet was forced closed.  You must reopen it to continue working with "
-"it."
-msgstr "هذه المحفظة أغلقت قسراً. يجب عليك إعادة فتحها لاستمرار بالعمل بها."
-
-#: kwalleteditor.cpp:288
-msgid "Passwords"
-msgstr "كلمات السر"
-
-#: kwalleteditor.cpp:289
-msgid "Maps"
-msgstr "خرائط"
-
-#: kwalleteditor.cpp:290
-msgid "Binary Data"
-msgstr "بيانات ثنائيّة"
-
-#: kwalleteditor.cpp:291
-msgid "Unknown"
-msgstr "غير معروف"
-
-#: kwalleteditor.cpp:330
-#, kde-format
-msgid "Are you sure you wish to delete the folder '%1' from the wallet?"
-msgstr "أمتأكد من أنك تريد حذف المجلد '%1' من الحافظة؟"
-
-#: kwalleteditor.cpp:334
-msgid "Error deleting folder."
-msgstr "خطأ في حذف المجلد."
-
-#: kwalleteditor.cpp:353
-msgid "New Folder"
-msgstr "مجلد جديد"
-
-#: kwalleteditor.cpp:354
-msgid "Please choose a name for the new folder:"
-msgstr "رجاءا اختر اسما للمجلد الجديد:"
-
-#: kwalleteditor.cpp:364
-msgid "Sorry, that folder name is in use. Try again?"
-msgstr "عذرا، اسم المجلد هذا قيد الاستخدام. حاول مرة أخرى؟"
-
-#: kwalleteditor.cpp:364 kwalleteditor.cpp:709
-msgid "Try Again"
-msgstr "المحاولة مرة أخرى"
-
-#: kwalleteditor.cpp:364 kwalleteditor.cpp:709 kwalletmanager.cpp:386
-msgid "Do Not Try"
-msgstr "لا تحاول"
-
-#: kwalleteditor.cpp:402
-#, kde-format
-msgid "Error saving entry. Error code: %1"
-msgstr "خطأ في حفظ المُدخلة. رقم الخطأ : %1"
-
-#: kwalleteditor.cpp:421
-msgid ""
-"The contents of the current item has changed.\n"
-"Do you want to save changes?"
-msgstr ""
-
-#: kwalleteditor.cpp:470 kwalleteditor.cpp:787
-#, kde-format
-msgid "Password: %1"
-msgstr "كلمة السر: %1"
-
-#: kwalleteditor.cpp:485 kwalleteditor.cpp:789
-#, kde-format
-msgid "Name-Value Map: %1"
-msgstr "خريطة اسم-قيمة: %1"
-
-#: kwalleteditor.cpp:493 kwalleteditor.cpp:791
-#, kde-format
-msgid "Binary Data: %1"
-msgstr "بيانات ثنائية: %1"
-
-#: kwalleteditor.cpp:697
-msgid "New Entry"
-msgstr "مُدخلة جديدة"
-
-#: kwalleteditor.cpp:698
-msgid "Please choose a name for the new entry:"
-msgstr "رجاءا اختر اسم للمُدخلة الجديدة:"
-
-#: kwalleteditor.cpp:709
-msgid "Sorry, that entry already exists. Try again?"
-msgstr "عذرا، المُدخلة موجودة مسبقا. حاول مرة أخرى؟"
-
-#: kwalleteditor.cpp:726 kwalleteditor.cpp:735
-msgid "An unexpected error occurred trying to add the new entry"
-msgstr "حدث خطأ غير متوقع أثناء محاولة إضافة المُدخلة الجديدة"
-
-#: kwalleteditor.cpp:783
-msgid "An unexpected error occurred trying to rename the entry"
-msgstr "حدث خطأ غير متوقع أثناء محاولة تغير اسم المُدخلة"
-
-#: kwalleteditor.cpp:803
-#, kde-format
-msgid "Are you sure you wish to delete the item '%1'?"
-msgstr "هل أنت متأكد من أنك تريد حذف العنصر '%1' ؟"
-
-#: kwalleteditor.cpp:807
-msgid "An unexpected error occurred trying to delete the entry"
-msgstr "حدث خطأ غير متوقع أثناء محاولة حذف المُدخلة"
-
-#: kwalleteditor.cpp:835
-msgid "Unable to open the requested wallet."
-msgstr "غير قادر على فتح المحفظة المطلوبة."
-
-#: kwalleteditor.cpp:871
-#, kde-format
-msgid "Unable to access wallet '<b>%1</b>'."
-msgstr "غير قادر على الوصول للمحفظة '<b>%1</b>'."
-
-#: kwalleteditor.cpp:901 kwalleteditor.cpp:932 kwalleteditor.cpp:967
-#: kwalleteditor.cpp:1058
-#, kde-format
-msgid ""
-"Folder '<b>%1</b>' already contains an entry '<b>%2</b>'.  Do you wish to "
-"replace it?"
-msgstr ""
-"يحتوى المجلد '<b>%1</b>' على المدخلة '<b>%2</b>' بالفعل.  هل ترغب فى "
-"استبدالها؟"
-
-#: kwalleteditor.cpp:1006
-#, kde-format
-msgid "Unable to access XML file '<b>%1</b>'."
-msgstr "غير قادر على الوصول لملف الـXML  '<b>%1</b>'."
-
-#: kwalleteditor.cpp:1012
-#, kde-format
-msgid "Error opening XML file '<b>%1</b>' for input."
-msgstr "حدث خطأ عند فتح ملف الـXML '<b>%1</b>' للإدخال."
-
-#: kwalleteditor.cpp:1019
-#, kde-format
-msgid "Error reading XML file '<b>%1</b>' for input."
-msgstr "حدث خطأ عند قرائة ملف الـXML '<b>%1</b>' للإدخال."
-
-#: kwalleteditor.cpp:1026
-msgid "Error: XML file does not contain a wallet."
-msgstr "خطأ: لا يحتوى ملف الـXML على محفظة."
-
-#: kwalletmanager.cpp:68 kwalletmanager.cpp:75 kwalletmanager.cpp:188
-#: kwalletmanager.cpp:334
-msgid "KDE Wallet"
-msgstr "محفظة كدى"
-
-#: kwalletmanager.cpp:68 kwalletmanager.cpp:334
-msgid "No wallets open."
-msgstr "لا توجد محافظ مفتوحة."
-
-#: kwalletmanager.cpp:75 kwalletmanager.cpp:188
-msgid "A wallet is open."
-msgstr "محفظة مفتوحة."
-
-#: kwalletmanager.cpp:119 kwalletpopup.cpp:40
-msgid "&New Wallet..."
-msgstr "مح&فظة جديدة..."
-
-#: kwalletmanager.cpp:123
-msgid "Configure &Wallet..."
-msgstr "إع&داد المحفظة..."
-
-#: kwalletmanager.cpp:131
-msgid "Close &All Wallets"
-msgstr "أغلق &كل المحافظ"
-
-#: kwalletmanager.cpp:142
-msgid "Open Wallet"
-msgstr "افتح المحفظة"
-
-#: kwalletmanager.cpp:146
-msgid "Delete Wallet"
-msgstr "احذف المحفظة"
-
-#: kwalletmanager.cpp:236
-#, kde-format
-msgid "Are you sure you wish to delete the wallet '%1'?"
-msgstr "أمتأكد من أنك تريد حذف المحفظة '%1' ؟"
-
-#: kwalletmanager.cpp:242
-#, kde-format
-msgid "Unable to delete the wallet. Error code was %1."
-msgstr "غير قادر على حذف المحفظة. رقم الخطا %1 ."
-
-#: kwalletmanager.cpp:251
-msgid ""
-"Unable to close wallet cleanly. It is probably in use by other applications. "
-"Do you wish to force it closed?"
-msgstr ""
-"لا يمكن إغلاق المحفظة بصورة نظيفة. ربما تكون قيد الاستخدام من قبل تطبيقات "
-"أخرى. هل تريد الإجبار على الإغلاق؟"
-
-#: kwalletmanager.cpp:251
-msgid "Force Closure"
-msgstr "أجبر على الإغلاق"
-
-#: kwalletmanager.cpp:251
-msgid "Do Not Force"
-msgstr "لا تجبر"
-
-#: kwalletmanager.cpp:255
-#, kde-format
-msgid "Unable to force the wallet closed. Error code was %1."
-msgstr "لا يمكن اجبار إغلاق المحفظة. رقم الخطأ هو %1."
-
-#: kwalletmanager.cpp:276 kwalletmanager.cpp:318
-#, kde-format
-msgid "Error opening wallet %1."
-msgstr "خطأ في فتح المحفظة %1 ."
-
-#: kwalletmanager.cpp:369
-msgid "Please choose a name for the new wallet:"
-msgstr "رجاءا اختر اسم للمحفظة الجديدة:"
-
-#: kwalletmanager.cpp:378
-msgid "New Wallet"
-msgstr "محفظة جديدة"
-
-#: kwalletmanager.cpp:386
-msgid "Sorry, that wallet already exists. Try a new name?"
-msgstr "عذرا، المحفظة موجوده مسبقا. تجربة اسم جديد ؟"
-
-#: kwalletmanager.cpp:386
-msgid "Try New"
-msgstr "تجربة اسم جديد"
-
-#: kwalletpopup.cpp:45
-msgid "&Open..."
-msgstr "ا&فتح..."
-
-#: kwalletpopup.cpp:67
-msgid "Disconnec&t"
-msgstr "اق&طع الاتصال"
-
-#: kwmapeditor.cpp:45
-msgid "Key"
-msgstr "المفتاح"
-
-#: kwmapeditor.cpp:46
-msgid "Value"
-msgstr "القيمة"
-
-#: kwmapeditor.cpp:123
-msgid "&New Entry"
-msgstr "مُ&دخلة جديدة"
-
-#: main.cpp:44 main.cpp:69
-msgid "KDE Wallet Manager"
-msgstr "مدير محفظة كدى"
-
-#: main.cpp:45
-msgid "KDE Wallet Management Tool"
-msgstr "أداة إدارة محفظة كدى"
-
-#: main.cpp:47
-msgid "(c) 2003,2004 George Staikos"
-msgstr "الحقوق محفوظة لجورج ستايكوس 2003،2004"
-
-#: main.cpp:50
-msgid "Michael Leupold"
-msgstr "Michael Leupold"
-
-#: main.cpp:50
-msgid "Maintainer"
-msgstr "مشرف المشروع"
-
-#: main.cpp:51
-msgid "George Staikos"
-msgstr "George Staikos"
-
-#: main.cpp:51
-msgid "Original author and former maintainer"
-msgstr "المؤلّف الرئيسي والمشرف السابق"
-
-#: main.cpp:52
-msgid "Isaac Clerencia"
-msgstr "Isaac Clerencia"
-
-#: main.cpp:52
-msgid "Developer"
-msgstr "مطوّر"
-
-#: main.cpp:57
-msgid "Show window on startup"
-msgstr "أظهر النافذة عند البدأ"
-
-#: main.cpp:58
-msgid "For use by kwalletd only"
-msgstr "لإستخدام بواسطة محفظة ك فقط"
-
-#: main.cpp:59
-msgid "A wallet name"
-msgstr "اسم محفظة"
-
-#: rc.cpp:43
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr ""
-"عبدالرحمن عبدالخالق غريب, منذر طه, خالد حسنى, فهد السعيدي, ,Launchpad "
-"Contributions:,Khaled Hosny,Munzir Taha"
-
-#: rc.cpp:44
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr ""
-"king_abdo@yahoo.com, munzir@kacst.edu.sa, dr.khaled.hosny@gmail.com, "
-"Fahad.alsaidi@gmail.com,,,khaledhosny@eglug.org,"
-
-#. i18n: file: kwalleteditor.rc:4
-#. i18n: ectx: Menu (file)
-#. i18n: file: kwalletmanager.rc:4
-#. i18n: ectx: Menu (file)
-#. i18n: file: kwalleteditor.rc:4
-#. i18n: ectx: Menu (file)
-#. i18n: file: kwalletmanager.rc:4
-#. i18n: ectx: Menu (file)
-#: rc.cpp:15 rc.cpp:21 rc.cpp:47 rc.cpp:53
-msgid "&File"
-msgstr "&ملف"
-
-#. i18n: file: kwalleteditor.rc:14
-#. i18n: ectx: Menu (help)
-#. i18n: file: kwalletmanager.rc:11
-#. i18n: ectx: Menu (help)
-#. i18n: file: kwalleteditor.rc:14
-#. i18n: ectx: Menu (help)
-#. i18n: file: kwalletmanager.rc:11
-#. i18n: ectx: Menu (help)
-#: rc.cpp:18 rc.cpp:27 rc.cpp:50 rc.cpp:59
-msgid "&Help"
-msgstr "م&ساعدة"
-
-#. i18n: file: kwalletmanager.rc:8
-#. i18n: ectx: Menu (settings)
-#: rc.cpp:24 rc.cpp:56
-msgid "&Settings"
-msgstr "إ&عدادات"
-
-#. i18n: file: kbetterthankdialogbase.ui:43
-#. i18n: ectx: property (text), widget (QPushButton, _allowOnce)
-#: rc.cpp:3 rc.cpp:62
-msgid "&Replace"
-msgstr "استب&دل"
-
-#. i18n: file: kbetterthankdialogbase.ui:53
-#. i18n: ectx: property (text), widget (QPushButton, _allowAlways)
-#: rc.cpp:6 rc.cpp:65
-msgid "Replace &All"
-msgstr "استبدل ال&كل"
-
-#. i18n: file: kbetterthankdialogbase.ui:60
-#. i18n: ectx: property (text), widget (QPushButton, _deny)
-#: rc.cpp:9 rc.cpp:68
-msgid "&Skip"
-msgstr "تخ&طّى"
-
-#. i18n: file: kbetterthankdialogbase.ui:67
-#. i18n: ectx: property (text), widget (QPushButton, _denyForever)
-#: rc.cpp:12 rc.cpp:71
-msgid "Skip A&ll"
-msgstr "تخطّى الك&ل"
-
-#. i18n: file: walletwidget.ui:127
-#. i18n: ectx: property (text), widget (KPushButton, _hideContents)
-#: rc.cpp:30 rc.cpp:74
-msgid "Hide &Contents"
-msgstr "ا&خف المحتويات"
-
-#. i18n: file: walletwidget.ui:185
-#. i18n: ectx: property (text), widget (QLabel, textLabel1_2)
-#: rc.cpp:33 rc.cpp:77
-msgid ""
-"This is a binary data entry.  It cannot be editted as its format is unknown "
-"and application specific."
-msgstr ""
-"هذا مدخل بيانات ثنائي. لا يمكن تحريره بسبب أن نسقه غير معروف وخاص بتطبيق "
-"معين."
-
-#. i18n: file: walletwidget.ui:232
-#. i18n: ectx: property (text), widget (KPushButton, _showContents)
-#: rc.cpp:36 rc.cpp:80
-msgid "Show &Contents"
-msgstr "أظ&هر المحتويات"
-
-#. i18n: file: walletwidget.ui:289
-#. i18n: ectx: property (text), widget (KPushButton, _undoChanges)
-#: rc.cpp:39 rc.cpp:83
-msgid "&Undo"
-msgstr "&تراجع"
-
-#. i18n: file: walletwidget.ui:299
-#. i18n: ectx: property (text), widget (KPushButton, _saveChanges)
-#: rc.cpp:42 rc.cpp:86
-msgid "&Save"
-msgstr "ا&حفظ"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwatchgnupg.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwatchgnupg.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwatchgnupg.po	2012-02-23 06:20:10.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwatchgnupg.po	2012-03-23 06:41:42.000000000 +0000
@@ -8,7 +8,7 @@
 "Project-Id-Version: kwatchgnupg\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 03:45+0000\n"
-"PO-Revision-Date: 2012-01-25 07:24+0000\n"
+"PO-Revision-Date: 2012-03-14 17:54+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
@@ -16,8 +16,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:38+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:17+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: aboutdata.cpp:40
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwin_art_clients.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwin_art_clients.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwin_art_clients.po	2012-02-23 06:20:06.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwin_art_clients.po	2012-03-23 06:41:38.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:37+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:43+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: web/Web.cpp:56
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwin_clients.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwin_clients.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwin_clients.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwin_clients.po	2012-03-23 06:42:04.000000000 +0000
@@ -11,14 +11,14 @@
 "Project-Id-Version: kwin_clients\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:16+0000\n"
+"PO-Revision-Date: 2012-03-12 22:26+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:15+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:16+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: laptop/laptopclient.cpp:372
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwin_effects.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwin_effects.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwin_effects.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwin_effects.po	2012-03-23 06:42:04.000000000 +0000
@@ -10,16 +10,16 @@
 "Project-Id-Version: kwin_effects\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:16+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-13 08:31+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:16+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:17+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: thumbnailaside/thumbnailaside.cpp:38
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwin.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwin.po	2012-03-23 06:42:04.000000000 +0000
@@ -16,16 +16,15 @@
 "Project-Id-Version: kwin\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:16+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-14 17:04+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:14+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:16+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: activation.cpp:757
 #, kde-format
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwinshutdown.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwinshutdown.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwinshutdown.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwinshutdown.po	2012-03-23 06:41:58.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:17+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:06+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: main.cpp:33
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwinstartmenu.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwinstartmenu.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwinstartmenu.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwinstartmenu.po	2012-03-23 06:41:58.000000000 +0000
@@ -10,15 +10,14 @@
 "Project-Id-Version: kwinstartmenu\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:42+0000\n"
+"PO-Revision-Date: 2012-03-12 22:38+0000\n"
 "Last-Translator: Abderrahim Kitouni <a.kitouni@gmail.com>\n"
 "Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:17+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:06+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: main.cpp:42
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwordquiz.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwordquiz.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwordquiz.po	2012-02-23 06:20:34.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwordquiz.po	2012-03-23 06:42:07.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:39+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 01:07+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kwordquizprefs.cpp:36
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwriteconfig.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwriteconfig.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwriteconfig.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwriteconfig.po	2012-03-23 06:41:58.000000000 +0000
@@ -12,14 +12,14 @@
 "Project-Id-Version: kwriteconfig\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-26 13:07+0000\n"
+"PO-Revision-Date: 2012-03-14 17:34+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:18+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:07+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: kwriteconfig.cpp:35
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwrite.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwrite.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kwrite.po	2012-02-23 06:20:29.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kwrite.po	2012-03-23 06:42:01.000000000 +0000
@@ -5,21 +5,21 @@
 #
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # Abdulaziz AlSharif <a.a-a.s@hotmail.com>, 2007.
-# zayed <zayed.alsaidi@gmail.com>, 2008, 2009.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2009, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kwrite\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 17:20+0000\n"
-"PO-Revision-Date: 2011-01-06 05:17+0000\n"
+"PO-Revision-Date: 2012-03-12 22:33+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 04:14+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:39+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: kwritemain.cpp:72 kwritemain.cpp:487
 msgid ""
@@ -136,7 +136,7 @@
 
 #: kwritemain.cpp:630
 msgid "(c) 2000-2010 The Kate Authors"
-msgstr ""
+msgstr "جميع الحقوق محفوظة، 2000-2010، مؤلفو Kate"
 
 #: kwritemain.cpp:643
 msgid "Christoph Cullmann"
@@ -381,14 +381,16 @@
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
 msgstr ""
-"يوسف الشهيبي,عبدالعزيز الشريف,زايد السعيدي, ,Launchpad Contributions:,drsaudi"
+"يوسف الشهيبي,عبدالعزيز الشريف,زايد السعيدي, ,Launchpad Contributions:,Zayed "
+"Amer Al-Saidi,drsaudi"
 
 #: rc.cpp:23
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
 msgstr ""
 "chahibi@gmail.com,a.a-"
-"a.s@hotmail.com,zayed.alsaidi@gmail.com,,,mon7b6@gmail.com"
+"a.s@hotmail.com,zayed.alsaidi@gmail.com,,,zayed.alsaidi@gmail.com,mon7b6@gmai"
+"l.com"
 
 #. i18n: file: kwriteui.rc:5
 #. i18n: ectx: Menu (file)
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kxkb.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kxkb.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kxkb.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kxkb.po	2012-03-23 06:42:04.000000000 +0000
@@ -11,40 +11,40 @@
 # AbdulAziz AlSharif <a.a-a.s@hotmail.com>, 2007.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kxkb\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 23:52+0000\n"
+"PO-Revision-Date: 2012-03-14 17:03+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
+"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:17+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Poedit-Language: Arabic\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:17+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: kcm_add_layout_dialog.cpp:54
 msgid "Any language"
-msgstr ""
+msgstr "أيّ لغة"
 
 #: kcm_add_layout_dialog.cpp:134 kcm_view_models.cpp:288
 msgctxt "variant"
 msgid "Default"
-msgstr ""
+msgstr "المبدئي"
 
 #: kcm_keyboard.cpp:53
 msgid "KDE Keyboard Control Module"
-msgstr ""
+msgstr "وحدةكدي لتبديل تخطيط لوحة المفاتيح"
 
 #: kcm_keyboard.cpp:55
 msgid "(c) 2010 Andriy Rysin"
-msgstr ""
+msgstr "(c) 2010 Andriy Rysin"
 
 #: kcm_keyboard.cpp:58
 msgid ""
@@ -55,37 +55,45 @@
 #: kcm_keyboard_widget.cpp:178
 msgctxt "unknown keyboard model vendor"
 msgid "Unknown"
-msgstr ""
+msgstr "مجهول"
 
 #: kcm_keyboard_widget.cpp:180
 #, kde-format
 msgctxt "vendor | keyboard model"
 msgid "%1 | %2"
-msgstr ""
+msgstr "%1 | %2"
 
 #: kcm_keyboard_widget.cpp:190
 #, kde-format
 msgid "Only up to %1 keyboard layout is supported"
 msgid_plural "Only up to %1 keyboard layouts are supported"
 msgstr[0] ""
-msgstr[1] ""
+msgstr[1] "يسمح بتخطيط لوحة مفاتيح واحد فقط"
+msgstr[2] "يسمح بتخطيطيّ لوحة مفاتيح على الأكثر"
+msgstr[3] "يسمح حتى %1 تخطيطات لوحة مفاتيح فقط"
+msgstr[4] "يسمح حتى %تخطيط لوحة مفاتيح فقط"
+msgstr[5] "يسمح حتى %1 تخطيط لوحة مفاتيح فقط"
 
 #: kcm_keyboard_widget.cpp:533
 msgctxt "no shortcuts defined"
 msgid "None"
-msgstr ""
+msgstr "بدون"
 
 #: kcm_keyboard_widget.cpp:549
 #, kde-format
 msgid "%1 shortcut"
 msgid_plural "%1 shortcuts"
-msgstr[0] ""
-msgstr[1] ""
+msgstr[0] "لا اختصارات"
+msgstr[1] "اختصار واحد"
+msgstr[2] "اختصاران"
+msgstr[3] "%1 اختصارات"
+msgstr[4] "%1 اختصاراً"
+msgstr[5] "%1 اختصار"
 
 #: kcm_view_models.cpp:210
 msgctxt "layout map name"
 msgid "Map"
-msgstr ""
+msgstr "الخريطة"
 
 #: kcm_view_models.cpp:210
 msgid "Layout"
@@ -101,28 +109,28 @@
 
 #: kcm_view_models.cpp:225
 msgid "Shortcut"
-msgstr ""
+msgstr "اختصار"
 
 #: keyboard_applet.cpp:51
 msgid "XKB extension failed to initialize"
-msgstr ""
+msgstr "فشل بدء ملحق XKB"
 
 #: layout_tray_icon.cpp:49 layout_tray_icon.cpp:50
 msgctxt "tooltip title"
 msgid "Keyboard Layout"
-msgstr ""
+msgstr "تخطيط لوحة المفاتيح"
 
 #: layouts_menu.cpp:79
 #, kde-format
 msgctxt "short layout label - full layout name"
 msgid "%1 - %2"
-msgstr ""
+msgstr "%1 - %2"
 
 #: flags.cpp:120
 #, kde-format
 msgctxt "layout - variant"
 msgid "%1 - %2"
-msgstr ""
+msgstr "%1 - %2"
 
 #: layouts_menu.cpp:120
 msgid "Configure..."
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kxsconfig.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kxsconfig.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/kxsconfig.po	2012-02-23 06:20:07.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/kxsconfig.po	2012-03-23 06:41:38.000000000 +0000
@@ -18,8 +18,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:37+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:43+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kxsconfig.cpp:128
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/lancelot.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/lancelot.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/lancelot.po	2012-02-23 06:20:20.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/lancelot.po	2012-03-23 06:41:51.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:17+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:08+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: application/AboutData.cpp:26 application/LancelotWindow.cpp:888
 #: launcher/LancelotAppletConfig.cpp:56
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libakonadi.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libakonadi.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libakonadi.po	2012-02-23 06:20:17.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libakonadi.po	2012-03-23 06:41:47.000000000 +0000
@@ -16,8 +16,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:05+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:18+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: agentactionmanager.cpp:51
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libk3bdevice.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libk3bdevice.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libk3bdevice.po	2012-02-23 06:20:06.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libk3bdevice.po	2012-03-23 06:41:37.000000000 +0000
@@ -12,8 +12,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:28+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:38+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: k3bdeviceglobals.cpp:29 k3bdeviceglobals.cpp:152
 msgid "CD-R"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libk3b.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libk3b.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libk3b.po	2012-02-23 06:20:06.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libk3b.po	2012-03-23 06:41:37.000000000 +0000
@@ -15,8 +15,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:27+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:37+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: projects/k3babstractwriter.cpp:56
 msgid "Unlocking drive..."
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkasten.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkasten.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkasten.po	2012-02-23 06:20:11.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkasten.po	2012-03-23 06:41:43.000000000 +0000
@@ -9,14 +9,14 @@
 "Project-Id-Version: okteta\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 16:09+0000\n"
-"PO-Revision-Date: 2012-01-26 23:56+0000\n"
+"PO-Revision-Date: 2012-03-12 23:58+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:54+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:25+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: core/system/dialoghandler.cpp:40
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkcddb.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkcddb.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkcddb.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkcddb.po	2012-03-23 06:41:40.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:06+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:58+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: categories.cpp:22 genres.cpp:70
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkcompactdisc.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkcompactdisc.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkcompactdisc.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkcompactdisc.po	2012-03-23 06:41:40.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:06+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:58+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kcompactdisc_p.cpp:220
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkdcraw.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkdcraw.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkdcraw.po	2012-02-23 06:20:19.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkdcraw.po	2012-03-23 06:41:50.000000000 +0000
@@ -11,14 +11,14 @@
 "Project-Id-Version: libkdcraw\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 13:31+0000\n"
-"PO-Revision-Date: 2012-01-25 20:22+0000\n"
+"PO-Revision-Date: 2012-03-13 22:12+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:48+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:48+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: libkdcraw/dcrawsettingswidget.cpp:203
 msgctxt "@option:check"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkdecorations.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkdecorations.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkdecorations.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkdecorations.po	2012-03-23 06:42:04.000000000 +0000
@@ -2,26 +2,26 @@
 #
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kwin_lib\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2011-07-20 15:19+0000\n"
-"Last-Translator: Youssef Chahibi <Unknown>\n"
-"Language-Team: <en@li.org>\n"
+"PO-Revision-Date: 2012-03-12 22:23+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:17+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:18+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
-"X-Poedit-Language: Arabic\n"
 
 #: kcommondecoration.cpp:291
 #, kde-format
 msgid "<center><b>%1</b></center>"
-msgstr ""
+msgstr "<center><b>%1</b></center>"
 
 #: kcommondecoration.cpp:381
 msgid "Menu"
@@ -84,7 +84,7 @@
 #: kdecoration_plugins_p.cpp:109
 msgid ""
 "Loading of window decoration plugin library disabled in configuration."
-msgstr ""
+msgstr "تحميل مكتبة إضافة زخرفة النوافذ معطّل في الإعدادات"
 
 #: kdecoration_plugins_p.cpp:129
 msgid "No window decoration plugin library was found."
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkdegames.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkdegames.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkdegames.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkdegames.po	2012-03-23 06:41:39.000000000 +0000
@@ -18,8 +18,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:56+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:53+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: kstandardgameaction.cpp:51
 msgctxt "new game"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkdepim.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkdepim.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkdepim.po	2012-02-23 06:20:11.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkdepim.po	2012-03-23 06:41:42.000000000 +0000
@@ -18,8 +18,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:39+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:18+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: addcontactjob.cpp:61
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkexiv2.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkexiv2.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkexiv2.po	2012-02-23 06:20:18.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkexiv2.po	2012-03-23 06:41:49.000000000 +0000
@@ -7,14 +7,14 @@
 "Project-Id-Version: digikam\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 13:12+0000\n"
-"PO-Revision-Date: 2012-01-26 22:23+0000\n"
+"PO-Revision-Date: 2012-03-14 06:26+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:28+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:32+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: libkexiv2/altlangstredit.cpp:66
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkholidays.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkholidays.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkholidays.po	2012-02-23 06:20:17.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkholidays.po	2012-03-23 06:41:48.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:08+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:20+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: astroseasons.cpp:39
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkleopatra.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkleopatra.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkleopatra.po	2012-02-23 06:20:11.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkleopatra.po	2012-03-23 06:41:42.000000000 +0000
@@ -13,8 +13,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:40+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:18+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #. i18n: file: ui/adddirectoryservicedialog.ui:13
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkmahjongg.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkmahjongg.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkmahjongg.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkmahjongg.po	2012-03-23 06:41:39.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:56+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:54+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kmahjonggconfigdialog.cpp:57
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkmime.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkmime.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkmime.po	2012-02-23 06:20:17.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkmime.po	2012-03-23 06:41:48.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:09+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:21+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: kmime_dateformatter.cpp:225
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libknetworkmanager.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libknetworkmanager.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libknetworkmanager.po	2012-02-23 06:20:24.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libknetworkmanager.po	2012-03-23 06:41:56.000000000 +0000
@@ -9,7 +9,7 @@
 "Project-Id-Version: networkmanagement_vpncui\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-01 20:15+0000\n"
-"PO-Revision-Date: 2012-02-13 19:17+0000\n"
+"PO-Revision-Date: 2012-03-01 23:19+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
@@ -17,8 +17,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:23+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:32+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: vpnplugins/novellvpn/novellvpnwidget.cpp:63
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkonq.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkonq.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkonq.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkonq.po	2012-03-23 06:42:00.000000000 +0000
@@ -13,14 +13,13 @@
 # AbdulAziz AlSharif <a.a-a.s@hotmail.com>, 2007.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # majed <gmajedli@gmail.com>, 2008.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: libkonq\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2012-01-25 11:02+0000\n"
+"PO-Revision-Date: 2012-03-12 22:31+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
@@ -28,9 +27,9 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:49+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Poedit-Language: Arabic\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:25+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: konq_copytomenu.cpp:78
 msgctxt "@title:menu"
@@ -98,39 +97,39 @@
 #: konq_operations.cpp:814
 msgctxt "@action:button"
 msgid "Create directory"
-msgstr ""
+msgstr "أنشئ دليل"
 
 #: konq_operations.cpp:816
 msgctxt "@action:button"
 msgid "Enter a different name"
-msgstr ""
+msgstr "ادخل اسم مختلف"
 
 #: konq_operations.cpp:819
 #, kde-format
 msgid ""
 "The name \"%1\" starts with a dot, so the directory will be hidden by "
 "default."
-msgstr ""
+msgstr "الاسم \"%1\" يبدأ بنقطة ، لذا سيكون الدليل مخفي بشكل افتراضي."
 
 #: konq_operations.cpp:836
 msgctxt "@title:window"
 msgid "Create hidden directory?"
-msgstr ""
+msgstr "أأنشئ دليل مخفي؟"
 
 #: konq_operations.cpp:847
 msgctxt "@label Default name when creating a folder"
 msgid "New Folder"
-msgstr ""
+msgstr "مجلد جديد"
 
 #: konq_operations.cpp:854
 msgctxt "@title:window"
 msgid "New Folder"
-msgstr ""
+msgstr "مجلد جديد"
 
 #: konq_operations.cpp:855
 msgctxt "@label:textbox"
 msgid "Enter folder name:"
-msgstr ""
+msgstr "أدخل اسم المجلد:"
 
 #: konq_operations.cpp:947
 msgctxt "@action:inmenu"
@@ -202,7 +201,7 @@
 
 #: konq_popupmenu.cpp:351
 msgid "&Configure Trash Bin"
-msgstr ""
+msgstr "ا&ضبط إعدادات سلة المهملات"
 
 #: konq_popupmenu.cpp:363
 msgid "&Bookmark This Page"
@@ -239,4 +238,4 @@
 #: konq_statusbarmessagelabel.cpp:80
 msgctxt "@info"
 msgid "Close"
-msgstr ""
+msgstr "أغلق"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkremotecontrol.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkremotecontrol.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkremotecontrol.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkremotecontrol.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,983 +0,0 @@
-# Copyright (C) YEAR This_file_is_part_of_KDE
-# This file is distributed under the same license as the PACKAGE package.
-#
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-msgid ""
-msgstr ""
-"Project-Id-Version: \n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 13:31+0000\n"
-"PO-Revision-Date: 2012-01-26 17:17+0000\n"
-"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:12+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-
-#: dbusinterface.cpp:195
-msgctxt "The name of a parameter"
-msgid "unknown"
-msgstr "مجهول"
-
-#: keypressaction.cpp:33
-msgid "Workspace"
-msgstr ""
-
-#: keypressaction.cpp:37
-msgid "Keypress:"
-msgstr ""
-
-#. i18n: file: ../profiles/amarok.profile.xml:6
-#: rc.cpp:2
-msgid "Amarok"
-msgstr ""
-
-#. i18n: file: ../profiles/dragonplayer.profile.xml:6
-#: rc.cpp:4
-msgid "Dragon Player"
-msgstr ""
-
-#. i18n: file: ../profiles/klauncher.profile.xml:5
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/klauncher.profile.xml:10
-#: rc.cpp:6 rc.cpp:137
-msgid "Run command"
-msgstr ""
-
-#. i18n: file: ../profiles/klauncher.profile.xml:6
-#: rc.cpp:8
-msgid "Run commands with KLauncher"
-msgstr ""
-
-#. i18n: file: ../profiles/kmix.profile.xml:7
-#: rc.cpp:10
-msgid "Sound Mixer"
-msgstr ""
-
-#. i18n: file: ../profiles/kmix.profile.xml:8
-#: rc.cpp:12
-msgid "Volume control actions for kmix"
-msgstr ""
-
-#. i18n: file: ../profiles/konqueror.profile.xml:6
-#: rc.cpp:14
-msgid "Konqueror"
-msgstr ""
-
-#. i18n: file: ../profiles/kscd.profile.xml:6
-#: rc.cpp:16
-msgid "KsCD"
-msgstr ""
-
-#. i18n: file: ../profiles/okular.profile.xml:6
-#: rc.cpp:18
-msgid "Okular"
-msgstr ""
-
-#. i18n: file: ../profiles/powermanagement.profile.xml:6
-#: rc.cpp:20
-msgid "Power management"
-msgstr ""
-
-#. i18n: file: ../profiles/powermanagement.profile.xml:7
-#: rc.cpp:22
-msgid "Shutdown, suspend or reboot your computer"
-msgstr ""
-
-#. i18n: file: ../profiles/vlc.profile.xml:6
-#: rc.cpp:24
-msgid "VLC videolan player"
-msgstr ""
-
-#. i18n: file: ../profiles/vlc.profile.xml:7
-#: rc.cpp:26
-msgid ""
-"This profile works only if VLC is configured for single instance running"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/amarok.profile.xml:12
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/dragonplayer.profile.xml:11
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/kscd.profile.xml:10
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/vlc.profile.xml:12
-#: rc.cpp:29 rc.cpp:89 rc.cpp:200 rc.cpp:389
-msgid "Play"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/amarok.profile.xml:12
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/dragonplayer.profile.xml:11
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/vlc.profile.xml:12
-#: rc.cpp:32 rc.cpp:92 rc.cpp:392
-msgid "Start playing"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/amarok.profile.xml:22
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/dragonplayer.profile.xml:21
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/kscd.profile.xml:20
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/vlc.profile.xml:21
-#: rc.cpp:35 rc.cpp:95 rc.cpp:206 rc.cpp:395
-msgid "Stop"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/amarok.profile.xml:22
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/dragonplayer.profile.xml:21
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/vlc.profile.xml:21
-#: rc.cpp:38 rc.cpp:98 rc.cpp:398
-msgid "Stop playing"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/amarok.profile.xml:33
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/vlc.profile.xml:30
-#: rc.cpp:41 rc.cpp:401
-msgid "Pause"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/amarok.profile.xml:33
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/vlc.profile.xml:30
-#: rc.cpp:44 rc.cpp:404
-msgid "Pause playing"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/amarok.profile.xml:43
-#: rc.cpp:47
-msgid "Play Pause"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/amarok.profile.xml:43
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/dragonplayer.profile.xml:31
-#: rc.cpp:50 rc.cpp:104
-msgid "Toggle Play/Pause"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/amarok.profile.xml:53
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/dragonplayer.profile.xml:43
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/vlc.profile.xml:39
-#: rc.cpp:53 rc.cpp:107 rc.cpp:407
-msgid "Skip Forward"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/amarok.profile.xml:53
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/dragonplayer.profile.xml:43
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/vlc.profile.xml:39
-#: rc.cpp:56 rc.cpp:110 rc.cpp:410
-msgid "Advance to next track"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/amarok.profile.xml:63
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/dragonplayer.profile.xml:54
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/vlc.profile.xml:49
-#: rc.cpp:59 rc.cpp:113 rc.cpp:413
-msgid "Skip Backward"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/amarok.profile.xml:63
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/dragonplayer.profile.xml:54
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/vlc.profile.xml:49
-#: rc.cpp:62 rc.cpp:116 rc.cpp:416
-msgid "Go to previous track"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/amarok.profile.xml:73
-#: rc.cpp:65
-msgid "Fast Forward"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/amarok.profile.xml:73
-#: rc.cpp:68
-msgid "Seek forward"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/amarok.profile.xml:79
-#: rc.cpp:71
-msgid "Amount to fast forward in ms"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/amarok.profile.xml:88
-#: rc.cpp:74
-msgid "Backward"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/amarok.profile.xml:88
-#: rc.cpp:77
-msgid "Seek backward"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/amarok.profile.xml:94
-#: rc.cpp:80
-msgid "Amount to rewind in ms"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/amarok.profile.xml:103
-#: rc.cpp:83
-msgid "Fullscreen"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/amarok.profile.xml:103
-#: rc.cpp:86
-msgid "Toggle fullscreen mode"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/kmix.profile.xml:13
-#: rc.cpp:155
-msgid "Volume Up"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/amarok.profile.xml:113
-#: rc.cpp:92
-msgid "Increases Volume"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/amarok.profile.xml:119
-#: rc.cpp:95
-msgid "Amount to increase volume in percent"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/kmix.profile.xml:28
-#: rc.cpp:164
-msgid "Volume Down"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/amarok.profile.xml:128
-#: rc.cpp:101
-msgid "Decreases Volume"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/amarok.profile.xml:134
-#: rc.cpp:104
-msgid "Amount to decrease volume in percent"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/dragonplayer.profile.xml:31
-#: rc.cpp:101
-msgid "Play/Pause"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/klauncher.profile.xml:10
-#: rc.cpp:140
-msgid "Runs a command with optional arguments"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/klauncher.profile.xml:16
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/klauncher.profile.xml:34
-#: rc.cpp:125 rc.cpp:143
-msgid "The executable name and path of the program or script to run"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/klauncher.profile.xml:18
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/klauncher.profile.xml:36
-#: rc.cpp:128 rc.cpp:146
-msgid "Parameters for the program or script"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/klauncher.profile.xml:20
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/klauncher.profile.xml:38
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/powermanagement.profile.xml:23
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/powermanagement.profile.xml:43
-#: rc.cpp:131 rc.cpp:149 rc.cpp:320 rc.cpp:338
-msgid "Environment variables"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/klauncher.profile.xml:22
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/klauncher.profile.xml:40
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/powermanagement.profile.xml:25
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/powermanagement.profile.xml:45
-#: rc.cpp:134 rc.cpp:152 rc.cpp:323 rc.cpp:341
-msgid "Startup ID"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/kmix.profile.xml:13
-#: rc.cpp:158
-msgid "Increase Volume"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/kmix.profile.xml:19
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/kmix.profile.xml:34
-#: rc.cpp:161 rc.cpp:170
-msgid ""
-"Name of the slider to move and its index separated by a colon (eg. Master:0)"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/kmix.profile.xml:28
-#: rc.cpp:167
-msgid "Decrease Volume"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/kmix.profile.xml:43
-#: rc.cpp:173
-msgid "Mute"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/kmix.profile.xml:43
-#: rc.cpp:176
-msgid "Toggle Mute"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/kmix.profile.xml:49
-#: rc.cpp:179
-msgid ""
-"Name of the slider to mute and its index separated by a colon (eg. Master:0)"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/konqueror.profile.xml:10
-#: rc.cpp:182
-msgid "Create New Window"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/konqueror.profile.xml:10
-#: rc.cpp:185
-msgid "Creates a new window and loads an arbitrary URL"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/konqueror.profile.xml:16
-#: rc.cpp:188
-msgid "The URL to load in the window initially"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/konqueror.profile.xml:18
-#: rc.cpp:191
-msgid "Startup Id"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/konqueror.profile.xml:25
-#: rc.cpp:194
-msgid "Quit"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/konqueror.profile.xml:25
-#: rc.cpp:197
-msgid "Closes the Konqueror window"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/kscd.profile.xml:10
-#: rc.cpp:203
-msgid "Start playing the CD"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/kscd.profile.xml:20
-#: rc.cpp:209
-msgid "Stops the CD"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/kscd.profile.xml:29
-#: rc.cpp:212
-msgid "Eject"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/kscd.profile.xml:29
-#: rc.cpp:215
-msgid "Ejects the CD"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/kscd.profile.xml:39
-#: rc.cpp:218
-msgid "Previous"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/kscd.profile.xml:39
-#: rc.cpp:221
-msgid "Skips to the previous track on the CD"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/kscd.profile.xml:49
-#: rc.cpp:224
-msgid "Next"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/kscd.profile.xml:49
-#: rc.cpp:227
-msgid "Skips to the next track on the CD"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/kscd.profile.xml:59
-#: rc.cpp:230
-msgid "Play Track"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/kscd.profile.xml:59
-#: rc.cpp:233
-msgid "Skips to a specific track on the CD"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/kscd.profile.xml:65
-#: rc.cpp:236
-msgid "The number of the track to skip to"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/kscd.profile.xml:73
-#: rc.cpp:239
-msgid "Set Volume"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/kscd.profile.xml:73
-#: rc.cpp:242
-msgid "Sets the play volume"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/kscd.profile.xml:79
-#: rc.cpp:245
-msgid "The new value for the volume"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/kscd.profile.xml:86
-#: rc.cpp:248
-msgid "Shuffle"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/kscd.profile.xml:86
-#: rc.cpp:251
-msgid "Toggles track shuffling on and off"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/okular.profile.xml:10
-#: rc.cpp:254
-msgid "Back"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/okular.profile.xml:10
-#: rc.cpp:257
-msgid "Goes to the previous page"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/okular.profile.xml:21
-#: rc.cpp:260
-msgid "Forward"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/okular.profile.xml:21
-#: rc.cpp:263
-msgid "Goes to the next page"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/okular.profile.xml:32
-#: rc.cpp:266
-msgid "First"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/okular.profile.xml:32
-#: rc.cpp:269
-msgid "Goes to the first page"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/okular.profile.xml:43
-#: rc.cpp:272
-msgid "Last"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/okular.profile.xml:43
-#: rc.cpp:275
-msgid "Goes to the last page"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/okular.profile.xml:54
-#: rc.cpp:278
-msgid "Presentation"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/okular.profile.xml:54
-#: rc.cpp:281
-msgid "Starts / stops presentation"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/okular.profile.xml:65
-#: rc.cpp:284
-msgid "Reload"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/okular.profile.xml:65
-#: rc.cpp:287
-msgid "Reloads the open document"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/okular.profile.xml:74
-#: rc.cpp:290
-msgid "Go to Page"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/okular.profile.xml:74
-#: rc.cpp:293
-msgid "Goes to the specified page"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/okular.profile.xml:80
-#: rc.cpp:296
-msgid "The page to choose"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/okular.profile.xml:88
-#: rc.cpp:299
-msgid "Open document"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/okular.profile.xml:88
-#: rc.cpp:302
-msgid "Opens a specific document"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/okular.profile.xml:94
-#: rc.cpp:305
-msgid "The document to be open"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/powermanagement.profile.xml:11
-#: rc.cpp:308
-msgid "Suspend"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/powermanagement.profile.xml:11
-#: rc.cpp:311
-msgid "Suspends your computer to RAM (sleep)"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/powermanagement.profile.xml:17
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/powermanagement.profile.xml:37
-#: rc.cpp:314 rc.cpp:332
-msgid "System command to use for suspend"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/powermanagement.profile.xml:20
-#: rc.cpp:317
-msgid "Parameters for the suspend command"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/powermanagement.profile.xml:31
-#: rc.cpp:326
-msgid "Hibernate"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/powermanagement.profile.xml:31
-#: rc.cpp:329
-msgid "Suspends your computer disk (deep sleep)"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/powermanagement.profile.xml:40
-#: rc.cpp:335
-msgid "Parameters for the suspend commands"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/powermanagement.profile.xml:51
-#: rc.cpp:344
-msgid "Shutdown"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/powermanagement.profile.xml:51
-#: rc.cpp:347
-msgid "Logout and shutdown your computer"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/powermanagement.profile.xml:57
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/powermanagement.profile.xml:78
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/powermanagement.profile.xml:97
-#: rc.cpp:350 rc.cpp:365 rc.cpp:380
-msgid "Ask for confirmation? 1 = No, 2 = Yes"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/powermanagement.profile.xml:60
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/powermanagement.profile.xml:81
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/powermanagement.profile.xml:100
-#: rc.cpp:353 rc.cpp:368 rc.cpp:383
-msgid "Shutdown? 1 = Reboot, 2 = Halt, 3 = Logout"
-msgstr ""
-
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/powermanagement.profile.xml:63
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/powermanagement.profile.xml:84
-#. i18n: tag argument attribute comment
-#. i18n: file: ../profiles/powermanagement.profile.xml:103
-#: rc.cpp:356 rc.cpp:371 rc.cpp:386
-msgid "When? 0 = When ready, 1 = Try now, 2 = Force now, 3 = Interactive"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/powermanagement.profile.xml:72
-#: rc.cpp:359
-msgid "Reboot"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/powermanagement.profile.xml:72
-#: rc.cpp:362
-msgid "Logout and restart your computer"
-msgstr ""
-
-#. i18n: tag action attribute name
-#. i18n: file: ../profiles/powermanagement.profile.xml:91
-#: rc.cpp:374
-msgid "Logout"
-msgstr ""
-
-#. i18n: tag action attribute description
-#. i18n: file: ../profiles/powermanagement.profile.xml:91
-#: rc.cpp:377
-msgid "Just log out"
-msgstr ""
-
-#: remotecontrolbutton.cpp:328
-msgctxt "A button on a Remote Control"
-msgid "0"
-msgstr ""
-
-#: remotecontrolbutton.cpp:330
-msgctxt "A button on a Remote Control"
-msgid "1"
-msgstr ""
-
-#: remotecontrolbutton.cpp:332
-msgctxt "A button on a Remote Control"
-msgid "2"
-msgstr ""
-
-#: remotecontrolbutton.cpp:334
-msgctxt "A button on a Remote Control"
-msgid "3"
-msgstr ""
-
-#: remotecontrolbutton.cpp:336
-msgctxt "A button on a Remote Control"
-msgid "4"
-msgstr ""
-
-#: remotecontrolbutton.cpp:338
-msgctxt "A button on a Remote Control"
-msgid "5"
-msgstr ""
-
-#: remotecontrolbutton.cpp:340
-msgctxt "A button on a Remote Control"
-msgid "6"
-msgstr ""
-
-#: remotecontrolbutton.cpp:342
-msgctxt "A button on a Remote Control"
-msgid "7"
-msgstr ""
-
-#: remotecontrolbutton.cpp:344
-msgctxt "A button on a Remote Control"
-msgid "8"
-msgstr ""
-
-#: remotecontrolbutton.cpp:346
-msgctxt "A button on a Remote Control"
-msgid "9"
-msgstr ""
-
-#: remotecontrolbutton.cpp:350
-msgctxt "A button on a Remote Control"
-msgid "Play"
-msgstr ""
-
-#: remotecontrolbutton.cpp:352
-msgctxt "A button on a Remote Control"
-msgid "Pause"
-msgstr ""
-
-#: remotecontrolbutton.cpp:354
-msgctxt "A button on a Remote Control"
-msgid "Play Pause"
-msgstr ""
-
-#: remotecontrolbutton.cpp:356
-msgctxt "A button on a Remote Control"
-msgid "Stop"
-msgstr ""
-
-#: remotecontrolbutton.cpp:358
-msgctxt "A button on a Remote Control"
-msgid "Skip Forward"
-msgstr ""
-
-#: remotecontrolbutton.cpp:360
-msgctxt "A button on a Remote Control"
-msgid "Skip Backward"
-msgstr ""
-
-#: remotecontrolbutton.cpp:362
-msgctxt "A button on a Remote Control"
-msgid "Fast Forward"
-msgstr ""
-
-#: remotecontrolbutton.cpp:364
-msgctxt "A button on a Remote Control"
-msgid "Rewind"
-msgstr ""
-
-#: remotecontrolbutton.cpp:366
-msgctxt "A button on a Remote Control"
-msgid "Channel Down"
-msgstr ""
-
-#: remotecontrolbutton.cpp:368
-msgctxt "A button on a Remote Control"
-msgid "Channel Up"
-msgstr ""
-
-#: remotecontrolbutton.cpp:370
-msgctxt "A button on a Remote Control"
-msgid "Volume Down"
-msgstr ""
-
-#: remotecontrolbutton.cpp:372
-msgctxt "A button on a Remote Control"
-msgid "Volume Up"
-msgstr ""
-
-#: remotecontrolbutton.cpp:374
-msgctxt "A button on a Remote Control"
-msgid "Mute"
-msgstr ""
-
-#: remotecontrolbutton.cpp:376
-msgctxt "A button on a Remote Control"
-msgid "Info"
-msgstr ""
-
-#: remotecontrolbutton.cpp:378
-msgctxt "A button on a Remote Control"
-msgid "Eject"
-msgstr ""
-
-#: remotecontrolbutton.cpp:380
-msgctxt "A button on a Remote Control"
-msgid "Power"
-msgstr ""
-
-#: remotecontrolbutton.cpp:384
-msgctxt "A button on a Remote Control"
-msgid "Up"
-msgstr ""
-
-#: remotecontrolbutton.cpp:386
-msgctxt "A button on a Remote Control"
-msgid "Down"
-msgstr ""
-
-#: remotecontrolbutton.cpp:388
-msgctxt "A button on a Remote Control"
-msgid "Left"
-msgstr ""
-
-#: remotecontrolbutton.cpp:390
-msgctxt "A button on a Remote Control"
-msgid "Right"
-msgstr ""
-
-#: remotecontrolbutton.cpp:392
-msgctxt "A button on a Remote Control"
-msgid "Select"
-msgstr ""
-
-#: remotecontrolbutton.cpp:394
-msgctxt "A button on a Remote Control"
-msgid "Back"
-msgstr ""
-
-#: remotecontrolbutton.cpp:396
-msgctxt "A button on a Remote Control"
-msgid "Menu"
-msgstr ""
-
-#: remotecontrolbutton.cpp:400
-msgctxt "A button on a Remote Control"
-msgid "Aux"
-msgstr ""
-
-#: remotecontrolbutton.cpp:402
-msgctxt "A button on a Remote Control"
-msgid "CD"
-msgstr ""
-
-#: remotecontrolbutton.cpp:404
-msgctxt "A button on a Remote Control"
-msgid "DVD"
-msgstr ""
-
-#: remotecontrolbutton.cpp:406
-msgctxt "A button on a Remote Control"
-msgid "EPG"
-msgstr ""
-
-#: remotecontrolbutton.cpp:408
-msgctxt "A button on a Remote Control"
-msgid "Favorites"
-msgstr ""
-
-#: remotecontrolbutton.cpp:410
-msgctxt "A button on a Remote Control"
-msgid "Help"
-msgstr ""
-
-#: remotecontrolbutton.cpp:412
-msgctxt "A button on a Remote Control"
-msgid "Home"
-msgstr ""
-
-#: remotecontrolbutton.cpp:414
-msgctxt "A button on a Remote Control"
-msgid "Music"
-msgstr ""
-
-#: remotecontrolbutton.cpp:416
-msgctxt "A button on a Remote Control"
-msgid "Text"
-msgstr ""
-
-#: remotecontrolbutton.cpp:418
-msgctxt "A button on a Remote Control"
-msgid "TV"
-msgstr ""
-
-#: remotecontrolbutton.cpp:422
-msgctxt "A button on a Remote Control"
-msgid "Blue"
-msgstr ""
-
-#: remotecontrolbutton.cpp:424
-msgctxt "A button on a Remote Control"
-msgid "Green"
-msgstr ""
-
-#: remotecontrolbutton.cpp:426
-msgctxt "A button on a Remote Control"
-msgid "Red"
-msgstr ""
-
-#: remotecontrolbutton.cpp:428
-msgctxt "A button on a Remote Control"
-msgid "Yellow"
-msgstr ""
-
-#: remotecontrolbutton.cpp:430
-msgctxt "A button on a Remote Control"
-msgid "Unknown"
-msgstr ""
-
-#: remotecontrolmanager.cpp:76
-#, kde-format
-msgid "Backend loaded but wrong type obtained, expected %1"
-msgstr ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkresources.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkresources.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkresources.po	2012-02-23 06:20:17.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkresources.po	2012-03-23 06:41:48.000000000 +0000
@@ -8,14 +8,14 @@
 "Project-Id-Version: libkresources\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 15:54+0000\n"
-"PO-Revision-Date: 2011-12-12 18:41+0000\n"
+"PO-Revision-Date: 2012-03-14 16:45+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:11+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:21+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: configdialog.cpp:63
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libksane.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libksane.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libksane.po	2012-02-23 06:20:20.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libksane.po	2012-03-23 06:41:51.000000000 +0000
@@ -2,14 +2,13 @@
 # Copyright (C) YEAR This_file_is_part_of_KDE
 # This file is distributed under the same license as the PACKAGE package.
 #
-# zayed <zayed.alsaidi@gmail.com>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: libksane\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:27+0000\n"
-"PO-Revision-Date: 2012-01-25 10:54+0000\n"
+"PO-Revision-Date: 2012-03-12 22:23+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
@@ -17,8 +16,9 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:14+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:06+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: ksane_viewer.cpp:91 ksane_widget.cpp:145
 msgid "Zoom In"
@@ -111,16 +111,24 @@
 msgctxt "Parameter and Unit"
 msgid "%1 Pixel"
 msgid_plural "%1 Pixels"
-msgstr[0] ""
-msgstr[1] ""
+msgstr[0] "%1 بكسل"
+msgstr[1] "بكسل واحد"
+msgstr[2] "بكسلان"
+msgstr[3] "%1 بكسلات"
+msgstr[4] "%1 بكسلا"
+msgstr[5] "%1 بكسل"
 
 #: options/ksane_opt_combo.cpp:174
 #, kde-format
 msgctxt "Parameter and Unit"
 msgid "%1 Bit"
 msgid_plural "%1 Bits"
-msgstr[0] ""
-msgstr[1] ""
+msgstr[0] "%1 بت"
+msgstr[1] "بت واحد"
+msgstr[2] "بتان"
+msgstr[3] "%1 بتات"
+msgstr[4] "%1 بتا"
+msgstr[5] "%1 بت"
 
 #: options/ksane_opt_combo.cpp:175
 #, kde-format
@@ -152,15 +160,23 @@
 msgctxt "SpinBox parameter unit"
 msgid " Pixel"
 msgid_plural " Pixels"
-msgstr[0] ""
-msgstr[1] ""
+msgstr[0] " بيكسل"
+msgstr[1] " بيكسل"
+msgstr[2] " بيكسل"
+msgstr[3] " بيكسل"
+msgstr[4] " بيكسل"
+msgstr[5] " بيكسل"
 
 #: options/ksane_option.cpp:293
 msgctxt "SpinBox parameter unit"
 msgid " Bit"
 msgid_plural " Bits"
-msgstr[0] ""
-msgstr[1] ""
+msgstr[0] " بت"
+msgstr[1] " بت"
+msgstr[2] " بت"
+msgstr[3] " بت"
+msgstr[4] " بت"
+msgstr[5] " بت"
 
 #: options/ksane_option.cpp:294
 msgctxt "SpinBox parameter unit"
@@ -187,12 +203,12 @@
 #: options/ksane_option.cpp:307
 msgctxt "Double numbers. SpinBox parameter unit"
 msgid " Pixels"
-msgstr ""
+msgstr " بيكسل"
 
 #: options/ksane_option.cpp:308
 msgctxt "Double numbers. SpinBox parameter unit"
 msgid " Bits"
-msgstr ""
+msgstr " بت"
 
 #: options/ksane_option.cpp:309
 msgctxt "Double numbers. SpinBox parameter unit"
@@ -359,12 +375,12 @@
 #: widgets/labeled_entry.cpp:51
 msgctxt "Label for button to reset text in a KLineEdit"
 msgid "Reset"
-msgstr ""
+msgstr "أعد الضبط"
 
 #: widgets/labeled_entry.cpp:53
 msgctxt "Label for button to write text in a KLineEdit to sane"
 msgid "Set"
-msgstr ""
+msgstr "عيّن"
 
 #: ksane_widget_private.cpp:337
 msgid "Separate color intensity tables"
@@ -372,21 +388,21 @@
 
 #: ksane_widget_private.cpp:356
 msgid "Invert colors"
-msgstr ""
+msgstr "اعكس الألوان"
 
 #: ksane_widget_private.cpp:929
 msgctxt "This is compared to the option string returned by sane"
 msgid "Transparency"
-msgstr ""
+msgstr "شفافية"
 
 #: ksane_widget_private.cpp:931
 msgctxt "This is compared to the option string returned by sane"
 msgid "Negative"
-msgstr ""
+msgstr "سالب"
 
 #: ksane_widget.cpp:121
 msgid "Waiting for the scan to start."
-msgstr ""
+msgstr "بانتظار بدء المسح."
 
 #: ksane_widget.cpp:133
 msgid "Cancel current scan operation"
@@ -416,7 +432,7 @@
 
 #: ksane_widget.cpp:216
 msgid "Scanner Specific Options"
-msgstr ""
+msgstr "خيارات خاصة بالماسحة"
 
 #: ksane_widget.cpp:329
 #, kde-format
@@ -433,4 +449,4 @@
 
 #: ../ksanetwain/ktwain_widget.cpp:52
 msgid "Open scan dialog"
-msgstr ""
+msgstr "مربع فتح الماسحة"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkscreensaver.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkscreensaver.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkscreensaver.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkscreensaver.po	2012-03-23 06:42:04.000000000 +0000
@@ -19,10 +19,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:18+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:18+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: main.cpp:133
 msgid "Setup screen saver"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libktnef.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libktnef.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libktnef.po	2012-02-23 06:20:17.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libktnef.po	2012-03-23 06:41:48.000000000 +0000
@@ -10,14 +10,14 @@
 "Project-Id-Version: libktnef\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 15:54+0000\n"
-"PO-Revision-Date: 2011-12-12 19:09+0000\n"
+"PO-Revision-Date: 2012-03-14 17:01+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:12+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:22+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: formatter.cpp:399
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkunitconversion.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkunitconversion.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkunitconversion.po	2012-02-23 06:20:16.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkunitconversion.po	2012-03-23 06:41:47.000000000 +0000
@@ -15,8 +15,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 22:54+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:13+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: acceleration.cpp:28
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkworkspace.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkworkspace.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libkworkspace.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libkworkspace.po	2012-03-23 06:42:04.000000000 +0000
@@ -16,10 +16,9 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:19+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:18+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: kdisplaymanager.cpp:538
 #, kde-format
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libmessagelist.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libmessagelist.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libmessagelist.po	2012-02-23 06:20:11.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libmessagelist.po	2012-03-23 06:41:42.000000000 +0000
@@ -10,7 +10,7 @@
 "Project-Id-Version: kmail\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 03:45+0000\n"
-"PO-Revision-Date: 2012-01-26 00:24+0000\n"
+"PO-Revision-Date: 2012-03-14 17:47+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
@@ -18,8 +18,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:43+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:20+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: storagemodel.cpp:239
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libmessageviewer.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libmessageviewer.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libmessageviewer.po	2012-02-23 06:20:11.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libmessageviewer.po	2012-03-23 06:41:42.000000000 +0000
@@ -10,7 +10,7 @@
 "Project-Id-Version: kmail\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 03:45+0000\n"
-"PO-Revision-Date: 2012-01-26 23:34+0000\n"
+"PO-Revision-Date: 2012-03-14 17:43+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
@@ -18,8 +18,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:43+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:20+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: htmlstatusbar.cpp:113
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/liboktetacore.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/liboktetacore.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/liboktetacore.po	2012-02-23 06:20:11.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/liboktetacore.po	2012-03-23 06:41:43.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:54+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:25+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: piecetable/replacepiecetablechange.cpp:40
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/liboktetakasten.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/liboktetakasten.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/liboktetakasten.po	2012-02-23 06:20:11.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/liboktetakasten.po	2012-03-23 06:41:43.000000000 +0000
@@ -9,7 +9,7 @@
 "Project-Id-Version: okteta\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 16:09+0000\n"
-"PO-Revision-Date: 2012-01-26 23:57+0000\n"
+"PO-Revision-Date: 2012-03-12 23:59+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
@@ -17,8 +17,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:55+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:25+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: core/io/filesystem/bytearrayrawfilereloadthread.cpp:62
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libphonon.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libphonon.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libphonon.po	2012-02-23 06:20:20.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libphonon.po	2012-03-23 06:41:51.000000000 +0000
@@ -8,14 +8,14 @@
 "Project-Id-Version: libphonon\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-19 23:05+0000\n"
-"PO-Revision-Date: 2012-01-26 23:48+0000\n"
+"PO-Revision-Date: 2012-03-12 23:53+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:15+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:07+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: phononnamespace.cpp:57
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libplasmaclock.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libplasmaclock.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libplasmaclock.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libplasmaclock.po	2012-03-23 06:42:04.000000000 +0000
@@ -10,7 +10,7 @@
 "Project-Id-Version: libplasmaclock\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:13+0000\n"
+"PO-Revision-Date: 2012-03-12 22:24+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
@@ -18,8 +18,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:19+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:19+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: calendartable.cpp:659
 #, kde-format
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libplasma.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libplasma.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libplasma.po	2012-02-23 06:20:16.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libplasma.po	2012-03-23 06:41:47.000000000 +0000
@@ -2,36 +2,36 @@
 # translation of libplasma.po to
 # Copyright (C) YEAR This_file_is_part_of_KDE
 # This file is distributed under the same license as the PACKAGE package.
+#
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # Abdulaziz AlSharif <a.a-a.s@hotmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
 # OsamaKhalid <osamak.wfm@gmail.com>, 2009.
 # Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
-#
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: libplasma\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 13:46+0000\n"
-"PO-Revision-Date: 2012-01-27 00:07+0000\n"
+"PO-Revision-Date: 2012-03-13 00:03+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 22:55+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:14+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: animations/animationscriptengine.cpp:144
 msgid "animation() takes one argument"
-msgstr ""
+msgstr "animation() تأخذ معطى واحدًا"
 
 #: animations/animationscriptengine.cpp:169
 #, kde-format
 msgid "%1 is not a known animation type"
-msgstr ""
+msgstr "%1 ليس نوع تحريك رسومي معروف"
 
 #: applet.cpp:242
 msgid "Script initialization failed"
@@ -43,11 +43,11 @@
 
 #: applet.cpp:808
 msgid "Panel"
-msgstr ""
+msgstr "اللوحة"
 
 #: applet.cpp:810
 msgid "Unknown"
-msgstr ""
+msgstr "مجهول"
 
 #: applet.cpp:815
 msgid "Unknown Widget"
@@ -64,23 +64,23 @@
 
 #: applet.cpp:1094
 msgid "&OK"
-msgstr ""
+msgstr "&موافق"
 
 #: applet.cpp:651 applet.cpp:1102
 msgid "&Yes"
-msgstr ""
+msgstr "&نعم"
 
 #: applet.cpp:654 applet.cpp:1109
 msgid "&No"
-msgstr ""
+msgstr "&لا"
 
 #: applet.cpp:657 applet.cpp:1116
 msgid "&Cancel"
-msgstr ""
+msgstr "أل&غِ"
 
 #: applet.cpp:1153
 msgid "OK"
-msgstr ""
+msgstr "موافق"
 
 #: applet.cpp:1540
 #, kde-format
@@ -97,7 +97,7 @@
 
 #: applet.cpp:1739
 msgid "Run the Associated Application"
-msgstr ""
+msgstr "شغل التطبيق المربوط"
 
 #: applet.cpp:1849
 msgid "Settings"
@@ -180,7 +180,7 @@
 
 #: applet.cpp:1913
 msgid "Productivity"
-msgstr ""
+msgstr "الإنتاجيّة"
 
 #: applet.cpp:1914
 msgid "System Information"
@@ -253,7 +253,7 @@
 
 #: containment.cpp:247
 msgid "Remove this Panel"
-msgstr ""
+msgstr "أزل هذه اللوحة"
 
 #: containment.cpp:249
 msgid "Remove this Activity"
@@ -356,11 +356,11 @@
 
 #: extenders/extenderitem.cpp:947
 msgid "Reattach"
-msgstr ""
+msgstr "أعد الإرفاق"
 
 #: extenders/extenderitem.cpp:973
 msgid "Close"
-msgstr ""
+msgstr "أغلق"
 
 #: glapplet.cpp:76 glapplet.cpp:87
 msgid "This system does not support OpenGL widgets."
@@ -414,7 +414,7 @@
 
 #: private/packages.cpp:65 private/packages.cpp:120
 msgid "Data Files"
-msgstr ""
+msgstr "ملفات البيانات"
 
 #: private/packages.cpp:67 private/packages.cpp:122
 msgid "Executable Scripts"
@@ -443,11 +443,11 @@
 
 #: private/packages.cpp:78 private/packages.cpp:161
 msgid "Animation scripts"
-msgstr ""
+msgstr "نصّ برمجي للتحريك"
 
 #: private/packages.cpp:127
 msgid "Service Descriptions"
-msgstr ""
+msgstr "وصف الخدمة"
 
 #: private/packages.cpp:154
 msgid "Images for dialogs"
@@ -636,57 +636,58 @@
 
 #: remote/accessappletjob.cpp:112
 msgid "You are about to open a remote widget on your system.<br>"
-msgstr ""
+msgstr "أنت بصدد فتح ودجة بعيدة على نظامك.<br>"
 
 #: remote/accessappletjob.cpp:113
 msgid "<table width=\"100%\">"
-msgstr ""
+msgstr "<table width=\"100%\">"
 
 #: remote/accessappletjob.cpp:114
 #, kde-format
 msgid "<tr><td align=\"right\"><b>Name:</b></td><td>&nbsp; %1</td></tr>"
-msgstr ""
+msgstr "<tr><td align=\"right\"><b>الاسم:</b></td><td>&nbsp; %1</td></tr>"
 
 #: remote/accessappletjob.cpp:115
 #, kde-format
 msgid ""
 "<tr><td align=\"right\"><b>Description:</b></td><td>&nbsp; %1</td></tr>"
-msgstr ""
+msgstr "<tr><td align=\"right\"><b>الوصف:</b></td><td>&nbsp; %1</td></tr>"
 
 #: remote/accessappletjob.cpp:116
 #, kde-format
 msgid ""
 "<tr><td align=\"right\"><b>Author:</b></td><td>&nbsp; %1 &lt;%2&gt;</td></tr>"
 msgstr ""
+"<tr><td align=\"right\"><b>المؤلف:</b></td><td>&nbsp; %1 &lt;%2&gt;</td></tr>"
 
 #: remote/accessappletjob.cpp:119
 #, kde-format
 msgid "<tr><td align=\"right\"><b>Server:</b></td><td>&nbsp; %1</td></tr>"
-msgstr ""
+msgstr "<tr><td align=\"right\"><b>الخادم:</b></td><td>&nbsp; %1</td></tr>"
 
 #: remote/accessappletjob.cpp:120
 msgid "</table>"
-msgstr ""
+msgstr "</table>"
 
 #: remote/accessappletjob.cpp:121
 msgid "<br><br>Are you sure you want to open this widget on your system?"
-msgstr ""
+msgstr "<br><br>أمتأكّد من أنّك تريد فتح هذه الودجة على نظامك؟"
 
 #: remote/accessappletjob.cpp:124
 msgid "Remote Widget"
-msgstr ""
+msgstr "أزل ودجة"
 
 #: remote/accessappletjob.cpp:126
 msgid "Open Widget"
-msgstr ""
+msgstr "افتح ودجة"
 
 #: remote/accessappletjob.cpp:127
 msgid "Reject Widget"
-msgstr ""
+msgstr "ارفض ودجة"
 
 #: remote/accessappletjob.cpp:136
 msgid "User rejected"
-msgstr ""
+msgstr "رفضها المستخدم"
 
 #: remote/accessappletjob.cpp:130
 msgid "Timeout"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libplasmaweather.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libplasmaweather.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libplasmaweather.po	2012-02-23 06:20:20.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libplasmaweather.po	2012-03-23 06:41:51.000000000 +0000
@@ -15,8 +15,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:19+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:09+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #. i18n: file: weatherconfig.ui:32
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libtaskmanager.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libtaskmanager.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/libtaskmanager.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/libtaskmanager.po	2012-03-23 06:42:04.000000000 +0000
@@ -13,14 +13,14 @@
 "Project-Id-Version: libtaskmanager\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:13+0000\n"
+"PO-Revision-Date: 2012-03-12 22:24+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:20+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:19+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "X-Poedit-Language: Arabic\n"
 
 #: task.cpp:222
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/lightdm.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/lightdm.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/lightdm.po	2012-02-23 06:20:24.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/lightdm.po	2012-03-23 06:41:55.000000000 +0000
@@ -7,111 +7,123 @@
 msgstr ""
 "Project-Id-Version: lightdm\n"
 "Report-Msgid-Bugs-To: FULL NAME <EMAIL@ADDRESS>\n"
-"POT-Creation-Date: 2012-02-16 07:12+0000\n"
+"POT-Creation-Date: 2012-03-22 07:31+0000\n"
 "PO-Revision-Date: 2012-01-04 18:39+0000\n"
 "Last-Translator: Ahmed Shams <Unknown>\n"
 "Language-Team: Arabic <ar@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:03+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:18+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #. Help string for command line --config flag
-#: ../src/lightdm.c:831
+#: ../src/lightdm.c:832
 msgid "Use configuration file"
 msgstr "استخدم ملف الضبط"
 
 #. Help string for command line --debug flag
-#: ../src/lightdm.c:834
+#: ../src/lightdm.c:835
 msgid "Print debugging messages"
 msgstr ""
 
 #. Help string for command line --test-mode flag
-#: ../src/lightdm.c:837
+#: ../src/lightdm.c:838
 msgid "Run as unprivileged user, skipping things that require root access"
 msgstr ""
 
 #. Help string for command line --pid-file flag
-#: ../src/lightdm.c:840
+#: ../src/lightdm.c:841
 msgid "File to write PID into"
 msgstr ""
 
 #. Help string for command line --xsessions-dir flag
-#: ../src/lightdm.c:843
+#: ../src/lightdm.c:844
 msgid "Directory to load X sessions from"
 msgstr ""
 
 #. Help string for command line --xgreeters-dir flag
-#: ../src/lightdm.c:846
+#: ../src/lightdm.c:847
 msgid "Directory to load X greeters from"
 msgstr ""
 
 #. Help string for command line --log-dir flag
-#: ../src/lightdm.c:849
+#: ../src/lightdm.c:850
 msgid "Directory to write logs to"
 msgstr ""
 
 #. Help string for command line --run-dir flag
-#: ../src/lightdm.c:852
+#: ../src/lightdm.c:853
 msgid "Directory to store running state"
 msgstr ""
 
 #. Help string for command line --cache-dir flag
-#: ../src/lightdm.c:855
+#: ../src/lightdm.c:856
 msgid "Directory to cache information"
 msgstr ""
 
 #. Help string for command line --version flag
-#: ../src/lightdm.c:858
+#: ../src/lightdm.c:859
 msgid "Show release version"
 msgstr ""
 
 #. Arguments and description for --help test
-#: ../src/lightdm.c:869
+#: ../src/lightdm.c:874
 msgid "- Display Manager"
 msgstr ""
 
 #. Text printed out when an unknown command-line argument provided
-#: ../src/lightdm.c:879
+#: ../src/lightdm.c:884
 #, c-format
 msgid "Run '%s --help' to see a full list of available command line options."
 msgstr ""
 
-#: ../utils/lightdm-set-defaults.c:39
+#: ../utils/lightdm-set-defaults.c:42
 msgid "Enable debugging"
 msgstr ""
 
-#: ../utils/lightdm-set-defaults.c:40
+#: ../utils/lightdm-set-defaults.c:43
 msgid "Only update if no default already set"
 msgstr ""
 
-#: ../utils/lightdm-set-defaults.c:41
+#: ../utils/lightdm-set-defaults.c:44
 msgid "Remove default value if it's the current one"
 msgstr ""
 
-#: ../utils/lightdm-set-defaults.c:42
+#: ../utils/lightdm-set-defaults.c:45
 msgid "Set default session"
 msgstr ""
 
-#: ../utils/lightdm-set-defaults.c:43
+#: ../utils/lightdm-set-defaults.c:46
 msgid "Set default greeter"
 msgstr ""
 
-#: ../utils/lightdm-set-defaults.c:44
+#: ../utils/lightdm-set-defaults.c:47
 msgid "Set autologin user"
 msgstr ""
 
-#: ../utils/lightdm-set-defaults.c:119
+#: ../utils/lightdm-set-defaults.c:48
+msgid "Hide user list in greeter (exclusive to show-users)"
+msgstr ""
+
+#: ../utils/lightdm-set-defaults.c:49
+msgid "Show user list in greeter (exclusive to hide-users)"
+msgstr ""
+
+#: ../utils/lightdm-set-defaults.c:144
 msgid "- set lightdm default values"
 msgstr ""
 
-#: ../utils/lightdm-set-defaults.c:122
+#: ../utils/lightdm-set-defaults.c:147
 #, c-format
 msgid "option parsing failed: %s\n"
 msgstr ""
 
-#: ../utils/lightdm-set-defaults.c:128
+#: ../utils/lightdm-set-defaults.c:153
+msgid "show-users and hide-users are mutually exclusive\n"
+msgstr ""
+
+#: ../utils/lightdm-set-defaults.c:158
 #, c-format
 msgid ""
 "Wrong usage of the command\n"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/lokalize.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/lokalize.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/lokalize.po	2012-02-23 06:20:11.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/lokalize.po	2012-03-23 06:41:43.000000000 +0000
@@ -8,30 +8,31 @@
 # Tarig Abdu Taha <ihassan@kacst.edu.sa>, 2004.
 # Munzir Taha <munzir@kacst.edu.sa>, 2004.
 # Khaled Hosny <khaledhosny@eglug.org>, 2007, 2008.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: lokalize\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 16:09+0000\n"
-"PO-Revision-Date: 2011-01-06 03:17+0000\n"
-"Last-Translator: Khaled Hosny <khaledhosny@eglug.org>\n"
+"PO-Revision-Date: 2012-03-12 23:01+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:56+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:26+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: rc.cpp:1
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
-msgstr " ,Launchpad Contributions:,Khaled Hosny"
+msgstr "عبدالرحيم الفاخوري, ,Launchpad Contributions:,Khaled Hosny"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr ",,khaledhosny@eglug.org"
+msgstr "abdilra7eem@yahoo.com,,,khaledhosny@eglug.org"
 
 #. i18n: file: src/editorui.rc:4
 #. i18n: ectx: Menu (file)
@@ -39,37 +40,37 @@
 #. i18n: ectx: Menu (file)
 #: rc.cpp:5 rc.cpp:150
 msgid "&File"
-msgstr ""
+msgstr "&ملف"
 
 #. i18n: file: src/editorui.rc:32
 #. i18n: ectx: Menu (edit)
 #: rc.cpp:8
 msgid "&Edit"
-msgstr ""
+msgstr "ت&حرير"
 
 #. i18n: file: src/editorui.rc:64
 #. i18n: ectx: Menu (glossary)
 #: rc.cpp:11
 msgid "&Glossary"
-msgstr ""
+msgstr "المُسْر&د:"
 
 #. i18n: file: src/editorui.rc:89
 #. i18n: ectx: Menu (webquery)
 #: rc.cpp:14
 msgid "&WebQuery"
-msgstr ""
+msgstr "استعلام في الشنكبوتية"
 
 #. i18n: file: src/editorui.rc:106
 #. i18n: ectx: Menu (tmquery)
 #: rc.cpp:17
 msgid "Translation &Memory"
-msgstr ""
+msgstr "ذاكرة الترجمة"
 
 #. i18n: file: src/editorui.rc:123
 #. i18n: ectx: Menu (alttrans)
 #: rc.cpp:20
 msgid "Alternative Translations"
-msgstr ""
+msgstr "ترجمات بديلة"
 
 #. i18n: file: src/editorui.rc:141
 #. i18n: ectx: Menu (go)
@@ -83,19 +84,19 @@
 #. i18n: ectx: Menu (bookmarks)
 #: rc.cpp:26
 msgid "&Bookmarks"
-msgstr ""
+msgstr "علاماتامسح علامات المواقع"
 
 #. i18n: file: src/editorui.rc:178
 #. i18n: ectx: Menu (merge)
 #: rc.cpp:29
 msgid "S&ync"
-msgstr ""
+msgstr "م&زامنة"
 
 #. i18n: file: src/editorui.rc:187
 #. i18n: ectx: Menu (mergesecondary)
 #: rc.cpp:32
 msgid "&Secondary sync source"
-msgstr ""
+msgstr "مصدر مزامنة ثانويّ"
 
 #. i18n: file: src/editorui.rc:209
 #. i18n: ectx: Menu (toolviews)
@@ -103,7 +104,7 @@
 #. i18n: ectx: Menu (toolviews)
 #: rc.cpp:35 rc.cpp:159
 msgid "Tool&views"
-msgstr ""
+msgstr "عر&ض الأدوات"
 
 #. i18n: file: src/editorui.rc:232
 #. i18n: ectx: ToolBar (mainToolBar)
@@ -111,13 +112,13 @@
 #. i18n: ectx: ToolBar (mainToolBar)
 #: rc.cpp:38 rc.cpp:468
 msgid "Main Toolbar"
-msgstr ""
+msgstr "شريط الأدوات الرئيسي"
 
 #. i18n: file: src/glossary/termedit.ui:17
 #. i18n: ectx: property (text), widget (QLabel, label)
 #: rc.cpp:41
 msgid "English synonyms (double-click to edit):"
-msgstr ""
+msgstr "مترادفات إنجليزيّة (نقرة مزدوجة لتحررها)"
 
 #. i18n: file: src/glossary/termedit.ui:27
 #. i18n: ectx: property (text), widget (QLabel, label_2)
@@ -139,6 +140,7 @@
 "When adding a new item, press enter after you have typed its name for "
 "changes to take effect"
 msgstr ""
+"عند إضافة عنصر جديد، اضغط زرّ الإدخال بعد إدخال اسمه ليتمّ اعتماد التغييرات"
 
 #. i18n: file: src/glossary/termedit.ui:54
 #. i18n: ectx: property (text), widget (QLabel, label_3)
@@ -167,7 +169,7 @@
 #. i18n: ectx: property (text), widget (QPushButton, addData)
 #: rc.cpp:64
 msgid "Add Data"
-msgstr ""
+msgstr "أضف بيانات"
 
 #. i18n: file: src/tm/managedatabases.ui:33
 #. i18n: ectx: property (text), widget (QPushButton, importTMX)
@@ -185,19 +187,19 @@
 #. i18n: ectx: property (text), widget (QPushButton, remove)
 #: rc.cpp:73
 msgid "Remove"
-msgstr ""
+msgstr "أزل"
 
 #. i18n: file: src/tm/dbparams.ui:20
 #. i18n: ectx: property (text), widget (QLabel, label)
 #: rc.cpp:76 scripts/newprojectwizard.py:213
 msgid "Name:"
-msgstr ""
+msgstr "الا&سم:"
 
 #. i18n: file: src/tm/dbparams.ui:28
 #. i18n: ectx: property (text), item, widget (QComboBox, dbType)
 #: rc.cpp:79
 msgid "Local"
-msgstr ""
+msgstr "محلي"
 
 #. i18n: file: src/tm/dbparams.ui:33
 #. i18n: ectx: property (text), item, widget (QComboBox, dbType)
@@ -209,55 +211,55 @@
 #. i18n: ectx: property (text), widget (QLabel, label_6)
 #: rc.cpp:85
 msgid "Database type:"
-msgstr ""
+msgstr "نوع قاعدة البيانات:"
 
 #. i18n: file: src/tm/dbparams.ui:48
 #. i18n: ectx: property (title), widget (QGroupBox, connectionBox)
 #: rc.cpp:88
 msgid "Connection"
-msgstr ""
+msgstr "الاتصال"
 
 #. i18n: file: src/tm/dbparams.ui:57
 #. i18n: ectx: property (text), widget (QLabel, label_10)
 #: rc.cpp:91
 msgid "Database name:"
-msgstr ""
+msgstr "اسم قاعدة البيانات:"
 
 #. i18n: file: src/tm/dbparams.ui:67
 #. i18n: ectx: property (text), widget (QLabel, label_7)
 #: rc.cpp:94
 msgid "Host:"
-msgstr ""
+msgstr "المضيف:"
 
 #. i18n: file: src/tm/dbparams.ui:81
 #. i18n: ectx: property (text), widget (QLabel, label_8)
 #: rc.cpp:97
 msgid "User:"
-msgstr ""
+msgstr "المستخدم:"
 
 #. i18n: file: src/tm/dbparams.ui:91
 #. i18n: ectx: property (text), widget (QLabel, label_9)
 #: rc.cpp:100
 msgid "Password:"
-msgstr ""
+msgstr "كلمة المرور:"
 
 #. i18n: file: src/tm/dbparams.ui:108
 #. i18n: ectx: property (title), widget (QGroupBox, contentBox)
 #: rc.cpp:103
 msgid "Content"
-msgstr ""
+msgstr "المحتوى"
 
 #. i18n: file: src/tm/dbparams.ui:60
 #. i18n: ectx: property (text), widget (QLabel, label_4)
 #: rc.cpp:85
 msgid "Source language:"
-msgstr ""
+msgstr "اللغة المصدر:"
 
 #. i18n: file: src/tm/dbparams.ui:70
 #. i18n: ectx: property (text), widget (QLabel, label_5)
 #: rc.cpp:88
 msgid "Target language:"
-msgstr ""
+msgstr "اللغة الهدف"
 
 #. i18n: file: src/tm/dbparams.ui:27
 #. i18n: ectx: property (text), widget (QLabel, label_2)
@@ -269,7 +271,7 @@
 #. i18n: ectx: property (text), widget (QLabel, label_3)
 #: rc.cpp:82
 msgid "Accelerator:"
-msgstr ""
+msgstr "المُسَرِّع:"
 
 #. i18n: file: src/tm/queryoptions.ui:32
 #. i18n: ectx: property (text), widget (QLabel, label)
@@ -304,13 +306,13 @@
 #. i18n: ectx: property (text), widget (QLabel, querySourceLabel)
 #: rc.cpp:99 scripts/newprojectwizard.py:281
 msgid "Source:"
-msgstr ""
+msgstr "المصدر:"
 
 #. i18n: file: src/tm/queryoptions.ui:50
 #. i18n: ectx: property (text), widget (QLabel, queryTargetLabel)
 #: rc.cpp:102 scripts/newprojectwizard.py:282
 msgid "Target:"
-msgstr ""
+msgstr "الهدف:"
 
 #. i18n: file: src/tm/queryoptions.ui:60
 #. i18n: ectx: property (toolTip), widget (QCheckBox, invertTarget)
@@ -326,7 +328,7 @@
 #. i18n: ectx: property (text), widget (QCheckBox, invertSource)
 #: rc.cpp:108 rc.cpp:114
 msgid "Invert"
-msgstr ""
+msgstr "اعكس"
 
 #. i18n: file: src/tm/queryoptions.ui:96
 #. i18n: ectx: property (text), widget (QLabel, label_2)
@@ -344,27 +346,27 @@
 #. i18n: ectx: property (toolTip), widget (QRadioButton, substr)
 #: rc.cpp:123 src/cataloglistview/cataloglistview.cpp:190
 msgid "Case insensitive"
-msgstr ""
+msgstr "غير حساس لحالة الأحرف"
 
 #. i18n: file: src/tm/queryoptions.ui:126
 #. i18n: ectx: property (text), widget (QRadioButton, substr)
 #: rc.cpp:126
 msgctxt "@option:radio"
 msgid "Substring"
-msgstr ""
+msgstr "نصّ فرعيّ"
 
 #. i18n: file: src/tm/queryoptions.ui:136
 #. i18n: ectx: property (toolTip), widget (QRadioButton, like)
 #: rc.cpp:129
 msgid "Space is AND operator. Case insensitive."
-msgstr ""
+msgstr "الفراغ يعادل دالّة \"و\". غير حساس لحالة الأحرف."
 
 #. i18n: file: src/tm/queryoptions.ui:139
 #. i18n: ectx: property (text), widget (QRadioButton, like)
 #: rc.cpp:132
 msgctxt "@option:radio"
 msgid "Google-like"
-msgstr ""
+msgstr "شبيه بجوجل"
 
 #. i18n: file: src/tm/queryoptions.ui:149
 #. i18n: ectx: property (toolTip), widget (QRadioButton, glob)
@@ -383,7 +385,7 @@
 #. i18n: ectx: property (text), widget (QPushButton, doFind)
 #: rc.cpp:141
 msgid "&Search"
-msgstr ""
+msgstr "ا&بحث"
 
 #. i18n: file: src/tm/queryoptions.ui:179
 #. i18n: ectx: property (toolTip), widget (QPushButton, doUpdateTM)
@@ -397,7 +399,7 @@
 #. i18n: ectx: property (text), widget (QPushButton, doUpdateTM)
 #: rc.cpp:181
 msgid "&Rescan project files"
-msgstr ""
+msgstr "أ&عد فحص ملفات المشروع"
 
 #. i18n: file: src/lokalizemainwindowui.rc:17
 #. i18n: ectx: Menu (project)
@@ -409,13 +411,13 @@
 #. i18n: ectx: Menu (project_actions)
 #: rc.cpp:156
 msgid "&Scripts"
-msgstr ""
+msgstr "نصوص برمجيّة"
 
 #. i18n: file: src/prefs/prefs_tm.ui:35
 #. i18n: ectx: property (toolTip), widget (QCheckBox, kcfg_PrefetchTM)
 #: rc.cpp:162
 msgid "If checked, get translation memory suggestions "
-msgstr ""
+msgstr "الحصول على اقتراحات ذاكرة الترجمة "
 
 #. i18n: file: src/prefs/prefs_tm.ui:38
 #. i18n: ectx: property (whatsThis), widget (QCheckBox, kcfg_PrefetchTM)
@@ -459,7 +461,7 @@
 #. i18n: ectx: property (text), widget (QCheckBox, kcfg_ScanToTMOnOpen)
 #: rc.cpp:183
 msgid "Add opened files to translation memory automatically"
-msgstr ""
+msgstr "أضف الملفات المفتوحة إلى ذاكرة الترجمة آليًّا"
 
 #. i18n: file: src/prefs/prefs_identity.ui:14
 #. i18n: ectx: property (whatsThis), widget (QWidget, prefs_identity)
@@ -474,27 +476,27 @@
 #: rc.cpp:189
 msgctxt "@label:chooser"
 msgid "Default language:"
-msgstr ""
+msgstr "اللغة المبدئيّة:"
 
 #. i18n: file: src/prefs/prefs_identity.ui:36
 #. i18n: ectx: property (text), widget (QLabel, textLabel2)
 #: rc.cpp:192
 msgctxt "@label:textbox"
 msgid "Email:"
-msgstr ""
+msgstr "ال&بريد الإلكتروني:"
 
 #. i18n: file: src/prefs/prefs_identity.ui:49
 #. i18n: ectx: property (text), widget (QLabel, textLabel2_2)
 #: rc.cpp:195
 msgctxt "@label:textbox"
 msgid "Name:"
-msgstr ""
+msgstr "الا&سم:"
 
 #. i18n: file: src/prefs/prefs_identity.ui:62
 #. i18n: ectx: property (toolTip), widget (KLineEdit, kcfg_authorName)
 #: rc.cpp:198
 msgid "Your name, in English"
-msgstr ""
+msgstr "اسمك، باللغة الإنجليزيّة"
 
 #. i18n: file: src/prefs/prefs_identity.ui:65
 #. i18n: ectx: property (whatsThis), widget (KLineEdit, kcfg_authorName)
@@ -507,13 +509,13 @@
 #: rc.cpp:204
 msgctxt "@label:textbox"
 msgid "Default mailing list:"
-msgstr ""
+msgstr "القائمة البريديّة المبدئيّة:"
 
 #. i18n: file: src/prefs/prefs_identity.ui:82
 #. i18n: ectx: property (toolTip), widget (KLineEdit, kcfg_DefaultMailingList)
 #: rc.cpp:207
 msgid "The email of your team mailing list"
-msgstr ""
+msgstr "عنوان القائمة البريديّة لفريقك"
 
 #. i18n: file: src/prefs/prefs_identity.ui:85
 #. i18n: ectx: property (whatsThis), widget (KLineEdit, kcfg_DefaultMailingList)
@@ -525,7 +527,7 @@
 #. i18n: ectx: property (toolTip), widget (KComboBox, DefaultLangCode)
 #: rc.cpp:213
 msgid "Language you translate to"
-msgstr ""
+msgstr "اللغة التي تترجم إليها"
 
 #. i18n: file: src/prefs/prefs_identity.ui:95
 #. i18n: ectx: property (whatsThis), widget (KComboBox, DefaultLangCode)
@@ -537,7 +539,7 @@
 #. i18n: ectx: property (toolTip), widget (KLineEdit, kcfg_authorEmail)
 #: rc.cpp:219
 msgid "Write your email"
-msgstr ""
+msgstr "اكتب عنوان بريدك"
 
 #. i18n: file: src/prefs/prefs_identity.ui:118
 #. i18n: ectx: property (whatsThis), widget (KLineEdit, kcfg_authorEmail)
@@ -550,7 +552,7 @@
 #. i18n: ectx: property (toolTip), widget (KLineEdit, kcfg_authorLocalizedName)
 #: rc.cpp:225
 msgid "Your name in your own language"
-msgstr ""
+msgstr "اسمك بلغتك المحلّيّة"
 
 #. i18n: file: src/prefs/prefs_identity.ui:135
 #. i18n: ectx: property (whatsThis), widget (KLineEdit, kcfg_authorLocalizedName)
@@ -564,7 +566,7 @@
 #: rc.cpp:231
 msgctxt "@label:textbox"
 msgid "Localized name:"
-msgstr ""
+msgstr "الاسم باللغة المحلّيّة:"
 
 #. i18n: file: src/prefs/prefs_editor.ui:36
 #. i18n: ectx: property (text), widget (QCheckBox, kcfg_AutoApprove)
@@ -597,7 +599,7 @@
 #. i18n: ectx: property (text), widget (QCheckBox, kcfg_MouseWheelGo)
 #: rc.cpp:243
 msgid "Mouse wheel goes to previous or next translation unit"
-msgstr ""
+msgstr "تتنقّ عجلة الفأرة بين وحدات الترجمة السابقة والتالية"
 
 #. i18n: file: src/prefs/prefs_editor.ui:56
 #. i18n: ectx: property (toolTip), widget (QLabel, l1)
@@ -605,49 +607,49 @@
 #. i18n: ectx: property (toolTip), widget (QSpinBox, kcfg_WordCompletionLength)
 #: rc.cpp:246 rc.cpp:252
 msgid "Set to 2 to disable word completion"
-msgstr ""
+msgstr "اجعل قيمتها 2 لتعطيل إكمال الكلمات"
 
 #. i18n: file: src/prefs/prefs_editor.ui:59
 #. i18n: ectx: property (text), widget (QLabel, l1)
 #: rc.cpp:249
 msgid "Minimum word length for word completion"
-msgstr ""
+msgstr "الطول الأدنى للكلمة لإكمالها"
 
 #. i18n: file: src/prefs/prefs_editor.ui:69
 #. i18n: ectx: property (specialValueText), widget (QSpinBox, kcfg_WordCompletionLength)
 #: rc.cpp:255
 msgid "Disable word completion"
-msgstr ""
+msgstr "عطّل إكمال الكلمات"
 
 #. i18n: file: src/prefs/lokalize.kcfg:14
 #. i18n: ectx: label, entry, group (Identity)
 #: rc.cpp:258
 msgid "Translator's name"
-msgstr ""
+msgstr "اسم المترجِم:"
 
 #. i18n: file: src/prefs/lokalize.kcfg:15
 #. i18n: ectx: whatsthis, entry, group (Identity)
 #: rc.cpp:261
 msgid "Translator's name in English"
-msgstr ""
+msgstr "اسم المُتَرجِم بالإنجليزيّة"
 
 #. i18n: file: src/prefs/lokalize.kcfg:21
 #. i18n: ectx: label, entry, group (Identity)
 #: rc.cpp:264
 msgid "Localized name"
-msgstr ""
+msgstr "الاسم باللغة المحلّيّة:"
 
 #. i18n: file: src/prefs/lokalize.kcfg:22
 #. i18n: ectx: whatsthis, entry, group (Identity)
 #: rc.cpp:267
 msgid "Translator's name in target language"
-msgstr ""
+msgstr "اسم المترجم باللغة الهدف"
 
 #. i18n: file: src/prefs/lokalize.kcfg:28
 #. i18n: ectx: whatsthis, entry, group (Identity)
 #: rc.cpp:270
 msgid "Translator's email"
-msgstr ""
+msgstr "بريد المترجم"
 
 #. i18n: file: src/prefs/lokalize.kcfg:34
 #. i18n: ectx: label, entry, group (Identity)
@@ -655,7 +657,7 @@
 #. i18n: ectx: whatsthis, entry, group (Identity)
 #: rc.cpp:273 rc.cpp:276
 msgid "Default language code for new projects"
-msgstr ""
+msgstr "رمز اللغة المبدئيّ للمشاريع الجديدة"
 
 #. i18n: file: src/prefs/lokalize.kcfg:41
 #. i18n: ectx: label, entry, group (Identity)
@@ -663,7 +665,7 @@
 #. i18n: ectx: whatsthis, entry, group (Identity)
 #: rc.cpp:279 rc.cpp:282
 msgid "Default mailing list for new projects"
-msgstr ""
+msgstr "القائمة البريديّة المبدئيّة للمشاريع الجديدة"
 
 #. i18n: file: src/prefs/lokalize.kcfg:61
 #. i18n: ectx: label, entry (CleverEditing), group (Appearance)
@@ -689,7 +691,7 @@
 #. i18n: ectx: property (text), widget (QLabel, label)
 #: rc.cpp:300
 msgid "Editor font:"
-msgstr ""
+msgstr "خط المحرر:"
 
 #. i18n: file: src/prefs/prefs_appearance.ui:31
 #. i18n: ectx: property (toolTip), widget (KFontRequester, kcfg_MsgFont)
@@ -736,14 +738,14 @@
 #. i18n: ectx: property (title), widget (QGroupBox, groupBox)
 #: rc.cpp:321
 msgid "String Matching"
-msgstr ""
+msgstr "مطابقة النصوص"
 
 #. i18n: file: src/prefs/prefs_appearance.ui:65
 #. i18n: ectx: property (text), widget (QLabel, label_2)
 #: rc.cpp:324
 msgctxt "@label:chooser"
 msgid "Text added in the newer string:"
-msgstr ""
+msgstr "نصٌّ أضيف في السلسلة النصّيّة الجديدة"
 
 #. i18n: file: src/prefs/prefs_appearance.ui:72
 #. i18n: ectx: property (toolTip), widget (KColorButton, kcfg_AddColor)
@@ -763,7 +765,7 @@
 #: rc.cpp:333
 msgctxt "@label:chooser"
 msgid "Text removed in the newer string:"
-msgstr ""
+msgstr "نصٌّ أزيل في السلسلة النصّيّة الجديدة"
 
 #. i18n: file: src/prefs/prefs_appearance.ui:92
 #. i18n: ectx: property (toolTip), widget (KColorButton, kcfg_DelColor)
@@ -798,13 +800,13 @@
 #. i18n: ectx: property (text), widget (QPushButton, queryBtn)
 #: rc.cpp:348
 msgid "Query"
-msgstr ""
+msgstr "الاستعلام"
 
 #. i18n: file: src/webquery/querycontrol.ui:15
 #. i18n: ectx: property (text), widget (QCheckBox, autoQuery)
 #: rc.cpp:351
 msgid "Autoquery"
-msgstr ""
+msgstr "استعلام آليّ"
 
 #. i18n: file: src/webquery/querycontrol.ui:22
 #. i18n: ectx: property (toolTip), widget (QCheckBox, checkBox)
@@ -823,13 +825,13 @@
 #: rc.cpp:360
 msgctxt "@label:textbox"
 msgid "Target language:"
-msgstr ""
+msgstr "اللغة الهدف:"
 
 #. i18n: file: src/project/prefs_projectmain.ui:36
 #. i18n: ectx: property (toolTip), widget (KComboBox, LangCode)
 #: rc.cpp:363
 msgid "Target language of the project."
-msgstr ""
+msgstr "اللغة الهدف للمشروع."
 
 #. i18n: file: src/project/prefs_projectmain.ui:56
 #. i18n: ectx: property (toolTip), widget (KUrlRequester, poBaseDir)
@@ -844,14 +846,14 @@
 #: rc.cpp:370
 msgctxt "@label:textbox"
 msgid "Root folder:"
-msgstr ""
+msgstr "المجلد الرئيسي:"
 
 #. i18n: file: src/project/prefs_projectmain.ui:89
 #. i18n: ectx: property (text), widget (QLabel, l2)
 #: rc.cpp:373
 msgctxt "@label:textbox"
 msgid "Glossary:"
-msgstr ""
+msgstr "المُسْرد:"
 
 #. i18n: file: src/project/prefs_projectmain.ui:99
 #. i18n: ectx: property (toolTip), widget (QLineEdit, kcfg_ProjectID)
@@ -869,27 +871,27 @@
 #: rc.cpp:382
 msgctxt "@label:textbox"
 msgid "ID:"
-msgstr ""
+msgstr "الهويّة:"
 
 #. i18n: file: src/project/prefs_projectmain.ui:116
 #. i18n: ectx: property (text), widget (QLabel, l4)
 #: rc.cpp:385
 msgctxt "@label:textbox"
 msgid "Mailing list:"
-msgstr ""
+msgstr "القائمة البريديّة:"
 
 #. i18n: file: src/project/prefs_project_advanced.ui:16
 #. i18n: ectx: property (title), widget (QGroupBox, groupBox)
 #: rc.cpp:388
 msgid "Syntax"
-msgstr ""
+msgstr "الصياغة"
 
 #. i18n: file: src/project/prefs_project_advanced.ui:22
 #. i18n: ectx: property (text), widget (QLabel, l0)
 #: rc.cpp:391
 msgctxt "@label:textbox"
 msgid "Accelerator:"
-msgstr ""
+msgstr "المُسَرِّع:"
 
 #. i18n: file: src/project/prefs_project_advanced.ui:29
 #. i18n: ectx: property (toolTip), widget (QLineEdit, kcfg_Accel)
@@ -922,14 +924,14 @@
 #. i18n: ectx: property (title), widget (QGroupBox, groupBox_2)
 #: rc.cpp:408
 msgid "Paths"
-msgstr ""
+msgstr "المسارات"
 
 #. i18n: file: src/project/prefs_project_advanced.ui:70
 #. i18n: ectx: property (text), widget (QLabel, l2)
 #: rc.cpp:411
 msgctxt "@label:textbox"
 msgid "Template files folder:"
-msgstr ""
+msgstr "مجلد ملفات القوالب:"
 
 #. i18n: file: src/project/prefs_project_advanced.ui:91
 #. i18n: ectx: property (toolTip), widget (KUrlRequester, potBaseDir)
@@ -948,7 +950,7 @@
 #: rc.cpp:422
 msgctxt "@label:textbox"
 msgid "Branch folder:"
-msgstr ""
+msgstr "مجلدات الفروع:"
 
 #. i18n: file: src/project/prefs_project_advanced.ui:125
 #. i18n: ectx: property (toolTip), widget (KUrlRequester, branchDir)
@@ -976,7 +978,7 @@
 #: rc.cpp:439
 msgctxt "@label:textbox"
 msgid "Alternate translations folder:"
-msgstr ""
+msgstr "مجلد الترجمات البديل"
 
 #. i18n: file: src/project/prefs_project_advanced.ui:156
 #. i18n: ectx: property (toolTip), widget (KUrlRequester, altDir)
@@ -1003,19 +1005,19 @@
 #. i18n: ectx: property (text), widget (QLabel, l0)
 #: rc.cpp:453
 msgid "Role:"
-msgstr ""
+msgstr "الدور:"
 
 #. i18n: file: src/project/prefs_project_local.ui:29
 #. i18n: ectx: property (text), item, widget (QComboBox, kcfg_Role)
 #: rc.cpp:456
 msgid "Translator"
-msgstr ""
+msgstr "المترجِم"
 
 #. i18n: file: src/project/prefs_project_local.ui:34
 #. i18n: ectx: property (text), item, widget (QComboBox, kcfg_Role)
 #: rc.cpp:459
 msgid "Reviewer"
-msgstr ""
+msgstr "مُدَقِّق"
 
 #. i18n: file: src/project/prefs_project_local.ui:39
 #. i18n: ectx: property (text), item, widget (QComboBox, kcfg_Role)
@@ -1027,31 +1029,31 @@
 #. i18n: ectx: label, entry (LangCode), group (General)
 #: rc.cpp:471
 msgid "Language"
-msgstr ""
+msgstr "الل&غة"
 
 #. i18n: file: src/project/projectbase.kcfg:33
 #. i18n: ectx: label, entry (PoBaseDir), group (General)
 #: rc.cpp:474
 msgid "The base directory for PO files (translations)"
-msgstr ""
+msgstr "المجلّد الأساسيّ لملفات PO (الترجمات)"
 
 #. i18n: file: src/project/projectbase.kcfg:39
 #. i18n: ectx: label, entry (PotBaseDir), group (General)
 #: rc.cpp:477
 msgid "The base directory for POT files (templates to be translated)"
-msgstr ""
+msgstr "المجلّد الأساسيّ لملفات POT (القوالب التي سيتم ترجمتها)"
 
 #. i18n: file: src/project/projectbase.kcfg:47
 #. i18n: ectx: label, entry (GlossaryTbx), group (General)
 #: rc.cpp:480
 msgid "Project's glossary"
-msgstr ""
+msgstr "مُسرَد المشروع"
 
 #. i18n: file: src/kaider_findextension.ui:30
 #. i18n: ectx: property (whatsThis), widget (QCheckBox, m_skipTags)
 #: rc.cpp:483
 msgid "Skip tags"
-msgstr ""
+msgstr "تخطّى الوسوم"
 
 #. i18n: file: src/kaider_findextension.ui:33
 #. i18n: ectx: property (text), widget (QCheckBox, m_skipTags)
@@ -1064,20 +1066,20 @@
 #. i18n: ectx: property (whatsThis), widget (QCheckBox, m_ignoreAccelMarks)
 #: rc.cpp:489 src/cataloglistview/cataloglistview.cpp:191
 msgid "Ignore accelerator marks"
-msgstr ""
+msgstr "تجاهل علامات المسرّعات"
 
 #. i18n: file: src/kaider_findextension.ui:43
 #. i18n: ectx: property (text), widget (QCheckBox, m_ignoreAccelMarks)
 #: rc.cpp:492
 msgctxt "@option:check"
 msgid "Ignore accelerator marks"
-msgstr ""
+msgstr "تجاهل علامات المسرّعات"
 
 #. i18n: file: src/kaider_findextension.ui:54
 #. i18n: ectx: property (text), widget (QCheckBox, m_notes)
 #: rc.cpp:495
 msgid "Include notes"
-msgstr ""
+msgstr "ضمّن الملاحظات"
 
 #. i18n: file: scripts/widget-text-capture.ui:25
 #. i18n: ectx: property (text), widget (QLabel, label)
@@ -1101,13 +1103,13 @@
 #. i18n: ectx: property (title), widget (QGroupBox, groupBox)
 #: rc.cpp:504
 msgid "Middle Mouse Button Click Reaction"
-msgstr ""
+msgstr "أثر نقر الزرّ الأوسط للفأرة"
 
 #. i18n: file: scripts/widget-text-capture.ui:47
 #. i18n: ectx: property (text), widget (QRadioButton, none)
 #: rc.cpp:507
 msgid "None"
-msgstr ""
+msgstr "شيء"
 
 #. i18n: file: scripts/widget-text-capture.ui:57
 #. i18n: ectx: property (text), widget (QRadioButton, search)
@@ -1119,19 +1121,19 @@
 #. i18n: ectx: property (text), widget (QRadioButton, clipboard)
 #: rc.cpp:513
 msgid "Copy GUI element text to clipboard"
-msgstr ""
+msgstr "انسخ نصّ عنصر الواجهة إلى الحافظة"
 
 #. i18n: tag collection attribute text
 #. i18n: file: scripts/msgmerge.rc:3
 #: rc.cpp:516
 msgid "File"
-msgstr ""
+msgstr "ملف"
 
 #. i18n: tag script attribute text
 #. i18n: file: scripts/msgmerge.rc:4
 #: rc.cpp:519
 msgid "Update file from template"
-msgstr ""
+msgstr "حدّث الملف من القالب"
 
 #. i18n: tag collection attribute text
 #. i18n: file: scripts/newprojectwizard.rc:3
@@ -1139,13 +1141,13 @@
 #. i18n: file: scripts/newprojectwizard_win.rc:3
 #: rc.cpp:522 rc.cpp:531
 msgid "Project"
-msgstr ""
+msgstr "مشروع"
 
 #. i18n: tag script attribute text
 #. i18n: file: scripts/newprojectwizard.rc:4
 #: rc.cpp:525
 msgid "New project wizard"
-msgstr ""
+msgstr "معالج مشروع جديد"
 
 #. i18n: tag script attribute comment
 #. i18n: file: scripts/newprojectwizard.rc:4
@@ -1153,13 +1155,13 @@
 #. i18n: file: scripts/newprojectwizard_win.rc:4
 #: rc.cpp:528 rc.cpp:537
 msgid "Fires up a wizard to guide you through project creation"
-msgstr ""
+msgstr "يبدأ معالجاً يساعدك في إنشاء المشروع"
 
 #. i18n: tag script attribute text
 #. i18n: file: scripts/newprojectwizard_win.rc:4
 #: rc.cpp:534
 msgid "Create new project"
-msgstr ""
+msgstr "أنشئ مشروعاً جديدًا"
 
 #. i18n: tag collection attribute text
 #. i18n: file: scripts/widget-text-capture.rc:3
@@ -1167,7 +1169,7 @@
 #. i18n: file: scripts/xliff2odf.rc:3
 #: rc.cpp:540 rc.cpp:549
 msgid "Tools"
-msgstr ""
+msgstr "الأدوات"
 
 #. i18n: tag script attribute text
 #. i18n: file: scripts/widget-text-capture.rc:4
@@ -1187,18 +1189,18 @@
 #. i18n: file: scripts/xliff2odf.rc:4
 #: rc.cpp:552
 msgid "Merge into ODF"
-msgstr ""
+msgstr "دمج في ملف ODF"
 
 #. i18n: tag script attribute comment
 #. i18n: file: scripts/xliff2odf.rc:4
 #: rc.cpp:555
 msgid "Generates translated version of ODF document"
-msgstr ""
+msgstr "إنشاء نسخة مترجمة من مستند ODF"
 
 #: src/alttransview.cpp:49 src/alttransview.cpp:52
 msgctxt "@title:window"
 msgid "Alternate Translations"
-msgstr ""
+msgstr "الترجمات البديلة"
 
 #: src/alttransview.cpp:85
 msgctxt "@info:tooltip"
@@ -1223,25 +1225,25 @@
 #: src/alttransview.cpp:278
 msgctxt "@item Undo action"
 msgid "Use alternate translation"
-msgstr ""
+msgstr "استخدم ترجمة بديلة"
 
 #: src/binunitsview.cpp:131
 msgid "no"
-msgstr ""
+msgstr "لا"
 
 #: src/binunitsview.cpp:131
 msgid "yes"
-msgstr ""
+msgstr "نعم"
 
 #: src/binunitsview.cpp:149
 msgctxt "@title:column"
 msgid "Source"
-msgstr ""
+msgstr "المصدر"
 
 #: src/binunitsview.cpp:150
 msgctxt "@title:column"
 msgid "Target"
-msgstr ""
+msgstr "الهدف"
 
 #: src/binunitsview.cpp:151
 msgctxt "@title:column"
@@ -1251,17 +1253,17 @@
 #: src/binunitsview.cpp:159
 msgctxt "@title toolview name"
 msgid "Binary Units"
-msgstr ""
+msgstr "وحدات ثنائيّة"
 
 #: src/binunitsview.cpp:197
 msgctxt "@action:inmenu"
 msgid "Set the file"
-msgstr ""
+msgstr "اضبط الملف"
 
 #: src/binunitsview.cpp:198
 msgctxt "@action:inmenu"
 msgid "Use source file"
-msgstr ""
+msgstr "الملف المصدر"
 
 #: src/editortab.cpp:164
 #, kde-format
@@ -1294,7 +1296,7 @@
 #, kde-format
 msgctxt "percentages in statusbar"
 msgid " (%1%)"
-msgstr ""
+msgstr " (%1%)"
 
 #: src/editortab.cpp:211 src/lokalizemainwindow.cpp:380
 msgctxt "@title actions category"
@@ -1337,12 +1339,12 @@
 #, kde-format
 msgctxt "@action:inmenu"
 msgid "Insert alternate translation # %1"
-msgstr ""
+msgstr "إدراج الترجمة البديلة # %1"
 
 #: src/editortab.cpp:289
 msgctxt "@action:inmenu"
 msgid "Add a note"
-msgstr ""
+msgstr "أضف ملاحظة"
 
 #: src/editortab.cpp:311
 #, kde-format
@@ -1354,12 +1356,12 @@
 #, kde-format
 msgctxt "@action:inmenu"
 msgid "Insert # %1 term translation"
-msgstr ""
+msgstr "إدراج # %1 ترجمة مصطلح"
 
 #: src/editortab.cpp:369
 msgctxt "@action:inmenu"
 msgid "Define new term"
-msgstr ""
+msgstr "عرّف مضطلحاً جديداً"
 
 #: src/editortab.cpp:403
 #, kde-format
@@ -1370,12 +1372,12 @@
 #: src/editortab.cpp:434
 msgctxt "@action:inmenu"
 msgid "Phases..."
-msgstr ""
+msgstr "الأطوار..."
 
 #: src/editortab.cpp:470
 msgctxt "@action:inmenu"
 msgid "Change searching direction"
-msgstr ""
+msgstr "غيّر اتجاه البحث"
 
 #: src/editortab.cpp:479
 msgctxt ""
@@ -1387,22 +1389,22 @@
 #: src/editortab.cpp:495
 msgctxt "@action:inmenu"
 msgid "Approve and go to next"
-msgstr ""
+msgstr "وافق وانتقل للتالي"
 
 #: src/editortab.cpp:500
 msgctxt "@action:inmenu"
 msgid "Equivalent translation"
-msgstr ""
+msgstr "الترجمة المكافئة"
 
 #: src/editortab.cpp:512
 msgctxt "@action:inmenu"
 msgid "Copy source to target"
-msgstr ""
+msgstr "انسخ المصدر للهدف"
 
 #: src/editortab.cpp:515
 msgctxt "@action:inmenu"
 msgid "Unwrap target"
-msgstr ""
+msgstr "الغِ التفاف نصوص المصدر"
 
 #: src/editortab.cpp:520
 msgctxt "@action:inmenu"
@@ -1412,7 +1414,7 @@
 #: src/editortab.cpp:524
 msgctxt "@action:inmenu"
 msgid "Completion"
-msgstr ""
+msgstr "تتمة"
 
 #: src/editortab.cpp:528
 msgctxt "@action:inmenu"
@@ -1422,7 +1424,7 @@
 #: src/editortab.cpp:532
 msgctxt "@action:inmenu"
 msgid "Insert Next Tag"
-msgstr ""
+msgstr "أدرج الوسم التالي"
 
 #: src/editortab.cpp:536
 msgctxt "@action:inmenu"
@@ -1459,14 +1461,14 @@
 "@action:inmenu\n"
 "'not ready' means 'fuzzy' in gettext terminology"
 msgid "Previous non-empty but not ready"
-msgstr ""
+msgstr "المبهمة السابقة"
 
 #: src/editortab.cpp:574 src/project/projecttab.cpp:106
 msgctxt ""
 "@action:inmenu\n"
 "'not ready' means 'fuzzy' in gettext terminology"
 msgid "Next non-empty but not ready"
-msgstr ""
+msgstr "المبهمة التالية"
 
 #: src/editortab.cpp:579 src/project/projecttab.cpp:109
 msgctxt "@action:inmenu"
@@ -1483,14 +1485,14 @@
 "@action:inmenu\n"
 "'not ready' means 'fuzzy' in gettext terminology"
 msgid "Previous not ready"
-msgstr ""
+msgstr "المدخلة السابقة غير الجاهزة"
 
 #: src/editortab.cpp:594 src/project/projecttab.cpp:100
 msgctxt ""
 "@action:inmenu\n"
 "'not ready' means 'fuzzy' in gettext terminology"
 msgid "Next not ready"
-msgstr ""
+msgstr "المدخلة التالية غير الجاهزة"
 
 #: src/editortab.cpp:601
 msgctxt "@action:inmenu"
@@ -1500,17 +1502,17 @@
 #: src/editortab.cpp:607
 msgctxt "@option:check"
 msgid "Bookmark message"
-msgstr ""
+msgstr "رسالة العلامة"
 
 #: src/editortab.cpp:613
 msgctxt "@action:inmenu"
 msgid "Previous bookmark"
-msgstr ""
+msgstr "العلامة السابقة"
 
 #: src/editortab.cpp:617
 msgctxt "@action:inmenu"
 msgid "Next bookmark"
-msgstr ""
+msgstr "العلامة التالية"
 
 #: src/editortab.cpp:625
 #, no-c-format
@@ -1532,7 +1534,7 @@
 #: src/editortab.cpp:638
 msgctxt "@action:inmenu"
 msgid "Open file for sync/merge"
-msgstr ""
+msgstr "افتح ملفًّا للمزامنة والدمج"
 
 #: src/editortab.cpp:639 src/editortab.cpp:686
 msgctxt "@info:status"
@@ -1544,7 +1546,7 @@
 #: src/editortab.cpp:645 src/editortab.cpp:692
 msgctxt "@action:inmenu"
 msgid "Previous different"
-msgstr ""
+msgstr "المختلف السابق"
 
 #: src/editortab.cpp:646 src/editortab.cpp:693
 msgctxt "@info:status"
@@ -1556,7 +1558,7 @@
 #: src/editortab.cpp:654 src/editortab.cpp:700
 msgctxt "@action:inmenu"
 msgid "Next different"
-msgstr ""
+msgstr "الاختلاف التالي"
 
 #: src/editortab.cpp:655 src/editortab.cpp:701
 msgctxt "@info:status"
@@ -1568,12 +1570,12 @@
 #: src/editortab.cpp:663 src/editortab.cpp:708
 msgctxt "@action:inmenu"
 msgid "Copy from merging source"
-msgstr ""
+msgstr "انسخ من مصدر الدمج"
 
 #: src/editortab.cpp:669 src/editortab.cpp:713
 msgctxt "@action:inmenu"
 msgid "Copy all new translations"
-msgstr ""
+msgstr "انسخ كلّ الترجمات الجديدة"
 
 #: src/editortab.cpp:670
 msgctxt "@info:status"
@@ -1583,22 +1585,22 @@
 #: src/editortab.cpp:678 src/editortab.cpp:720
 msgctxt "@action:inmenu"
 msgid "Copy to merging source"
-msgstr ""
+msgstr "انسخ إلى مصدر الدمج"
 
 #: src/editortab.cpp:685
 msgctxt "@action:inmenu"
 msgid "Open file for secondary sync"
-msgstr ""
+msgstr "افتح ملفاً لمزامنة ثانويّة"
 
 #: src/editortab.cpp:714
 msgctxt "@info:status"
 msgid "This changes only empty entries"
-msgstr ""
+msgstr "هذه تغيّر المدخلات غير المترجمة فقط"
 
 #: src/editortab.cpp:745
 msgctxt "editor tab name"
 msgid "(recovered)"
-msgstr ""
+msgstr "(مُسترجَع)"
 
 #: src/editortab.cpp:787 src/editortab.cpp:940
 msgctxt "@info"
@@ -1611,7 +1613,7 @@
 #: src/glossary/glossarywindow.cpp:478
 msgctxt "@title:window"
 msgid "Warning"
-msgstr ""
+msgstr "تحذير"
 
 #: src/editortab.cpp:884
 #, kde-format
@@ -1636,7 +1638,7 @@
 #: src/editortab.cpp:910
 msgctxt "@title"
 msgid "Error"
-msgstr ""
+msgstr "خطأ"
 
 #: src/editortab.cpp:918
 #, kde-format
@@ -1649,12 +1651,12 @@
 #: src/editortab.cpp:967
 msgctxt "@title"
 msgid "Jump to Entry"
-msgstr ""
+msgstr "اقفز إلى المدخلة"
 
 #: src/editortab.cpp:968
 msgctxt "@label:spinbox"
 msgid "Enter entry number:"
-msgstr ""
+msgstr "أدخل رقم المدخلة"
 
 #: src/editortab.cpp:1044
 #, kde-format
@@ -1672,18 +1674,18 @@
 #: src/tm/tmtab.cpp:246
 msgctxt "@info:status 'non-fuzzy' in gettext terminology"
 msgid "Ready"
-msgstr ""
+msgstr "جاهز"
 
 #: src/editortab.cpp:1058 src/cataloglistview/catalogmodel.cpp:169
 #: src/tm/tmtab.cpp:247
 msgctxt "@info:status 'fuzzy' in gettext terminology"
 msgid "Needs review"
-msgstr ""
+msgstr "يحتاج إلى مراجعة"
 
 #: src/editortab.cpp:1222
 msgctxt "@option:check trans-unit state"
 msgid "Translated"
-msgstr ""
+msgstr "مترجَم"
 
 #: src/editortab.cpp:1223
 msgctxt "@option:check trans-unit state"
@@ -1708,7 +1710,7 @@
 #: src/editortab.cpp:1229
 msgctxt "@info:tooltip"
 msgid "Entry is fully localized (i.e. final)"
-msgstr ""
+msgstr "المدخلة مترجمة كلّيًّا (نهائيّة مثلاً)"
 
 #: src/editortab.cpp:1342
 msgctxt "@info"
@@ -1731,11 +1733,11 @@
 #: src/editortab_findreplace.cpp:591 src/editortab_findreplace.cpp:600
 msgctxt "@title"
 msgid "Spellcheck"
-msgstr ""
+msgstr "دقق إملائياً"
 
 #: src/editortab_findreplace.cpp:600
 msgid "Lokalize has finished spellchecking"
-msgstr ""
+msgstr "أنهى لوكالايز التدقيق الإملائيّ"
 
 #: src/editortab_findreplace.cpp:710
 #, kde-format
@@ -1751,7 +1753,7 @@
 #: src/editorview.cpp:69
 msgctxt "@label whether entry is fuzzy"
 msgid "Not ready:"
-msgstr ""
+msgstr "غيرجاهز:"
 
 #: src/editorview.cpp:71
 msgctxt "@label whether entry is untranslated"
@@ -1761,13 +1763,13 @@
 #: src/editorview.cpp:82
 msgctxt "@action"
 msgid "Hide"
-msgstr ""
+msgstr "اخفِ"
 
 #: src/editorview.cpp:92
 #, kde-format
 msgctxt "@info:label cursor position"
 msgid "Column: %1"
-msgstr ""
+msgstr "العمود: %1"
 
 #: src/editorview.cpp:107
 msgid ""
@@ -1785,7 +1787,7 @@
 #: src/editorview.cpp:280
 msgctxt "@item Undo action item"
 msgid "Unwrap"
-msgstr ""
+msgstr "الغ الالتفاف"
 
 #: src/lokalizemainwindow.cpp:383
 msgctxt "@title actions category"
@@ -1799,11 +1801,11 @@
 
 #: src/lokalizemainwindow.cpp:423
 msgid "Next tab"
-msgstr ""
+msgstr "اللسان التالي"
 
 #: src/lokalizemainwindow.cpp:426
 msgid "Previous tab"
-msgstr ""
+msgstr "اللسان السابق"
 
 #: src/lokalizemainwindow.cpp:432
 msgctxt "@action:inmenu"
@@ -1818,22 +1820,22 @@
 #: src/lokalizemainwindow.cpp:444
 msgctxt "@action:inmenu"
 msgid "Manage translation memories"
-msgstr ""
+msgstr "أدِر ذواكر الترجمة"
 
 #: src/lokalizemainwindow.cpp:448
 msgctxt "@action:inmenu"
 msgid "Project overview"
-msgstr ""
+msgstr "عرض عام للمشروع"
 
 #: src/lokalizemainwindow.cpp:452
 msgctxt "@action:inmenu"
 msgid "Configure project"
-msgstr ""
+msgstr "اضبط المشروع"
 
 #: src/lokalizemainwindow.cpp:455
 msgctxt "@action:inmenu"
 msgid "Create new project"
-msgstr ""
+msgstr "أنشئ مشروعاً جديدًا"
 
 #: src/lokalizemainwindow.cpp:458 src/project/projecttab.cpp:131
 msgctxt "@action:inmenu"
@@ -1843,7 +1845,7 @@
 #: src/lokalizemainwindow.cpp:461
 msgctxt "@action:inmenu"
 msgid "Open recent project"
-msgstr ""
+msgstr "افتح مشروعاً حديثاً"
 
 #: src/lokalizemainwindow.cpp:642
 msgctxt "@info"
@@ -1857,11 +1859,13 @@
 "Computer-aided translation system.\n"
 "Do not translate what had already been translated."
 msgstr ""
+"برنامج ترجمة بمساعدة الحاسوب.\n"
+"لا تترجم ما تمّ ترجمته مسبقاً."
 
 #: src/main.cpp:60
 msgctxt "@title"
 msgid "Lokalize"
-msgstr ""
+msgstr "لوكالايز"
 
 #: src/main.cpp:61
 msgctxt "@info:credit"
@@ -1872,11 +1876,11 @@
 
 #: src/main.cpp:62
 msgid "Nick Shaforostoff"
-msgstr ""
+msgstr "Nick Shaforostoff"
 
 #: src/main.cpp:63
 msgid "Google Inc."
-msgstr ""
+msgstr "Google Inc."
 
 #: src/main.cpp:63
 msgid "sponsored development as part of Google Summer Of Code program"
@@ -1892,7 +1896,7 @@
 
 #: src/main.cpp:65
 msgid "Viesturs Zarins"
-msgstr ""
+msgstr "Viesturs Zarins"
 
 #: src/main.cpp:65
 msgid "project tree merging translation+templates"
@@ -1900,47 +1904,47 @@
 
 #: src/main.cpp:66
 msgid "Stephan Johach"
-msgstr ""
+msgstr "Stephan Johach"
 
 #: src/main.cpp:66 src/main.cpp:67 src/main.cpp:70
 msgid "bug fixing patches"
-msgstr ""
+msgstr "ترقيعات إصلاح العثرات"
 
 #: src/main.cpp:67
 msgid "Chusslove Illich"
-msgstr ""
+msgstr "Chusslove Illich"
 
 #: src/main.cpp:68
 msgid "Jure Repinc"
-msgstr ""
+msgstr "Jure Repinc"
 
 #: src/main.cpp:68
 msgid "testing and bug fixing"
-msgstr ""
+msgstr "الفحص وإصلاح العثرات"
 
 #: src/main.cpp:69
 msgid "Stefan Asserhall"
-msgstr ""
+msgstr "Stefan Asserhall"
 
 #: src/main.cpp:69
 msgid "patches"
-msgstr ""
+msgstr "الترقيعات"
 
 #: src/main.cpp:70
 msgid "Papp Laszlo"
-msgstr ""
+msgstr "Papp Laszlo"
 
 #: src/main.cpp:76
 msgid "Do not scan files of the project."
-msgstr ""
+msgstr "لا تفحص ملفات المشروع."
 
 #: src/main.cpp:77
 msgid "Load specified project."
-msgstr ""
+msgstr "تشغيل مشروع محدَّد"
 
 #: src/main.cpp:78
 msgid "Document to open"
-msgstr ""
+msgstr "مستند ليُفتَح"
 
 #: src/msgctxtview.cpp:50
 msgctxt "@title toolview name"
@@ -1951,111 +1955,111 @@
 msgctxt ""
 "@info notes to translation unit which expire when the catalog is closed"
 msgid "<b>Temporary notes:</b>"
-msgstr ""
+msgstr "<b>ملاحظات مؤقّتة:</b>"
 
 #: src/msgctxtview.cpp:121
 msgctxt "@info translation unit metadata"
 msgid "<b>Phase:</b><br>"
-msgstr ""
+msgstr "<b>الطور:</b><br>"
 
 #: src/msgctxtview.cpp:144
 msgctxt "@info PO comment parsing"
 msgid "<br><b>Files:</b><br>"
-msgstr ""
+msgstr "<br><b>الملفات:</b><br>"
 
 #: src/msgctxtview.cpp:152
 msgctxt "@info PO comment parsing"
 msgid "<br><b>Context:</b><br>"
-msgstr ""
+msgstr "<br><b>السياق:</b><br>"
 
 #: src/noteeditor.cpp:58
 msgctxt "@info:label"
 msgid "From:"
-msgstr ""
+msgstr "من:"
 
 #: src/noteeditor.cpp:62
 msgctxt "@info:tooltip"
 msgid "Save empty note to remove it"
-msgstr ""
+msgstr "احفظ ملاحظة فارغة لإزالتها"
 
 #: src/noteeditor.cpp:63
 msgctxt "@info:tooltip"
 msgid "Author of this note"
-msgstr ""
+msgstr "مؤلّف هذه الملاحظة"
 
 #: src/noteeditor.cpp:78
 msgid "Ctrl+Enter"
-msgstr ""
+msgstr "Ctrl+Enter"
 
 #: src/noteeditor.cpp:79
 msgid "Esc"
-msgstr ""
+msgstr "Esc"
 
 #: src/noteeditor.cpp:132
 msgctxt "@info XLIFF notes representation"
 msgid "<b>Notes:</b>"
-msgstr ""
+msgstr "<b>الملاحظات:</b>"
 
 #: src/noteeditor.cpp:144
 msgctxt "link to edit note"
 msgid "edit..."
-msgstr ""
+msgstr "حرِّر..."
 
 #: src/noteeditor.cpp:149
 msgctxt "link to add a note"
 msgid "Add..."
-msgstr ""
+msgstr "أضِف..."
 
 #: src/noteeditor.cpp:152
 msgctxt "link to add a note"
 msgid "Add a note..."
-msgstr ""
+msgstr "أضِف ملاحظة..."
 
 #: src/phaseswindow.cpp:148
 msgctxt "@title:column"
 msgid "Date"
-msgstr ""
+msgstr "التاريخ"
 
 #: src/phaseswindow.cpp:149
 msgctxt "@title:column"
 msgid "Process"
-msgstr ""
+msgstr "العمليّة"
 
 #: src/phaseswindow.cpp:150
 msgctxt "@title:column"
 msgid "Company"
-msgstr ""
+msgstr "الشركة"
 
 #: src/phaseswindow.cpp:151
 msgctxt "@title:column"
 msgid "Person"
-msgstr ""
+msgstr "الشخص"
 
 #: src/phaseswindow.cpp:152
 msgctxt "@title:column"
 msgid "Tool"
-msgstr ""
+msgstr "الأداة"
 
 #: src/phaseswindow.cpp:177
 msgid "Translation"
-msgstr ""
+msgstr "الترجمة"
 
 #: src/phaseswindow.cpp:177
 msgid "Review"
-msgstr ""
+msgstr "المراجعة"
 
 #: src/phaseswindow.cpp:177
 msgid "Approval"
-msgstr ""
+msgstr "الموافقة"
 
 #: src/phaseswindow.cpp:181
 msgid "Process"
-msgstr ""
+msgstr "العمليّة"
 
 #: src/phaseswindow.cpp:244
 msgctxt "@item Undo action item"
 msgid "Edit phases"
-msgstr ""
+msgstr "حرّر الأطوار"
 
 #: src/xlifftextedit.cpp:645 src/catalog/cmd.cpp:420
 msgctxt "@item Undo action item"
@@ -2065,24 +2069,24 @@
 #: src/xlifftextedit.cpp:1036 src/xlifftextedit.cpp:1095
 msgctxt "@item Undo action item"
 msgid "Replace text"
-msgstr ""
+msgstr "استبدل النصّ"
 
 #: src/xlifftextedit.cpp:1242
 msgctxt "@item Undo action item"
 msgid "Copy source to target"
-msgstr ""
+msgstr "انسخ المصدر إلى الهدف"
 
 #: src/catalog/catalog.cpp:74
 msgid "New"
-msgstr ""
+msgstr "جديد"
 
 #: src/catalog/catalog.cpp:74
 msgid "Needs translation"
-msgstr ""
+msgstr "يحتاج إلى ترجمة"
 
 #: src/catalog/catalog.cpp:74
 msgid "Needs full localization"
-msgstr ""
+msgstr "يحتاج ترجمة كاملة"
 
 #: src/catalog/catalog.cpp:74
 msgid "Needs adaptation"
@@ -2090,11 +2094,11 @@
 
 #: src/catalog/catalog.cpp:74
 msgid "Translated"
-msgstr ""
+msgstr "مترجَم"
 
 #: src/catalog/catalog.cpp:75
 msgid "Needs translation review"
-msgstr ""
+msgstr "يحتاج لمراجعة الترجمة"
 
 #: src/catalog/catalog.cpp:75
 msgid "Needs full localization review"
@@ -2106,7 +2110,7 @@
 
 #: src/catalog/catalog.cpp:75
 msgid "Final"
-msgstr ""
+msgstr "النهائي"
 
 #: src/catalog/catalog.cpp:76
 msgid "Signed-off"
@@ -2115,22 +2119,22 @@
 #: src/catalog/catalogstring.cpp:72
 msgctxt "XLIFF inline tag name"
 msgid "Start of paired tag"
-msgstr ""
+msgstr "بداية وسم مزدوج"
 
 #: src/catalog/catalogstring.cpp:73
 msgctxt "XLIFF inline tag name"
 msgid "End of paired tag"
-msgstr ""
+msgstr "نهاية وسم مزدوج"
 
 #: src/catalog/catalogstring.cpp:74
 msgctxt "XLIFF inline tag name"
 msgid "Stand-alone tag"
-msgstr ""
+msgstr "وسم مفرد"
 
 #: src/catalog/catalogstring.cpp:75
 msgctxt "XLIFF inline tag name"
 msgid "Isolated tag"
-msgstr ""
+msgstr "وسم معزول"
 
 #: src/catalog/catalogstring.cpp:77
 msgctxt "XLIFF inline tag name"
@@ -2155,17 +2159,17 @@
 #: src/catalog/catalogstring.cpp:82
 msgctxt "XLIFF inline tag name"
 msgid "Start of paired placeholder"
-msgstr ""
+msgstr "بداية حافظ مكان مزدوج"
 
 #: src/catalog/catalogstring.cpp:83
 msgctxt "XLIFF inline tag name"
 msgid "End of paired placeholder"
-msgstr ""
+msgstr "نهاية حافظ مكان مزدوج"
 
 #: src/catalog/catalogstring.cpp:131
 msgctxt "XLIFF mark type"
 msgid "abbreviation"
-msgstr ""
+msgstr "اختصار"
 
 #: src/catalog/catalogstring.cpp:132
 msgctxt "XLIFF mark type"
@@ -2215,7 +2219,7 @@
 #: src/catalog/catalogstring.cpp:138
 msgctxt "XLIFF mark type"
 msgid "date and/or time"
-msgstr ""
+msgstr "التاريخ و/أو الوقت"
 
 #: src/catalog/catalogstring.cpp:139
 msgctxt "XLIFF mark type"
@@ -2285,7 +2289,7 @@
 #: src/catalog/catalogstring.cpp:148
 msgctxt "XLIFF mark type"
 msgid "name"
-msgstr ""
+msgstr "اسم"
 
 #: src/catalog/catalogstring.cpp:149
 msgctxt "XLIFF mark type"
@@ -2305,7 +2309,7 @@
 #: src/catalog/catalogstring.cpp:151
 msgctxt "XLIFF mark type"
 msgid "phrase"
-msgstr ""
+msgstr "عِبارة"
 
 #: src/catalog/catalogstring.cpp:152
 msgctxt "XLIFF mark type"
@@ -2318,7 +2322,7 @@
 #: src/catalog/catalogstring.cpp:153
 msgctxt "XLIFF mark type"
 msgid "protected: the marked text should not be translated"
-msgstr ""
+msgstr "محميّ: النصّ المعلّم يجب أن لا يترجم"
 
 #: src/catalog/catalogstring.cpp:154
 msgctxt "XLIFF mark type"
@@ -2330,7 +2334,7 @@
 #: src/catalog/catalogstring.cpp:155
 msgctxt "XLIFF mark type"
 msgid "segment: the marked text represents a segment"
-msgstr ""
+msgstr "جزء: النصّ المعلّم يمثّل جزءاً"
 
 #: src/catalog/catalogstring.cpp:156
 msgctxt "XLIFF mark type"
@@ -2381,7 +2385,7 @@
 #: src/catalog/catalogstring.cpp:163
 msgctxt "XLIFF mark type"
 msgid "term"
-msgstr ""
+msgstr "مصطلح"
 
 #: src/catalog/catalogstring.cpp:164
 msgctxt "XLIFF mark type"
@@ -2410,17 +2414,17 @@
 #: src/catalog/catalogstring.cpp:167
 msgctxt "XLIFF mark type"
 msgid "variant: one of the alternate forms of a term"
-msgstr ""
+msgstr "بديل: أحد الأشكال البديلة لمصطلح"
 
 #: src/catalog/cmd.cpp:94
 msgctxt "@item Undo action item"
 msgid "Insertion"
-msgstr ""
+msgstr "الإدراج"
 
 #: src/catalog/cmd.cpp:128
 msgctxt "@item Undo action item"
 msgid "Deletion"
-msgstr ""
+msgstr "الحذف"
 
 #: src/catalog/cmd.cpp:183
 msgctxt "@item Undo action item"
@@ -2430,7 +2434,7 @@
 #: src/catalog/cmd.cpp:201
 msgctxt "@item Undo action item"
 msgid "Markup Insertion"
-msgstr ""
+msgstr "إدراج وسم"
 
 #: src/catalog/cmd.cpp:223
 msgctxt "@item Undo action item"
@@ -2440,12 +2444,12 @@
 #: src/catalog/cmd.cpp:244
 msgctxt "@item Undo action item"
 msgid "Note setting"
-msgstr ""
+msgstr "تحديد ملاحظة"
 
 #: src/catalog/cmd.cpp:278
 msgctxt "@item Undo action item"
 msgid "Update/add workflow phase"
-msgstr ""
+msgstr "إضافة/تحديث طور في مسار العمل"
 
 #: src/catalog/cmd.cpp:299
 msgctxt "@item Undo action item"
@@ -2460,12 +2464,12 @@
 #: src/cataloglistview/cataloglistview.cpp:67
 msgctxt "@title:window aka Message Tree"
 msgid "Translation Units"
-msgstr ""
+msgstr "وحدات الترجمة"
 
 #: src/cataloglistview/cataloglistview.cpp:84
 #: src/glossary/glossarywindow.cpp:236 src/project/projecttab.cpp:60
 msgid "Quick search..."
-msgstr ""
+msgstr "البحث السريع..."
 
 #: src/cataloglistview/cataloglistview.cpp:85 src/project/projecttab.cpp:61
 msgctxt "@info:tooltip"
@@ -2479,7 +2483,7 @@
 
 #: src/cataloglistview/cataloglistview.cpp:94
 msgid "options"
-msgstr ""
+msgstr "خيارات"
 
 #: src/cataloglistview/cataloglistview.cpp:184
 msgid "Reset individual filter"
@@ -2487,32 +2491,32 @@
 
 #: src/cataloglistview/cataloglistview.cpp:192
 msgid "Ready"
-msgstr ""
+msgstr "جاهز"
 
 #: src/cataloglistview/cataloglistview.cpp:193
 msgid "Non-ready"
-msgstr ""
+msgstr "غير جاهز"
 
 #: src/cataloglistview/cataloglistview.cpp:194
 msgid "Non-empty"
-msgstr ""
+msgstr "غيرفارغ"
 
 #: src/cataloglistview/cataloglistview.cpp:195
 msgid "Empty"
-msgstr ""
+msgstr "فارغ"
 
 #: src/cataloglistview/cataloglistview.cpp:196
 msgid "Changed since file open"
-msgstr ""
+msgstr "تغيّر منذ فتح الملف"
 
 #: src/cataloglistview/cataloglistview.cpp:197
 msgid "Unchanged since file open"
-msgstr ""
+msgstr "لم يتغيّر منذ فتح الملف"
 
 #: src/cataloglistview/cataloglistview.cpp:202
 msgctxt "@title:inmenu"
 msgid "Basic"
-msgstr ""
+msgstr "أساسيّ"
 
 #: src/cataloglistview/cataloglistview.cpp:203
 msgctxt "@title:inmenu"
@@ -2527,39 +2531,39 @@
 #: src/cataloglistview/cataloglistview.cpp:224
 msgctxt "@item:inmenu all columns"
 msgid "All"
-msgstr ""
+msgstr "الكلّ"
 
 #: src/cataloglistview/catalogmodel.cpp:101
 msgctxt "@title:column"
 msgid "Entry"
-msgstr ""
+msgstr "المدخلة"
 
 #: src/cataloglistview/catalogmodel.cpp:102 src/glossary/glossary.cpp:227
 #: src/tm/tmtab.cpp:79
 msgctxt "@title:column Original text"
 msgid "Source"
-msgstr ""
+msgstr "المصدر"
 
 #: src/cataloglistview/catalogmodel.cpp:103 src/glossary/glossary.cpp:228
 #: src/tm/tmtab.cpp:80
 msgctxt "@title:column Text in target language"
 msgid "Target"
-msgstr ""
+msgstr "الهدف"
 
 #: src/cataloglistview/catalogmodel.cpp:104
 msgctxt "@title:column"
 msgid "Notes"
-msgstr ""
+msgstr "الملاحظات"
 
 #: src/cataloglistview/catalogmodel.cpp:105 src/tm/tmtab.cpp:83
 msgctxt "@title:column"
 msgid "Translation Status"
-msgstr ""
+msgstr "حالة الترجمة"
 
 #: src/common/termlabel.cpp:99
 msgctxt "@action:inmenu Edit term"
 msgid "Edit"
-msgstr ""
+msgstr "حرّر"
 
 #: src/glossary/glossary.cpp:229
 msgctxt "@title:column"
@@ -2571,7 +2575,7 @@
 #: src/glossary/glossarywindow.cpp:437 src/glossary/glossarywindow.cpp:456
 msgctxt "@title:window"
 msgid "Glossary"
-msgstr ""
+msgstr "المُسْرد"
 
 #: src/glossary/glossaryview.cpp:81
 msgctxt "@info:tooltip"
@@ -2590,7 +2594,7 @@
 #: src/glossary/glossarywindow.cpp:255
 msgctxt "@info:tooltip"
 msgid "Reload glossary from disk, discarding any changes"
-msgstr ""
+msgstr "تحميل المسرد من القرص وإبطال كلّ التغييرات"
 
 #: src/glossary/glossarywindow.cpp:477
 msgctxt "@info"
@@ -2598,30 +2602,32 @@
 "The glossary contains unsaved changes.\n"
 "Do you want to save your changes or discard them?"
 msgstr ""
+"يحتوي المسرد على تغييرات غير  محفوظة.\n"
+"أتريد حفظ التغييرات أم  تجاهلها؟"
 
 #: src/mergemode/mergecatalog.cpp:257
 msgctxt "@item Undo action item"
 msgid "Accept change in translation"
-msgstr ""
+msgstr "اقبل تغييرات الترجمة"
 
 #: src/mergemode/mergecatalog.cpp:312
 msgctxt "@item Undo action item"
 msgid "Accept all new translations"
-msgstr ""
+msgstr "اقبل كلّ الترجمات الجديدة"
 
 #: src/mergemode/mergeview.cpp:46 src/mergemode/mergeview.cpp:51
 msgctxt ""
 "@title:window that displays difference between current file and 'merge "
 "source'"
 msgid "Primary Sync"
-msgstr ""
+msgstr "المزامنة الرئيسيّة"
 
 #: src/mergemode/mergeview.cpp:46 src/mergemode/mergeview.cpp:52
 msgctxt ""
 "@title:window that displays difference between current file and 'merge "
 "source'"
 msgid "Secondary Sync"
-msgstr ""
+msgstr "المزامنة الثانويّة"
 
 #: src/mergemode/mergeview.cpp:60
 msgctxt "@info:tooltip"
@@ -2647,27 +2653,27 @@
 #: src/prefs/prefs.cpp:112
 msgctxt "@title:tab"
 msgid "Identity"
-msgstr ""
+msgstr "الهويّة"
 
 #: src/prefs/prefs.cpp:118
 msgctxt "@title:tab"
 msgid "Editing"
-msgstr ""
+msgstr "التحرير"
 
 #: src/prefs/prefs.cpp:124
 msgctxt "@title:tab"
 msgid "Appearance"
-msgstr ""
+msgstr "المظهر"
 
 #: src/prefs/prefs.cpp:130
 msgctxt "@title:tab"
 msgid "Translation Memory"
-msgstr ""
+msgstr "ذاكرة الترجمة"
 
 #: src/prefs/prefs.cpp:139
 msgctxt "@title:tab"
 msgid "Spellcheck"
-msgstr ""
+msgstr "دقِّق إملائيًّا"
 
 #: src/prefs/prefs.cpp:185
 msgid ""
@@ -2678,12 +2684,12 @@
 #: src/prefs/prefs.cpp:186
 msgctxt "@action"
 msgid "New"
-msgstr ""
+msgstr "جديد"
 
 #: src/prefs/prefs.cpp:186
 msgctxt "@action"
 msgid "Open"
-msgstr ""
+msgstr "افتح"
 
 #: src/prefs/prefs.cpp:215
 msgid "*.lokalize|Lokalize translation project"
@@ -2692,27 +2698,27 @@
 #: src/prefs/prefs.cpp:241
 msgctxt "@title:tab"
 msgid "General"
-msgstr ""
+msgstr "عامّ"
 
 #: src/prefs/prefs.cpp:283
 msgctxt "@title:tab"
 msgid "Advanced"
-msgstr ""
+msgstr "متقدّم"
 
 #: src/prefs/prefs.cpp:302
 msgctxt "@title:tab"
 msgid "Scripts"
-msgstr ""
+msgstr "نصوص برمجيّة"
 
 #: src/prefs/prefs.cpp:308
 msgctxt "@title:tab"
 msgid "Personal"
-msgstr ""
+msgstr "شخصيّ"
 
 #: src/project/projectmodel.cpp:520
 msgctxt "@title:column File name"
 msgid "Name"
-msgstr ""
+msgstr "الاسم"
 
 #: src/project/projectmodel.cpp:521
 msgctxt ""
@@ -2724,62 +2730,62 @@
 #: src/project/projectmodel.cpp:522
 msgctxt "@title:column Number of entries"
 msgid "Total"
-msgstr ""
+msgstr "المجموع"
 
 #: src/project/projectmodel.cpp:523
 msgctxt "@title:column Number of entries"
 msgid "Translated"
-msgstr ""
+msgstr "مترجَم"
 
 #: src/project/projectmodel.cpp:524
 msgctxt "@title:column Number of entries"
 msgid "Not ready"
-msgstr ""
+msgstr "غيرجاهز"
 
 #: src/project/projectmodel.cpp:525
 msgctxt "@title:column Number of entries"
 msgid "Untranslated"
-msgstr ""
+msgstr "غير مترجم"
 
 #: src/project/projectmodel.cpp:526
 msgctxt "@title:column"
 msgid "Last Translation"
-msgstr ""
+msgstr "آخر ترجمة"
 
 #: src/project/projectmodel.cpp:527
 msgctxt "@title:column"
 msgid "Template Revision"
-msgstr ""
+msgstr "مراجعة القالب"
 
 #: src/project/projectmodel.cpp:528
 msgctxt "@title:column"
 msgid "Last Translator"
-msgstr ""
+msgstr "آخر مترجِم"
 
 #: src/project/projecttab.cpp:54
 msgctxt "@title:window"
 msgid "Project Overview"
-msgstr ""
+msgstr "عرض عام للمشروع"
 
 #: src/project/projecttab.cpp:115
 msgctxt "@action:inmenu"
 msgid "Previous template only"
-msgstr ""
+msgstr "القالب السابق فقطغير المترجم السابق"
 
 #: src/project/projecttab.cpp:118
 msgctxt "@action:inmenu"
 msgid "Next template only"
-msgstr ""
+msgstr "القالب التالي فقط"
 
 #: src/project/projecttab.cpp:121
 msgctxt "@action:inmenu"
 msgid "Previous translation only"
-msgstr ""
+msgstr "الترجمة السابقة فقط"
 
 #: src/project/projecttab.cpp:124
 msgctxt "@action:inmenu"
 msgid "Next translation only"
-msgstr ""
+msgstr "الترجمة التالية فقط"
 
 #: src/project/projecttab.cpp:174
 msgctxt "@action:inmenu"
@@ -2789,57 +2795,57 @@
 #: src/project/projecttab.cpp:183
 msgctxt "@action:inmenu"
 msgid "Add to translation memory"
-msgstr ""
+msgstr "أضف إلى ذاكرة الترجمة"
 
 #: src/tm/dbfilesmodel.cpp:105
 msgctxt "@title:column"
 msgid "Name"
-msgstr ""
+msgstr "الا&سم"
 
 #: src/tm/dbfilesmodel.cpp:106
 msgctxt "@title:column"
 msgid "Source language"
-msgstr ""
+msgstr "اللغة المصدر"
 
 #: src/tm/dbfilesmodel.cpp:107
 msgctxt "@title:column"
 msgid "Target language"
-msgstr ""
+msgstr "اللعة الهدف:"
 
 #: src/tm/dbfilesmodel.cpp:108
 msgctxt "@title:column"
 msgid "Pairs"
-msgstr ""
+msgstr "أزواج"
 
 #: src/tm/dbfilesmodel.cpp:109
 msgctxt "@title:column"
 msgid "Unique original entries"
-msgstr ""
+msgstr "المدخلات الأصليّة الفريدة"
 
 #: src/tm/dbfilesmodel.cpp:110
 msgctxt "@title:column"
 msgid "Unique translations"
-msgstr ""
+msgstr "الترجمات الفريدة"
 
 #: src/tm/tmmanager.cpp:57
 msgctxt "@title:window"
 msgid "Translation Memories"
-msgstr ""
+msgstr "ذاكرة الترجمة"
 
 #: src/tm/tmmanager.cpp:88
 msgctxt "@title:window"
 msgid "Select Directory to be scanned"
-msgstr ""
+msgstr "اختر  مجلدًا لليُفحَص"
 
 #: src/tm/tmmanager.cpp:112
 msgctxt "@title:window"
 msgid "New Translation Memory"
-msgstr ""
+msgstr "ذاكرة الترجمة الجديدة"
 
 #: src/tm/tmmanager.cpp:103
 msgctxt "@title:window"
 msgid "Translation Memory Properties"
-msgstr ""
+msgstr "خصائص ذاكرة الترجمة"
 
 #: src/tm/tmmanager.cpp:165 src/tm/tmmanager.cpp:188
 msgid ""
@@ -2868,12 +2874,12 @@
 #: src/tm/tmtab.cpp:81
 msgctxt "@title:column"
 msgid "Context"
-msgstr ""
+msgstr "السياق"
 
 #: src/tm/tmtab.cpp:82
 msgctxt "@title:column"
 msgid "File"
-msgstr ""
+msgstr "ملف"
 
 #: src/tm/tmtab.cpp:287 src/tm/tmview.cpp:147 src/tm/tmview.cpp:152
 msgctxt "@title:window"
@@ -2882,20 +2888,20 @@
 
 #: src/tm/tmtab.cpp:312
 msgid "Copy source to clipboard"
-msgstr ""
+msgstr "انسخ المصدر إلى الحافظة"
 
 #: src/tm/tmtab.cpp:318
 msgid "Copy target to clipboard"
-msgstr ""
+msgstr "انسخ الهدف إلى الحافظة"
 
 #: src/tm/tmtab.cpp:324
 msgid "Open file"
-msgstr ""
+msgstr "افتح ملفًا"
 
 #: src/tm/tmview.cpp:189 src/webquery/webqueryview.cpp:107
 msgctxt "@info:tooltip"
 msgid "Double-click any word to insert it into translation"
-msgstr ""
+msgstr "انقر مزدوجة على أيّ كلمة لإدراجها في الترجمة"
 
 #: src/tm/tmview.cpp:307
 msgctxt "@item Undo action"
@@ -2910,7 +2916,7 @@
 #: src/tm/tmview.cpp:317
 msgctxt "@info"
 msgid "No suggestions with exact matches were found."
-msgstr ""
+msgstr "لم يتم إيجاد أيّ اقتراحات متطابقة."
 
 #: src/tm/tmview.cpp:321
 msgctxt "@title"
@@ -2930,25 +2936,25 @@
 #: src/tm/tmview.cpp:564
 msgctxt "File argument in tooltip, when file is current file"
 msgid "this"
-msgstr ""
+msgstr "هذا"
 
 #: src/tm/tmview.cpp:565
 #, kde-format
 msgctxt "@info:tooltip"
 msgid "File: %1<br />Addition date: %2"
-msgstr ""
+msgstr "الملف: %1<br />تاريخ إضافيّ: %2"
 
 #: src/tm/tmview.cpp:567
 #, kde-format
 msgctxt "@info:tooltip on TM entry continues"
 msgid "<br />Last change date: %1"
-msgstr ""
+msgstr "<br />تاريخ التعديل الأخير: %1"
 
 #: src/tm/tmview.cpp:569
 #, kde-format
 msgctxt "@info:tooltip on TM entry continues"
 msgid "<br />Last change author: %1"
-msgstr ""
+msgstr "<br />مؤلّف آخر تعديل: %1"
 
 #: src/tm/tmview.cpp:566
 #, kde-format
@@ -2959,17 +2965,17 @@
 #: src/tm/tmview.cpp:568
 msgctxt "@info:tooltip on TM entry continues"
 msgid "<br />Is not present in the file anymore"
-msgstr ""
+msgstr "<br />لم يعد موجوداً في الملف"
 
 #: src/tm/tmview.cpp:586
 msgctxt "@action:inmenu"
 msgid "Remove this entry"
-msgstr ""
+msgstr "أزل هذه المدخلة"
 
 #: src/tm/tmview.cpp:588
 msgctxt "@action:inmenu"
 msgid "Open file containing this entry"
-msgstr ""
+msgstr "افتح ملفًّا يحوي هذه المدخلة"
 
 #: src/tm/tmview.cpp:593
 #, kde-format
@@ -2981,32 +2987,32 @@
 #: src/tm/tmview.cpp:594
 msgctxt "@title:window"
 msgid "Translation Memory Entry Removal"
-msgstr ""
+msgstr "إزالة مدخلة من ذاكرة الترجمة"
 
 #: src/tm/tmview.cpp:987
 msgctxt "@item Undo action"
 msgid "Use translation memory suggestion"
-msgstr ""
+msgstr "استخدم اقتراح ذاكرة الترجمة"
 
 #: src/webquery/webqueryview.cpp:65
 msgid "Web Queries"
-msgstr ""
+msgstr "استعلامات الشنكبوتية"
 
 #: scripts/msgmerge.py:33
 msgid "Gettext not found"
-msgstr ""
+msgstr "Gettext غير موجود"
 
 #: scripts/msgmerge.py:33
 msgid "Install gettext package for this feature to work"
-msgstr ""
+msgstr "ثبّت حزمة gettext لتعمل هذه الخاصّيّة"
 
 #: scripts/msgmerge.py:44
 msgid "Updating from templates..."
-msgstr ""
+msgstr "يحدّث من القوالب..."
 
 #: scripts/msgmerge.py:71
 msgid "Merge has been completed"
-msgstr ""
+msgstr "اكتمل الدمج"
 
 #: scripts/msgmerge.py:71
 msgid ""
@@ -3016,7 +3022,7 @@
 
 #: scripts/msgmerge.py:74
 msgid "Merge failed."
-msgstr ""
+msgstr "فشل الدمج"
 
 #: scripts/msgmerge.py:74
 msgid ""
@@ -3032,27 +3038,27 @@
 
 #: scripts/newprojectwizard.py:133
 msgid "What do you want to do?"
-msgstr ""
+msgstr "ماذا تريد ان تفعل؟"
 
 #: scripts/newprojectwizard.py:134
 msgid "Identify the kind of project you want:"
-msgstr ""
+msgstr "حدّد نوع المشروع الذي تريده"
 
 #: scripts/newprojectwizard.py:136
 msgid "Translate a document"
-msgstr ""
+msgstr "ترجم مستنداً"
 
 #: scripts/newprojectwizard.py:138
 msgid "Translate application interface"
-msgstr ""
+msgstr "ترجم واجهة تطبيق"
 
 #: scripts/newprojectwizard.py:158
 msgid "Choose a document to be translated"
-msgstr ""
+msgstr "اختر مستنداً ليُتَرجَم"
 
 #: scripts/newprojectwizard.py:159
 msgid "Choose document in a source language."
-msgstr ""
+msgstr "اختر مستنداً بلغةٍ مصدر."
 
 #: scripts/newprojectwizard.py:161
 msgid "Select file:"
@@ -3060,32 +3066,32 @@
 
 #: scripts/newprojectwizard.py:168
 msgid "Select a folder:"
-msgstr ""
+msgstr "اختر  مجلدًا:"
 
 #: scripts/newprojectwizard.py:202
 msgid "Choose project name and location"
-msgstr ""
+msgstr "اختر اسماً ومكاناً للمشروع"
 
 #: scripts/newprojectwizard.py:203
 msgid ""
 "If you choose custom paths then the source files will be copied to it."
-msgstr ""
+msgstr "إذا استخدمت مسارات مخصّصة فسيتمّ نسخ الملفات المصدر إليه."
 
 #: scripts/newprojectwizard.py:206
 msgid "Use initial source dir, generate name automatically"
-msgstr ""
+msgstr "استخدم مجلد البداية للمصدر، ولّد الاسم آليًّا"
 
 #: scripts/newprojectwizard.py:209
 msgid "Custom paths"
-msgstr ""
+msgstr "مسارات مخصّصة"
 
 #: scripts/newprojectwizard.py:216
 msgid "Location:"
-msgstr ""
+msgstr "المكان:"
 
 #: scripts/newprojectwizard.py:262
 msgid "Choose source and target languages"
-msgstr ""
+msgstr "اختر لغة المصدر والهدف"
 
 #: scripts/newprojectwizard.py:263
 msgid "Click on a combobox then start typing the name of the language."
@@ -3101,7 +3107,7 @@
 
 #: scripts/newprojectwizard.py:299
 msgid "KDE"
-msgstr ""
+msgstr "كدي"
 
 #: scripts/newprojectwizard.py:316
 msgid "Choose location of your software translation project"
@@ -3115,7 +3121,7 @@
 
 #: scripts/newprojectwizard.py:319
 msgid "Existing:"
-msgstr ""
+msgstr "موجود:"
 
 #: scripts/newprojectwizard.py:323
 msgid ""
@@ -3127,6 +3133,8 @@
 "Get from svn repository\n"
 "(approx. 20 MB):"
 msgstr ""
+"احصل عليها من مستودع svn\n"
+"(حوالي 20ميجا):"
 
 #: scripts/newprojectwizard.py:343
 msgid "Local download folder (will/does contain trunk/l10n-kde4/...)"
@@ -3140,7 +3148,7 @@
 
 #: scripts/newprojectwizard.py:386
 msgid "Subversion client not found"
-msgstr ""
+msgstr "لم يتم العثور على عميل subversion"
 
 #: scripts/widget-text-capture.py:17 scripts/widget-text-capture.py:20
 msgid "Widget Text Capture"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/lskat.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/lskat.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/lskat.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/lskat.po	2012-03-23 06:41:39.000000000 +0000
@@ -3,22 +3,23 @@
 #
 # Isam Bayazidi <bayazidi@arabeyes.org>, 2002.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: lskat\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 04:39+0000\n"
-"PO-Revision-Date: 2012-01-25 07:26+0000\n"
-"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
+"PO-Revision-Date: 2012-03-12 22:56+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 19:57+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:54+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: \n"
 
 #: config_two.cpp:45
 msgctxt "Default player name"
@@ -219,7 +220,7 @@
 
 #: main.cpp:88
 msgid "Run game in demo (autoplay) mode"
-msgstr "شغل اللعبة في النمط الإستعراضي ( تشغيل تلقائي)"
+msgstr "شغل اللعبة في النمط الاستعراضي (لعب تلقائي)"
 
 #: mainwindow.cpp:103
 msgid "Installation error: No theme list found."
@@ -347,13 +348,13 @@
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
 msgstr ""
-"Mohamed SAAD محمد سعد,زايد السعيدي, ,Launchpad Contributions:,abd el rahman "
-"Ghareeb"
+"Mohamed SAAD محمد سعد,زايد السعيدي, ,Launchpad Contributions:,Abdalrahim G. "
+"Fakhouri,abd el rahman Ghareeb"
 
 #: rc.cpp:29
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "metehyi@free.fr,zayed.alsaidi@gmail.com,,,"
+msgstr "metehyi@free.fr,zayed.alsaidi@gmail.com,,,,"
 
 #. i18n: file: lskatui.rc:10
 #. i18n: ectx: Menu (game)
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/marble.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/marble.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/marble.po	2012-02-23 06:20:18.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/marble.po	2012-03-23 06:41:49.000000000 +0000
@@ -9,14 +9,14 @@
 "Project-Id-Version: marble\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 13:17+0000\n"
-"PO-Revision-Date: 2012-01-25 11:02+0000\n"
+"PO-Revision-Date: 2012-03-12 23:09+0000\n"
 "Last-Translator: Ali S AlNoaimi <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:25+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:30+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: src/kdemain.cpp:63
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/messageviewer_text_calendar_plugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/messageviewer_text_calendar_plugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/messageviewer_text_calendar_plugin.po	2012-02-23 06:20:11.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/messageviewer_text_calendar_plugin.po	2012-03-23 06:41:42.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:44+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:21+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: text_calendar.cpp:394
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/messageviewer_text_vcard_plugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/messageviewer_text_vcard_plugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/messageviewer_text_vcard_plugin.po	2012-02-23 06:20:11.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/messageviewer_text_vcard_plugin.po	2012-03-23 06:41:42.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:45+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:21+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: text_vcard.cpp:82
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/mf_konqplugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/mf_konqplugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/mf_konqplugin.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/mf_konqplugin.po	2012-03-23 06:42:00.000000000 +0000
@@ -17,8 +17,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:50+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:26+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: konqmficon.cpp:267
 msgid "Microformats"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/minitoolsplugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/minitoolsplugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/minitoolsplugin.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/minitoolsplugin.po	2012-03-23 06:42:00.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:51+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:26+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: minitoolsplugin.cpp:50
 msgid "&Minitools"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/mplayerthumbsconfig.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/mplayerthumbsconfig.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/mplayerthumbsconfig.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/mplayerthumbsconfig.po	2012-03-23 06:41:40.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:07+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:58+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: main.cpp:30 main.cpp:36
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/mplayerthumbs.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/mplayerthumbs.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/mplayerthumbs.po	2012-02-23 06:20:08.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/mplayerthumbs.po	2012-03-23 06:41:40.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:07+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 18:58+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: rc.cpp:16
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/nepomukbackup.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/nepomukbackup.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/nepomukbackup.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/nepomukbackup.po	2012-03-23 06:41:58.000000000 +0000
@@ -15,9 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:19+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:07+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: main.cpp:40 guitest/main.cpp:37
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/nepomukcontroller.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/nepomukcontroller.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/nepomukcontroller.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/nepomukcontroller.po	2012-03-23 06:41:58.000000000 +0000
@@ -7,15 +7,14 @@
 "Project-Id-Version: \n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:42+0000\n"
+"PO-Revision-Date: 2012-03-12 22:38+0000\n"
 "Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:19+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:08+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: main.cpp:32
@@ -65,9 +64,9 @@
 #: rc.cpp:1
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
-msgstr "عبدالرحيم الفاخوري, ,Launchpad Contributions:,Abdalrahim G. Fakhouri"
+msgstr "عبدالرحيم الفاخوري, ,Launchpad Contributions:"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
-msgstr "abdilra7eem@yahoo.com,,,"
+msgstr "abdilra7eem@yahoo.com,,"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/nepomukqueryservice.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/nepomukqueryservice.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/nepomukqueryservice.po	2012-02-23 06:20:26.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/nepomukqueryservice.po	2012-03-23 06:41:58.000000000 +0000
@@ -9,15 +9,14 @@
 "Project-Id-Version: nepomuk\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-26 00:07+0000\n"
+"PO-Revision-Date: 2012-03-14 01:02+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:20+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:08+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: queryservice.cpp:98
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/nepomukserver.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/nepomukserver.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/nepomukserver.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/nepomukserver.po	2012-03-23 06:41:59.000000000 +0000
@@ -1,22 +1,23 @@
 # translation of nepomuk.po to Arabic
 # Copyright (C) YEAR This_file_is_part_of_KDE
 # This file is distributed under the same license as the PACKAGE package.
+#
 # zayed <zayed.alsaidi@gmail.com>, 2008, 2009.
 # Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-#
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: nepomuk\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:43+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-12 22:37+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:21+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:08+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: main.cpp:89
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/nepomukservicestub.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/nepomukservicestub.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/nepomukservicestub.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/nepomukservicestub.po	2012-03-23 06:41:59.000000000 +0000
@@ -1,22 +1,23 @@
 # translation of nepomuk.po to Arabic
 # Copyright (C) YEAR This_file_is_part_of_KDE
 # This file is distributed under the same license as the PACKAGE package.
+#
 # zayed <zayed.alsaidi@gmail.com>, 2008, 2009.
 # Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-#
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: nepomuk\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:39+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-12 22:39+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:21+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:08+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: main.cpp:70 main.cpp:72
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/nepomukstorage.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/nepomukstorage.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/nepomukstorage.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/nepomukstorage.po	2012-03-23 06:41:59.000000000 +0000
@@ -9,14 +9,14 @@
 "Project-Id-Version: nepomuk\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:44+0000\n"
+"PO-Revision-Date: 2012-03-12 22:38+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:22+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:09+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: ontologyloader.cpp:117
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/nepomukstrigiservice.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/nepomukstrigiservice.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/nepomukstrigiservice.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/nepomukstrigiservice.po	2012-03-23 06:41:59.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:22+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:09+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: strigiservice.cpp:159
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/nsplugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/nsplugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/nsplugin.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/nsplugin.po	2012-03-23 06:42:00.000000000 +0000
@@ -8,22 +8,21 @@
 # Munzir Taha <munzir@kacst.edu.sa>, 2004.
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: nsplugin\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2012-01-25 11:02+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-14 17:22+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:52+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Poedit-Language: Arabic\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:27+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: nspluginloader.cpp:91
 msgid "Start Plugin"
@@ -31,7 +30,7 @@
 
 #: plugin_part.cpp:170
 msgid "Netscape Plugin"
-msgstr ""
+msgstr "ملحق نيتسكيب"
 
 #: plugin_part.cpp:220
 msgid "&Save As..."
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/oktetapart.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/oktetapart.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/oktetapart.po	2012-02-23 06:20:11.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/oktetapart.po	2012-03-23 06:41:43.000000000 +0000
@@ -11,14 +11,14 @@
 "Project-Id-Version: oktetapart\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 16:09+0000\n"
-"PO-Revision-Date: 2012-01-25 11:17+0000\n"
+"PO-Revision-Date: 2012-03-12 23:01+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:57+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:27+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: partfactory.cpp:40
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okteta.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okteta.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okteta.po	2012-02-23 06:20:11.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okteta.po	2012-03-23 06:41:43.000000000 +0000
@@ -1,22 +1,23 @@
 # Copyright (C) YEAR This_file_is_part_of_KDE
 # This file is distributed under the same license as the PACKAGE package.
+#
 # Youness BOUTYOUR <niceboy@linuxac.org>, 2008.
 # Youness BOUTYOUR <niceboy120@gmail.com>, 2008.
 # Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-#
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: okteta\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 16:09+0000\n"
-"PO-Revision-Date: 2012-01-25 11:18+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-12 23:01+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:57+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:26+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: about.cpp:40
@@ -25,7 +26,7 @@
 
 #: about.cpp:41
 msgid "Hex editor"
-msgstr ""
+msgstr "محرّر ستّ-عشريّ"
 
 #: about.cpp:43
 msgid "Copyright 2006-2011 Friedrich W. H. Kossebau"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_chm.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_chm.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_chm.po	2012-02-23 06:20:18.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_chm.po	2012-03-23 06:41:49.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:29+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:33+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: generator_chm.cpp:38
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_comicbook.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_comicbook.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_comicbook.po	2012-02-23 06:20:18.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_comicbook.po	2012-03-23 06:41:49.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:30+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:33+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: generator_comicbook.cpp:27
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_djvu.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_djvu.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_djvu.po	2012-02-23 06:20:18.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_djvu.po	2012-03-23 06:41:49.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:31+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:33+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: generator_djvu.cpp:74
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_dvi.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_dvi.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_dvi.po	2012-02-23 06:20:18.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_dvi.po	2012-03-23 06:41:49.000000000 +0000
@@ -11,14 +11,14 @@
 "Project-Id-Version: okular_dvi\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:24+0000\n"
-"PO-Revision-Date: 2012-01-25 10:56+0000\n"
+"PO-Revision-Date: 2012-03-12 22:23+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:31+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:33+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: dviexport.cpp:74
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_epub.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_epub.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_epub.po	2012-02-23 06:20:18.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_epub.po	2012-03-23 06:41:49.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:32+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:33+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: converter.cpp:108
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_fax.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_fax.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_fax.po	2012-02-23 06:20:18.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_fax.po	2012-03-23 06:41:49.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:32+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:34+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: generator_fax.cpp:28
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_fictionbook.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_fictionbook.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_fictionbook.po	2012-02-23 06:20:18.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_fictionbook.po	2012-03-23 06:41:49.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:32+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:34+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: converter.cpp:98
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_ghostview.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_ghostview.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_ghostview.po	2012-02-23 06:20:18.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_ghostview.po	2012-03-23 06:41:49.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:33+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:34+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: generator_ghostview.cpp:41
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_kimgio.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_kimgio.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_kimgio.po	2012-02-23 06:20:18.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_kimgio.po	2012-03-23 06:41:49.000000000 +0000
@@ -4,29 +4,29 @@
 # This file is distributed under the same license as the PACKAGE package.
 #
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: okular_kimgio\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:24+0000\n"
-"PO-Revision-Date: 2011-08-29 01:21+0000\n"
+"PO-Revision-Date: 2012-03-12 22:23+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:33+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:34+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: generator_kimgio.cpp:33
 msgid "Image Backend"
-msgstr "نهاية خلفية الصورة"
+msgstr "محرك الصور"
 
 #: generator_kimgio.cpp:35
 msgid "A simple image backend"
-msgstr "خلفية صورة بسيطة"
+msgstr "محرك صور بسيط"
 
 #: generator_kimgio.cpp:37
 msgid ""
@@ -34,6 +34,9 @@
 "© 2006-2007 Pino Toscano\n"
 "© 2006-2007 Tobias Koenig"
 msgstr ""
+"© 2005, 2009 Albert Astals Cid\n"
+"© 2006-2007 Pino Toscano\n"
+"© 2006-2007 Tobias Koenig"
 
 #: generator_kimgio.cpp:41
 msgid "Albert Astals Cid"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_mobi.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_mobi.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_mobi.po	2012-02-23 06:20:34.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_mobi.po	2012-03-23 06:42:08.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:43+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 01:10+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: converter.cpp:54
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_ooo.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_ooo.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_ooo.po	2012-02-23 06:20:18.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_ooo.po	2012-03-23 06:41:49.000000000 +0000
@@ -5,20 +5,20 @@
 #
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # hayig2000 <hayig2000@gmail.com>, 2008.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: okular_ooo\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:24+0000\n"
-"PO-Revision-Date: 2011-08-29 01:22+0000\n"
+"PO-Revision-Date: 2012-03-12 22:23+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:33+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:34+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: generator_ooo.cpp:22
@@ -104,7 +104,7 @@
 
 #: manifest.cpp:241
 msgid "Please enter the password to read the document:"
-msgstr ""
+msgstr "رجاء أدخل كلمة السر لقراءة المستند:"
 
 #: manifest.cpp:359
 msgid ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_plucker.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_plucker.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_plucker.po	2012-02-23 06:20:18.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_plucker.po	2012-03-23 06:41:49.000000000 +0000
@@ -16,8 +16,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:34+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:35+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: generator_plucker.cpp:28
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular.po	2012-02-23 06:20:18.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular.po	2012-03-23 06:41:49.000000000 +0000
@@ -10,7 +10,7 @@
 "Project-Id-Version: okular\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:24+0000\n"
-"PO-Revision-Date: 2012-01-25 10:56+0000\n"
+"PO-Revision-Date: 2012-03-12 22:23+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
@@ -18,8 +18,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:29+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:32+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: conf/dlgpresentation.cpp:28
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_poppler.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_poppler.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_poppler.po	2012-02-23 06:20:18.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_poppler.po	2012-03-23 06:41:49.000000000 +0000
@@ -5,20 +5,20 @@
 #
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # hayig2000 <hayig2000@gmail.com>, 2008.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: okular_poppler\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:24+0000\n"
-"PO-Revision-Date: 2011-08-29 01:21+0000\n"
+"PO-Revision-Date: 2012-03-12 22:23+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:34+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:35+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: generator_pdf.cpp:64
@@ -60,7 +60,7 @@
 
 #: generator_pdf.cpp:419
 msgid "Please enter the password to read the document:"
-msgstr ""
+msgstr "رجاء أدخل كلمة السر لقراءة المستند:"
 
 #: generator_pdf.cpp:421
 msgid "Incorrect password. Try again:"
@@ -112,19 +112,19 @@
 
 #: generator_pdf.cpp:594 generator_pdf.cpp:595
 msgid "Unknown Date"
-msgstr "مجهول التاريخ"
+msgstr "التاريخ مجهول"
 
 #: generator_pdf.cpp:598
 msgid "Unknown Encryption"
-msgstr "مجهول التشفير"
+msgstr "التشفير مجهول"
 
 #: generator_pdf.cpp:599
 msgid "Unknown Optimization"
-msgstr "مجهول التحسين"
+msgstr "التحسين مجهول"
 
 #: generator_pdf.cpp:1686
 msgid "Saving files with /Encrypt is not supported."
-msgstr ""
+msgstr "حفظ الملفات بالتشفير غير مدعوم."
 
 #: rc.cpp:1
 msgctxt "NAME OF TRANSLATORS"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_tiff.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_tiff.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_tiff.po	2012-02-23 06:20:18.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_tiff.po	2012-03-23 06:41:49.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:35+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:35+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: generator_tiff.cpp:166
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_xps.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_xps.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/okular_xps.po	2012-02-23 06:20:18.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/okular_xps.po	2012-03-23 06:41:49.000000000 +0000
@@ -16,8 +16,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 23:35+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:36+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: generator_xps.cpp:47
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/parley.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/parley.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/parley.po	2012-02-23 06:20:34.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/parley.po	2012-03-23 06:42:07.000000000 +0000
@@ -11,7 +11,7 @@
 "Project-Id-Version: parley\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-08 19:48+0000\n"
-"PO-Revision-Date: 2012-01-25 07:58+0000\n"
+"PO-Revision-Date: 2012-03-12 22:04+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: <en@li.org>\n"
 "MIME-Version: 1.0\n"
@@ -19,8 +19,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:32+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 01:02+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: src/parleydocument.cpp:122 src/parleydocument.cpp:394
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/phonon_gstreamer.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/phonon_gstreamer.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/phonon_gstreamer.po	2012-02-23 06:20:24.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/phonon_gstreamer.po	2012-03-23 06:41:56.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:19+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:29+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: gstreamer/backend.cpp:193
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/phonon_kde.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/phonon_kde.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/phonon_kde.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/phonon_kde.po	2012-03-23 06:41:59.000000000 +0000
@@ -16,8 +16,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:23+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:09+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kdeplatformplugin.cpp:141
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/phononserver.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/phononserver.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/phononserver.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/phononserver.po	2012-03-23 06:41:59.000000000 +0000
@@ -4,23 +4,25 @@
 #
 # majed <gmajedli@gmail.com>, 2008.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: kded_phononserver\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:39+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-12 22:38+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:24+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:10+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: audiodeviceaccess.cpp:42
 msgid "Invalid Driver"
-msgstr "سائق غير صالح"
+msgstr "مشغّل غير صالح"
 
 #: audiodeviceaccess.cpp:44
 msgid "ALSA"
@@ -36,7 +38,7 @@
 
 #: deviceaccess.cpp:75
 msgid "Video 4 Linux"
-msgstr ""
+msgstr "نظام دعم المرئيات والعرض في لينكس Video4Linux"
 
 #: audiodevice.cpp:60
 msgid ""
@@ -64,7 +66,7 @@
 
 #: phononserver.cpp:228
 msgid "Unknown"
-msgstr ""
+msgstr "مجهول"
 
 #: phononserver.cpp:210
 #, kde-format
@@ -85,7 +87,7 @@
 #: phononserver.cpp:744
 #, kde-format
 msgid "Video: %1"
-msgstr ""
+msgstr "جهاز العرض: %1"
 
 #: phononserver.cpp:822
 msgid "Removed Sound Devices"
@@ -93,7 +95,7 @@
 
 #: phononserver.cpp:1135
 msgid "Removed Video Devices"
-msgstr ""
+msgstr "أزل أجهزة العرض"
 
 #: phononserver.cpp:828
 msgid "Forget about the sound devices."
@@ -101,7 +103,7 @@
 
 #: phononserver.cpp:1141
 msgid "Forget about the video devices"
-msgstr ""
+msgstr "تجاهل أجهزة العرض"
 
 #: phononserver.cpp:832
 msgctxt ""
@@ -114,6 +116,8 @@
 "Open the System Settings page for device configuration where you can "
 "manually remove disconnected devices from the cache."
 msgstr ""
+"إفتح صفحة إعدادات النظام لإعداد الأجهزة لتستطيع إزالة الأجهزة الغير موصلة "
+"يدوياً"
 
 #: phononserver.cpp:1154
 #, kde-format
@@ -123,6 +127,10 @@
 "devices?</b></p><p>This is the list of devices KDE thinks can be "
 "removed:<ul><li>%1</li></ul></p></html>"
 msgstr ""
+"<html><p>اكتشفت كيدي أنه تم إزالة واحد أو أكثر من الأجهزة "
+"الداخلية</p><p><b>هل تود أن تتجاهل كيدي هذه الأجهزة بشكل دائم؟</b></p><p>هذه "
+"القائمة من الأجهزة اكتشفت كيدي أنه بالإمكان إزالتها: "
+"<ul><li>%1</li></ul></p></html>"
 
 #: phononserver.cpp:846
 msgid "Do not ask again for these devices"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_battery.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_battery.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_battery.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_battery.po	2012-03-23 06:42:04.000000000 +0000
@@ -11,14 +11,14 @@
 "Project-Id-Version: plasma_applet_battery\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:12+0000\n"
+"PO-Revision-Date: 2012-03-12 22:24+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:21+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:19+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: battery.cpp:202
 msgid "<b>Battery:</b>"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_BbalL.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_BbalL.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_BbalL.po	2012-02-23 06:20:20.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_BbalL.po	2012-03-23 06:41:52.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:19+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:09+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: bball.cpp:143
 msgid "General"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_binaryclock.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_binaryclock.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_binaryclock.po	2012-02-23 06:20:20.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_binaryclock.po	2012-03-23 06:41:52.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:20+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:09+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #. i18n: file: clockConfig.ui:28
 #. i18n: ectx: property (text), widget (QLabel, Appearance)
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_bubblemon.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_bubblemon.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_bubblemon.po	2012-02-23 06:20:20.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_bubblemon.po	2012-03-23 06:41:52.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:21+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:10+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: bubble.cpp:114
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_calculator.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_calculator.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_calculator.po	2012-02-23 06:20:20.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_calculator.po	2012-03-23 06:41:52.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:21+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:11+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: calculator.cpp:119
 msgctxt "The = button of the calculator"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_CharSelectApplet.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_CharSelectApplet.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_CharSelectApplet.po	2012-02-23 06:20:20.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_CharSelectApplet.po	2012-03-23 06:41:52.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:22+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:11+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: charselect.cpp:71
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_clock.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_clock.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_clock.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_clock.po	2012-03-23 06:42:04.000000000 +0000
@@ -12,14 +12,14 @@
 "Project-Id-Version: plasma_applet_clock\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:16+0000\n"
+"PO-Revision-Date: 2012-03-12 22:26+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:22+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:20+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: clock.cpp:187
 msgid "Appearance"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_comic.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_comic.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_comic.po	2012-02-23 06:20:20.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_comic.po	2012-03-23 06:41:52.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:22+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:11+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: comic.cpp:77
 msgid "Go to Strip"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_currentappcontrol.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_currentappcontrol.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_currentappcontrol.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_currentappcontrol.po	2012-03-23 06:42:04.000000000 +0000
@@ -14,8 +14,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:23+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:21+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: currentappcontrol.cpp:191
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_devicenotifier.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_devicenotifier.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_devicenotifier.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_devicenotifier.po	2012-03-23 06:42:04.000000000 +0000
@@ -17,8 +17,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:23+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:21+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: deviceitem.cpp:286
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_dig_clock.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_dig_clock.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_dig_clock.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_dig_clock.po	2012-03-23 06:42:04.000000000 +0000
@@ -11,14 +11,14 @@
 "Project-Id-Version: plasma_applet_dig_clock\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:16+0000\n"
+"PO-Revision-Date: 2012-03-12 22:25+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:24+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:21+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: clock.cpp:220
 msgid "Appearance"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_fifteenPuzzle.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_fifteenPuzzle.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_fifteenPuzzle.po	2012-02-23 06:20:20.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_fifteenPuzzle.po	2012-03-23 06:41:52.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:22+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:11+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: fifteenPuzzle.cpp:59
 msgid "Shuffle"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_fileWatcher.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_fileWatcher.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_fileWatcher.po	2012-02-23 06:20:20.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_fileWatcher.po	2012-03-23 06:41:52.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:23+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:11+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: fileWatcher.cpp:88
 msgid "Select a file to watch."
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_folderview.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_folderview.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_folderview.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_folderview.po	2012-03-23 06:42:00.000000000 +0000
@@ -1,42 +1,41 @@
 # translation of plasma_applet_folderview.po to Arabic
 # Copyright (C) YEAR This_file_is_part_of_KDE
 # This file is distributed under the same license as the PACKAGE package.
-# zayed <zayed.alsaidi@gmail.com>, 2008, 2010. , 2010.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
 #
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2010. , 2010.
+# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: plasma_applet_folderview\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2012-01-25 11:01+0000\n"
+"PO-Revision-Date: 2012-03-12 22:32+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:53+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:27+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Bookmarks: 13,-1,-1,-1,-1,-1,-1,-1,-1,-1\n"
 
 #: folderview.cpp:621
 msgid "Title"
-msgstr ""
+msgstr "العنوان"
 
 #: folderview.cpp:626 folderview.cpp:635 folderview.cpp:2048
 msgid "None"
-msgstr ""
+msgstr "لا يوجد"
 
 #: folderview.cpp:628 folderview.cpp:636 folderview.cpp:2051
 msgid "Default"
-msgstr ""
+msgstr "مبدئي"
 
 #: folderview.cpp:630 folderview.cpp:637 folderview.cpp:2054
 msgid "Full path"
-msgstr ""
+msgstr "كامل المسار"
 
 #: folderview.cpp:502
 msgctxt "Sort Icons"
@@ -595,7 +594,7 @@
 #: tooltipwidget.cpp:143
 #, kde-format
 msgid "%1 MPixels"
-msgstr ""
+msgstr "%1 ميجابكسل"
 
 #: tooltipwidget.cpp:148
 msgid "Camera:"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_frame.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_frame.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_frame.po	2012-02-23 06:20:20.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_frame.po	2012-03-23 06:41:52.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:23+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:12+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: configdialog.cpp:51
 msgid ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_fuzzy_clock.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_fuzzy_clock.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_fuzzy_clock.po	2012-02-23 06:20:20.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_fuzzy_clock.po	2012-03-23 06:41:52.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:24+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:12+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: fuzzyClock.cpp:204
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_icon.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_icon.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_icon.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_icon.po	2012-03-23 06:42:04.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:24+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:22+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: icon.cpp:282
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_incomingmsg.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_incomingmsg.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_incomingmsg.po	2012-02-23 06:20:20.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_incomingmsg.po	2012-03-23 06:41:52.000000000 +0000
@@ -16,8 +16,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:24+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:12+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: incomingmsg.cpp:169
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_kget.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_kget.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_kget.po	2012-02-23 06:20:09.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_kget.po	2012-03-23 06:41:41.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:18+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:05+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: common/kgetapplet.cpp:85 common/kgetapplet.cpp:99
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_kolourpicker.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_kolourpicker.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_kolourpicker.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_kolourpicker.po	2012-03-23 06:41:52.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:26+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:13+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kolourpicker.cpp:181
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_launcher.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_launcher.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_launcher.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_launcher.po	2012-03-23 06:42:04.000000000 +0000
@@ -1,24 +1,25 @@
 # translation of plasma_applet_launcher.po to Arabic
 # Copyright (C) YEAR This_file_is_part_of_KDE
 # This file is distributed under the same license as the PACKAGE package.
+#
 # Youssef Chahibi <chahibi@gmail.com>, 2007, 2008.
 # Usama Akkad <uak@aya.sy>, 2008.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
 # Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-#
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: plasma_applet_launcher\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:13+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-12 22:24+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:25+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:22+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: ui/searchbar.cpp:68
@@ -105,7 +106,7 @@
 
 #: ui/contextmenufactory.cpp:236
 msgid "Uninstall"
-msgstr ""
+msgstr "أزل"
 
 #: ui/contextmenufactory.cpp:225
 msgid "Eject"
@@ -129,11 +130,11 @@
 
 #: core/leavemodel.cpp:55
 msgid "Lock screen"
-msgstr ""
+msgstr "اقفل الشاشة"
 
 #: core/leavemodel.cpp:57
 msgid "Switch user"
-msgstr ""
+msgstr "بدّل المستخدم"
 
 #: core/leavemodel.cpp:58
 msgid "Start a parallel session as a different user"
@@ -154,7 +155,7 @@
 
 #: core/leavemodel.cpp:67
 msgid "Restart computer"
-msgstr ""
+msgstr "أعد تشغيل الحاسوب"
 
 #: core/leavemodel.cpp:68 simpleapplet/simpleapplet.cpp:203
 msgid "Save Session"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_leavenote.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_leavenote.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_leavenote.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_leavenote.po	2012-03-23 06:41:52.000000000 +0000
@@ -9,7 +9,7 @@
 "Project-Id-Version: plasma_applet_leavenote\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-09 04:40+0000\n"
-"PO-Revision-Date: 2012-01-26 14:27+0000\n"
+"PO-Revision-Date: 2012-03-14 07:29+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
@@ -17,8 +17,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:27+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:13+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: leavenote.cpp:79
 msgid "Leave me a note: "
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_life.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_life.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_life.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_life.po	2012-03-23 06:41:52.000000000 +0000
@@ -17,8 +17,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:27+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:14+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: life.cpp:80
 msgid " second"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_lockout.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_lockout.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_lockout.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_lockout.po	2012-03-23 06:42:04.000000000 +0000
@@ -1,20 +1,21 @@
 # Copyright (C) YEAR This_file_is_part_of_KDE
 # This file is distributed under the same license as the PACKAGE package.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009, 2010.
 #
+# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009, 2010.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: plasma_applet_lockout\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:14+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-12 22:25+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:26+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:22+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: lockout.cpp:228
@@ -81,10 +82,10 @@
 #. i18n: ectx: property (text), widget (QLabel, label)
 #: rc.cpp:6 rc.cpp:24
 msgid "Leave"
-msgstr ""
+msgstr "غادِر"
 
 #. i18n: file: lockoutConfig.ui:101
 #. i18n: ectx: property (text), widget (QLabel, label_4)
 #: rc.cpp:18 rc.cpp:36
 msgid "Sleep"
-msgstr ""
+msgstr "نَم"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_luna.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_luna.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_luna.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_luna.po	2012-03-23 06:41:52.000000000 +0000
@@ -16,8 +16,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:28+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:14+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: luna.cpp:56
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_magnifique.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_magnifique.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_magnifique.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_magnifique.po	2012-03-23 06:41:52.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:28+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:14+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: magnifique.cpp:67
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_microblog.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_microblog.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_microblog.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_microblog.po	2012-03-23 06:41:52.000000000 +0000
@@ -19,8 +19,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:28+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:14+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: microblog.cpp:167
 msgid "Failed to load twitter DataEngine"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_netpanel.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_netpanel.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_netpanel.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_netpanel.po	2012-03-23 06:42:04.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:27+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:23+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: panel.cpp:97 panel.cpp:362
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_networkmanagement.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_networkmanagement.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_networkmanagement.po	2012-02-23 06:20:24.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_networkmanagement.po	2012-03-23 06:41:56.000000000 +0000
@@ -8,14 +8,14 @@
 "Project-Id-Version: \n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-01 20:15+0000\n"
-"PO-Revision-Date: 2012-02-13 19:18+0000\n"
+"PO-Revision-Date: 2012-03-01 23:19+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 02:24+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 22:33+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: activatableitem.cpp:100
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_newspaper.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_newspaper.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_newspaper.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_newspaper.po	2012-03-23 06:41:59.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:24+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:10+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: newspaper.cpp:130 newspaper.cpp:221
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_news.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_news.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_news.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_news.po	2012-03-23 06:41:52.000000000 +0000
@@ -17,8 +17,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:29+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:14+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: news.cpp:233
 msgid "General"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_notes.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_notes.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_notes.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_notes.po	2012-03-23 06:41:52.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:29+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:15+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: notes.cpp:332
 msgid "Notes Color"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_notifications.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_notifications.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_notifications.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_notifications.po	2012-03-23 06:42:04.000000000 +0000
@@ -2,12 +2,13 @@
 # This file is distributed under the same license as the PACKAGE package.
 # Mohamed Mohsen <eng.mohamed91@ymail.com>, 2010.
 # Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: \n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 20:27+0000\n"
+"PO-Revision-Date: 2012-03-13 22:16+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
@@ -15,14 +16,14 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:27+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:23+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: ui/jobtotalswidget.cpp:83
 msgctxt "Generic title for the job transfer popup"
 msgid "Jobs"
-msgstr ""
+msgstr "وظائف"
 
 #: ui/busywidget.cpp:274
 #, kde-format
@@ -50,7 +51,7 @@
 #, kde-format
 msgid "%1 completed job"
 msgid_plural "%1 completed jobs"
-msgstr[0] ""
+msgstr[0] "لا وظائف"
 msgstr[1] "وظيفة واحدة مكتملة"
 msgstr[2] "وظيفتان مكتملتان"
 msgstr[3] "%1 وظائف مكتملة"
@@ -61,7 +62,7 @@
 #, kde-format
 msgid "%1 notification"
 msgid_plural "%1 notifications"
-msgstr[0] ""
+msgstr[0] "لا إشعارات"
 msgstr[1] "إشعار واحد"
 msgstr[2] "إشعاران"
 msgstr[3] "%1 إشعارات"
@@ -204,7 +205,7 @@
 
 #: core/completedjobnotification.cpp:64
 msgid "Open"
-msgstr ""
+msgstr "افتح"
 
 #. i18n: file: ui/notificationsconfig.ui:26
 #. i18n: ectx: property (text), widget (QLabel, label_2)
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_nowplaying.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_nowplaying.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_nowplaying.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_nowplaying.po	2012-03-23 06:41:52.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:30+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:15+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: infopanel.cpp:51
 msgctxt "For a song or other music"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_opendesktop.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_opendesktop.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_opendesktop.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_opendesktop.po	2012-03-23 06:41:52.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:30+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:16+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: contactwidget.cpp:174
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_pager.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_pager.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_pager.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_pager.po	2012-03-23 06:42:04.000000000 +0000
@@ -12,7 +12,7 @@
 "Project-Id-Version: plasma_applet_pager\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:16+0000\n"
+"PO-Revision-Date: 2012-03-12 22:24+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
@@ -20,8 +20,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:28+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:23+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: pager.cpp:271
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_panel.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_panel.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_panel.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_panel.po	2012-03-23 06:42:04.000000000 +0000
@@ -8,14 +8,14 @@
 "Project-Id-Version: plasma_applet_panel\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:13+0000\n"
+"PO-Revision-Date: 2012-03-12 22:25+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:29+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:24+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: panel.cpp:160
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_panelspacer_internal.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_panelspacer_internal.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_panelspacer_internal.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_panelspacer_internal.po	2012-03-23 06:42:04.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:29+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:24+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: panelspacer.cpp:38
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_pastebin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_pastebin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_pastebin.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_pastebin.po	2012-03-23 06:41:52.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:32+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:16+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: pastebin.cpp:218
 msgctxt "The status of the applet has not been set - i.e. it is unset."
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_paste.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_paste.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_paste.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_paste.po	2012-03-23 06:41:52.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:31+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:16+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: addmacro.cpp:32
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_previewer.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_previewer.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_previewer.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_previewer.po	2012-03-23 06:41:52.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:33+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:17+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: plasma-previewer.cpp:245
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_qstardict.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_qstardict.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_qstardict.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_qstardict.po	2012-03-23 06:41:52.000000000 +0000
@@ -16,8 +16,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:33+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:17+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: dict.cpp:107
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_quicklaunch.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_quicklaunch.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_quicklaunch.po	2012-02-23 06:20:31.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_quicklaunch.po	2012-03-23 06:42:04.000000000 +0000
@@ -9,14 +9,14 @@
 "Project-Id-Version: plasma_applet_quicklaunch\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:13+0000\n"
+"PO-Revision-Date: 2012-03-12 22:24+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:30+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:24+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: launcherlist.cpp:396
 msgid "Multiple items"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_rssnow.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_rssnow.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_rssnow.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_rssnow.po	2012-03-23 06:41:52.000000000 +0000
@@ -17,8 +17,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:34+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:17+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: news.cpp:156
 msgid " minute"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_rtm.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_rtm.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_rtm.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_rtm.po	2012-03-23 06:41:52.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:34+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:18+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #. i18n: file: authenticate.ui:17
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_saverdesktop.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_saverdesktop.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_saverdesktop.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_saverdesktop.po	2012-03-23 06:42:04.000000000 +0000
@@ -9,14 +9,14 @@
 "Project-Id-Version: plasma_containment_saverdesktop\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:16+0000\n"
+"PO-Revision-Date: 2012-03-12 22:24+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:31+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:25+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: desktop.cpp:69
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_appletscriptengine_dashboard.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_appletscriptengine_dashboard.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_appletscriptengine_dashboard.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_appletscriptengine_dashboard.po	2012-03-23 06:42:05.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:37+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:28+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: bundle.cpp:312
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_showdashboard.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_showdashboard.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_showdashboard.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_showdashboard.po	2012-03-23 06:41:52.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:35+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:18+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: showdashboard.cpp:59
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_showdesktop.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_showdesktop.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_showdesktop.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_showdesktop.po	2012-03-23 06:41:52.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:35+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:18+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: showdesktop.cpp:61
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_skapplet.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_skapplet.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_skapplet.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_skapplet.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,37 +0,0 @@
-# translation of plasma_applet_skapplet.po to
-# Copyright (C) YEAR This_file_is_part_of_KDE
-# This file is distributed under the same license as the PACKAGE package.
-#
-# Youssef Chahibi <chahibi@gmail.com>, 2007.
-# Fahad Al-Saidi <fahad.alsaidi@gmail.com>, 2007.
-# Youness BOUTYOUR <niceboy@linuxac.org>, 2008.
-msgid ""
-msgstr ""
-"Project-Id-Version: plasma_applet_skapplet\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 13:31+0000\n"
-"PO-Revision-Date: 2009-01-07 09:09+0000\n"
-"Last-Translator: Youness BOUTYOUR <niceboy@linuxac.org>\n"
-"Language-Team: French <kde-i18n-doc@lists.kde.org>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:12+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"Language: fr\n"
-
-#: skapplet.cpp:141
-msgid ""
-"*.skz *.theme|Theme Files\n"
-"*|All Files"
-msgstr ""
-"*.skz *.theme|ملفات السمات\n"
-"*|كل الملفات"
-
-#: skapplet.cpp:145 skpackage.cpp:68 skpackage.cpp:94
-msgid "SuperKaramba Theme"
-msgstr "سمة سوبركارامبا"
-
-#: skappletscript.cpp:235
-msgid "Failed to launch SuperKaramba Theme"
-msgstr "فشل في إطلاق سمة سوبركارامبا"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_systemloadviewer.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_systemloadviewer.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_systemloadviewer.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_systemloadviewer.po	2012-03-23 06:41:52.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:36+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:19+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #. i18n: file: coloursconfig.ui:14
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_system-monitor.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_system-monitor.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_system-monitor.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_system-monitor.po	2012-03-23 06:42:04.000000000 +0000
@@ -9,7 +9,7 @@
 "Project-Id-Version: plasma_applet_system-monitor\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:12+0000\n"
+"PO-Revision-Date: 2012-03-12 22:23+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
@@ -17,8 +17,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:33+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:26+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: cpu.cpp:45 cpu.cpp:128 hwinfo.cpp:129
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_systemtray.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_systemtray.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_systemtray.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_systemtray.po	2012-03-23 06:42:04.000000000 +0000
@@ -9,14 +9,14 @@
 "Project-Id-Version: plasma_applet_systemtray\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 23:57+0000\n"
+"PO-Revision-Date: 2012-03-13 00:59+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:33+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:27+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: ui/applet.cpp:437
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_tasks.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_tasks.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_tasks.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_tasks.po	2012-03-23 06:42:05.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:34+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:27+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #. i18n: file: tasksConfig.ui:29
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_timer.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_timer.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_timer.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_timer.po	2012-03-23 06:41:52.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:37+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:19+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: customtimeeditor.cpp:70
 msgctxt "separator of hours:minutes:seconds in timer strings"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_trash.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_trash.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_trash.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_trash.po	2012-03-23 06:42:05.000000000 +0000
@@ -16,8 +16,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:35+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:27+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: trash.cpp:119 trash.cpp:135 trash.cpp:168 trash.cpp:242
 msgid "Trash"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_unitconverter.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_unitconverter.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_unitconverter.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_unitconverter.po	2012-03-23 06:41:52.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:37+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:19+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: unitconverter.cpp:178
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_weather.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_weather.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_weather.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_weather.po	2012-03-23 06:41:52.000000000 +0000
@@ -9,7 +9,7 @@
 "Project-Id-Version: plasma_applet_weather\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-09 04:40+0000\n"
-"PO-Revision-Date: 2012-01-25 11:22+0000\n"
+"PO-Revision-Date: 2012-03-12 22:29+0000\n"
 "Last-Translator: Osama Khalid <osamak.wfm@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
@@ -17,8 +17,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:38+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:19+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: weatherapplet.cpp:216
 msgctxt "Shown when you have not set a weather provider"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_weatherstation.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_weatherstation.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_weatherstation.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_weatherstation.po	2012-03-23 06:41:52.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:38+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:19+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #. i18n: file: appearanceconfig.ui:32
 #. i18n: ectx: property (windowTitle), widget (QWidget, AppearanceConfig)
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_webbrowser.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_webbrowser.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_applet_webbrowser.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_applet_webbrowser.po	2012-03-23 06:42:05.000000000 +0000
@@ -7,7 +7,7 @@
 "Project-Id-Version: plasma_applet_webbrowser\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:16+0000\n"
+"PO-Revision-Date: 2012-03-12 22:24+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
@@ -15,8 +15,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:35+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:28+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: browsermessagebox.cpp:39
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_containmentactions_contextmenu.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_containmentactions_contextmenu.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_containmentactions_contextmenu.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_containmentactions_contextmenu.po	2012-03-23 06:42:05.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:37+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:29+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: menu.cpp:98
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_containmentactions_switchactivity.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_containmentactions_switchactivity.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_containmentactions_switchactivity.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_containmentactions_switchactivity.po	2012-03-23 06:42:05.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:38+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:29+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: switch.cpp:111 switch.cpp:125
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_containmentactions_switchdesktop.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_containmentactions_switchdesktop.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_containmentactions_switchdesktop.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_containmentactions_switchdesktop.po	2012-03-23 06:42:05.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:38+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:29+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: desktop.cpp:34 desktop.cpp:62
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_containmentactions_switchwindow.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_containmentactions_switchwindow.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_containmentactions_switchwindow.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_containmentactions_switchwindow.po	2012-03-23 06:42:05.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:39+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:30+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #. i18n: file: config.ui:16
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma-desktop.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma-desktop.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma-desktop.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma-desktop.po	2012-03-23 06:42:05.000000000 +0000
@@ -12,14 +12,14 @@
 "Project-Id-Version: plasma\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:14+0000\n"
+"PO-Revision-Date: 2012-03-12 22:26+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:39+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:31+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: controllerwindow.cpp:401
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasmaengineexplorer.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasmaengineexplorer.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasmaengineexplorer.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasmaengineexplorer.po	2012-03-23 06:42:06.000000000 +0000
@@ -12,7 +12,7 @@
 "Project-Id-Version: plasmaengineexplorer\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:16+0000\n"
+"PO-Revision-Date: 2012-03-12 22:24+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
@@ -20,8 +20,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:03+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:44+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: engineexplorer.cpp:54 main.cpp:68
 msgid "Plasma Engine Explorer"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_engine_keystate.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_engine_keystate.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_engine_keystate.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_engine_keystate.po	2012-03-23 06:42:05.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:41+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:31+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: keystate.cpp:29
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_engine_kuiserver.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_engine_kuiserver.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_engine_kuiserver.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_engine_kuiserver.po	2012-03-23 06:42:05.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:42+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:32+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: jobaction.cpp:30
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_engine_metadata.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_engine_metadata.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_engine_metadata.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_engine_metadata.po	2012-03-23 06:42:05.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:42+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:32+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: metadata_engine.cpp:70 metadata_engine.cpp:122
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_engine_network.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_engine_network.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_engine_network.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_engine_network.po	2012-03-23 06:42:05.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:43+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:32+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: networkengine.cpp:72 networkengine.cpp:82 networkengine.cpp:118
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_engine_notifications.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_engine_notifications.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_engine_notifications.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_engine_notifications.po	2012-03-23 06:42:05.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:43+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:33+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: notificationaction.cpp:30
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_engine_nowplaying.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_engine_nowplaying.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_engine_nowplaying.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_engine_nowplaying.po	2012-03-23 06:42:05.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:44+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:33+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: playeractionjob.cpp:28
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_engine_rss.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_engine_rss.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_engine_rss.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_engine_rss.po	2012-03-23 06:42:05.000000000 +0000
@@ -17,8 +17,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:44+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:33+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: rss.cpp:195
 msgid "Syndication did not work out"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_engine_soliddevice.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_engine_soliddevice.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_engine_soliddevice.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_engine_soliddevice.po	2012-03-23 06:42:05.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:46+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:34+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: soliddeviceengine.cpp:106
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_engine_weather.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_engine_weather.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_engine_weather.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_engine_weather.po	2012-03-23 06:42:05.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:46+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:34+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: ions/wetter.com/ion_wettercom.cpp:168 ions/wetter.com/ion_wettercom.cpp:169
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasmagenericshell.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasmagenericshell.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasmagenericshell.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasmagenericshell.po	2012-03-23 06:42:06.000000000 +0000
@@ -8,14 +8,14 @@
 "Project-Id-Version: plasma-shells-common\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:12+0000\n"
+"PO-Revision-Date: 2012-03-12 22:26+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:03+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:45+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: widgetsexplorer/kcategorizeditemsviewmodels.cpp:72
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma-netbook.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma-netbook.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma-netbook.po	2012-02-23 06:20:32.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma-netbook.po	2012-03-23 06:42:05.000000000 +0000
@@ -2,19 +2,20 @@
 # This file is distributed under the same license as the PACKAGE package.
 # Mohamed Mohsen <eng.mohamed91@ymail.com>, 2010.
 # Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: \n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2010-08-09 19:38+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-12 22:24+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:47+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:35+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: main.cpp:28
@@ -23,7 +24,7 @@
 
 #: main.cpp:34
 msgid "Plasma Netbook Shell"
-msgstr ""
+msgstr "قشرة بلازما للأجهزة المحمولة"
 
 #: main.cpp:36
 msgid "Copyright 2006-2009, The KDE Team"
@@ -62,13 +63,13 @@
 
 #: netcorona.cpp:71
 msgid "Add page"
-msgstr ""
+msgstr "أضف صفحة"
 
 #: netcorona.cpp:129
 #, kde-format
 msgctxt "Page number"
 msgid "Page %1"
-msgstr ""
+msgstr "الصفحة %1"
 
 #: netpanelcontroller.cpp:63
 msgid "Screen edge"
@@ -90,14 +91,14 @@
 msgctxt "NAME OF TRANSLATORS"
 msgid "Your names"
 msgstr ""
-"محمد محسن زماره,زايد السعيدي, ,Launchpad Contributions:,Zayed Amer Al-"
-"Saidi,someone"
+"محمد محسن زماره,زايد السعيدي, ,Launchpad Contributions:,Abdalrahim G. "
+"Fakhouri,Zayed Amer Al-Saidi,someone"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
 msgstr ""
-"eng.mohamed91@ymail.com,zayed.alsaidi@gmail.com,,,zayed.alsaidi@gmail.com,"
+"eng.mohamed91@ymail.com,zayed.alsaidi@gmail.com,,,,zayed.alsaidi@gmail.com,"
 
 #: scripting/newspaper.cpp:48
 msgid ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma-overlay.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma-overlay.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma-overlay.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma-overlay.po	2012-03-23 06:42:05.000000000 +0000
@@ -9,14 +9,14 @@
 "Project-Id-Version: plasma-overlay\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:12+0000\n"
+"PO-Revision-Date: 2012-03-12 22:24+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:48+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:36+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: backgrounddialog.cpp:45
 msgid "Background Settings"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_packagestructure_comic.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_packagestructure_comic.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_packagestructure_comic.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_packagestructure_comic.po	2012-03-23 06:41:52.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:39+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:21+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: comic_package.cpp:28
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasmapkg.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasmapkg.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasmapkg.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasmapkg.po	2012-03-23 06:41:59.000000000 +0000
@@ -9,15 +9,14 @@
 "Project-Id-Version: plasmapkg\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:43+0000\n"
+"PO-Revision-Date: 2012-03-12 22:42+0000\n"
 "Last-Translator: Abderrahim Kitouni <a.kitouni@gmail.com>\n"
 "Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:26+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:11+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: main.cpp:38
@@ -235,11 +234,11 @@
 msgid "Your names"
 msgstr ""
 "محمد ابراهيم الحرقان، زايد السعيدي، محمد هاني صباغ, ,Launchpad "
-"Contributions:,Abderrahim Kitouni,Zayed Amer Al-Saidi"
+"Contributions:,Zayed Amer Al-Saidi"
 
 #: rc.cpp:2
 msgctxt "EMAIL OF TRANSLATORS"
 msgid "Your emails"
 msgstr ""
 "imksa@hotmail.com; zayed.alsaidi@gmail.com; "
-"hannysabbagh@hotmail.com,,,a.kitouni@gmail.com,zayed.alsaidi@gmail.com"
+"hannysabbagh@hotmail.com,,,zayed.alsaidi@gmail.com"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma-remote-helper.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma-remote-helper.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma-remote-helper.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma-remote-helper.po	2012-03-23 06:41:59.000000000 +0000
@@ -13,9 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:25+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:11+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: main.cpp:28
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_bookmarksrunner.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_bookmarksrunner.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_bookmarksrunner.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_bookmarksrunner.po	2012-03-23 06:42:05.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:49+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:37+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: bookmarksrunner.cpp:47
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_browserhistory.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_browserhistory.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_browserhistory.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_browserhistory.po	2012-03-23 06:41:52.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:40+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:21+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: browserhistory.cpp:48
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_calculatorrunner.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_calculatorrunner.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_calculatorrunner.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_calculatorrunner.po	2012-03-23 06:42:05.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:49+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:37+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: calculatorrunner.cpp:50
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_contacts.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_contacts.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_contacts.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_contacts.po	2012-03-23 06:41:53.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:41+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:21+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: contactsrunner.cpp:48
 msgid "Finds people in your address book matching :q:."
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_katesessions.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_katesessions.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_katesessions.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_katesessions.po	2012-03-23 06:41:53.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:43+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:22+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: katesessions.cpp:57
 msgid "Finds Kate sessions matching :q:."
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_kill.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_kill.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_kill.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_kill.po	2012-03-23 06:42:05.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:50+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:37+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: killrunner.cpp:60 killrunner_config.cpp:60 killrunner_config.cpp:86
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_konquerorsessions.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_konquerorsessions.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_konquerorsessions.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_konquerorsessions.po	2012-03-23 06:41:53.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:43+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:22+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: konquerorsessions.cpp:55
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_konsolesessions.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_konsolesessions.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_konsolesessions.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_konsolesessions.po	2012-03-23 06:41:53.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:43+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:23+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: konsolesessions.cpp:53
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_locations.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_locations.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_locations.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_locations.po	2012-03-23 06:42:05.000000000 +0000
@@ -16,8 +16,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:51+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:38+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: locationrunner.cpp:44
 msgid ""
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_nepomuksearchrunner.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_nepomuksearchrunner.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_nepomuksearchrunner.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_nepomuksearchrunner.po	2012-03-23 06:42:05.000000000 +0000
@@ -8,14 +8,14 @@
 "Project-Id-Version: krunner_nepomuksearchrunner\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:14+0000\n"
+"PO-Revision-Date: 2012-03-12 22:26+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:52+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:38+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: nepomuksearchrunner.cpp:76
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_placesrunner.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_placesrunner.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_placesrunner.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_placesrunner.po	2012-03-23 06:42:05.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:52+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:38+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: placesrunner.cpp:38
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_plasma-desktop.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_plasma-desktop.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_plasma-desktop.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_plasma-desktop.po	2012-03-23 06:42:06.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:53+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:39+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: plasma-desktop-runner.cpp:38
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_powerdevil.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_powerdevil.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_powerdevil.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_powerdevil.po	2012-03-23 06:42:06.000000000 +0000
@@ -10,14 +10,14 @@
 "Project-Id-Version: krunner_powerdevil\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-26 21:17+0000\n"
+"PO-Revision-Date: 2012-03-13 04:13+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:53+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:39+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: PowerDevilRunner.cpp:53 PowerDevilRunner.cpp:54 PowerDevilRunner.cpp:75
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_recentdocuments.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_recentdocuments.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_recentdocuments.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_recentdocuments.po	2012-03-23 06:42:06.000000000 +0000
@@ -16,8 +16,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:54+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:39+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: recentdocuments.cpp:46
 msgid "Looks for documents recently used with names matching :q:."
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_services.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_services.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_services.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_services.po	2012-03-23 06:42:06.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:55+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:40+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: servicerunner.cpp:39
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_sessions.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_sessions.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_sessions.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_sessions.po	2012-03-23 06:42:06.000000000 +0000
@@ -16,8 +16,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:56+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:41+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: sessionrunner.cpp:41 sessionrunner.cpp:72
 msgctxt "log out command"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_shell.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_shell.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_shell.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_shell.po	2012-03-23 06:42:06.000000000 +0000
@@ -9,14 +9,14 @@
 "Project-Id-Version: krunner_shellrunner\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:12+0000\n"
+"PO-Revision-Date: 2012-03-12 22:23+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:56+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:41+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #. i18n: file: shellOptions.ui:61
 #. i18n: ectx: property (whatsThis), widget (QLabel, lbUsername)
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_solid.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_solid.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_solid.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_solid.po	2012-03-23 06:42:06.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:57+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:41+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: devicewrapper.cpp:139
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_spellcheckrunner.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_spellcheckrunner.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_spellcheckrunner.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_spellcheckrunner.po	2012-03-23 06:41:53.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:45+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:23+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #. i18n: file: spellcheck_config.ui:16
 #. i18n: ectx: property (title), widget (QGroupBox, groupBox)
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_webshortcuts.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_webshortcuts.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_webshortcuts.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_webshortcuts.po	2012-03-23 06:42:06.000000000 +0000
@@ -10,14 +10,14 @@
 "Project-Id-Version: krunner_webshortcutsrunner\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:14+0000\n"
+"PO-Revision-Date: 2012-03-12 22:26+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:58+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:42+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: webshortcutrunner.cpp:105
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_windowedwidgets.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_windowedwidgets.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_windowedwidgets.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_windowedwidgets.po	2012-03-23 06:42:06.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:58+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:42+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: windowedwidgetsrunner.cpp:40
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_windows.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_windows.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_runner_windows.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_runner_windows.po	2012-03-23 06:42:06.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 05:59+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:42+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: windowsrunner.cpp:40
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_scriptengine_qscript.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_scriptengine_qscript.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_scriptengine_qscript.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_scriptengine_qscript.po	2012-03-23 06:41:59.000000000 +0000
@@ -9,15 +9,14 @@
 "Project-Id-Version: plasma_scriptengine_qscript\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2012-01-25 11:39+0000\n"
+"PO-Revision-Date: 2012-03-12 22:42+0000\n"
 "Last-Translator: Abderrahim Kitouni <a.kitouni@gmail.com>\n"
 "Language-Team: Arabic <doc@arabeyes.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:25+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"X-Project-Style: kde\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:11+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: common/javascriptaddonpackagestructure.cpp:30
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_wallpaper_color.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_wallpaper_color.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_wallpaper_color.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_wallpaper_color.po	2012-03-23 06:42:06.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:01+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:43+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #. i18n: file: config.ui:14
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_wallpaper_image.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_wallpaper_image.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_wallpaper_image.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_wallpaper_image.po	2012-03-23 06:42:06.000000000 +0000
@@ -9,14 +9,14 @@
 "Project-Id-Version: plasma_wallpaper_image\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 23:53+0000\n"
+"PO-Revision-Date: 2012-03-14 00:33+0000\n"
 "Last-Translator: Launchpad Translations Administrators <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:02+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:44+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: backgrounddelegate.cpp:80
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_wallpaper_mandelbrot.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_wallpaper_mandelbrot.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_wallpaper_mandelbrot.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_wallpaper_mandelbrot.po	2012-03-23 06:41:53.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:45+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:23+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: mandelbrot.cpp:37
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_wallpaper_marble.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_wallpaper_marble.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_wallpaper_marble.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_wallpaper_marble.po	2012-03-23 06:41:53.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:46+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:24+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #. i18n: file: config.ui:20
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_wallpaper_pattern.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_wallpaper_pattern.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_wallpaper_pattern.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_wallpaper_pattern.po	2012-03-23 06:41:53.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:46+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:24+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #. i18n: file: config.ui:17
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasmawallpaperviewer.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasmawallpaperviewer.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasmawallpaperviewer.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasmawallpaperviewer.po	2012-03-23 06:42:06.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:04+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:46+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: main.cpp:31
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_wallpaper_virus.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_wallpaper_virus.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_wallpaper_virus.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_wallpaper_virus.po	2012-03-23 06:41:53.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:47+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:24+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: backgrounddelegate.cpp:70
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_wallpaper_weather.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_wallpaper_weather.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma_wallpaper_weather.po	2012-02-23 06:20:21.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma_wallpaper_weather.po	2012-03-23 06:41:53.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 00:47+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 21:24+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: backgrounddelegate.cpp:68
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma-windowed.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma-windowed.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasma-windowed.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasma-windowed.po	2012-03-23 06:42:06.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:02+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:44+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: main.cpp:28
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasmoidviewer.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasmoidviewer.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/plasmoidviewer.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/plasmoidviewer.po	2012-03-23 06:42:06.000000000 +0000
@@ -10,14 +10,14 @@
 "Project-Id-Version: plasmoidviewer\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:14+0000\n"
+"PO-Revision-Date: 2012-03-12 22:24+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:05+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:46+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: main.cpp:49
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/powerdevil.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/powerdevil.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/powerdevil.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/powerdevil.po	2012-03-23 06:42:06.000000000 +0000
@@ -1,22 +1,23 @@
 # translation of powerdevil.po to Arabic
 # Copyright (C) YEAR This_file_is_part_of_KDE
 # This file is distributed under the same license as the PACKAGE package.
+#
 # zayed <zayed.alsaidi@gmail.com>, 2008.
 # Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-#
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: powerdevil\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:16+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-12 22:24+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:06+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:46+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: backends/upower/upowersuspendjob.cpp:76
@@ -88,7 +89,7 @@
 #: kcmodule/EditPage.cpp:108 kcmodule/EditPage.cpp:113
 #: kcmodule/GeneralPage.cpp:73
 msgid "Shutdown"
-msgstr "اطفئ"
+msgstr "أطفئ"
 
 #: actions/bundled/handlebuttoneventsconfig.cpp:85
 #: actions/bundled/suspendsessionconfig.cpp:86
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/printer-applet.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/printer-applet.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/printer-applet.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/printer-applet.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,474 +0,0 @@
-# translation of printer-applet.po to Arabic
-# Copyright (C) YEAR This_file_is_part_of_KDE
-# This file is distributed under the same license as the PACKAGE package.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-#
-msgid ""
-msgstr ""
-"Project-Id-Version: printer-applet\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 13:31+0000\n"
-"PO-Revision-Date: 2011-01-06 06:35+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
-"3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:13+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"Language: ar\n"
-
-#: printer-applet.py:254
-msgid "Cancel"
-msgstr "ألغ"
-
-#: printer-applet.py:255
-msgid "_Hold"
-msgstr "ا_مسك"
-
-#: printer-applet.py:256
-msgid "_Release"
-msgstr "ا_طلق"
-
-#: printer-applet.py:257
-msgid "Re_print"
-msgstr "أ_عد الطبع"
-
-#: printer-applet.py:263
-msgid "&Refresh"
-msgstr "أ&نعش"
-
-#. i18n: file: printer-applet.ui:157
-#. i18n: ectx: property (text), widget (QStatusBar, statusbar)
-#: printer-applet.py:268 rc.py:66
-msgid "Printer Configuration..."
-msgstr "ضبط الطابعة..."
-
-#. i18n: file: printer-applet.ui:115
-#. i18n: ectx: property (text), widget (QStatusBar, statusbar)
-#. i18n: file: printer-applet.ui:132
-#. i18n: ectx: property (text), widget (QStatusBar, statusbar)
-#: printer-applet.py:273 rc.py:51 rc.py:57
-msgid "Show Completed Jobs"
-msgstr "أظهر  المهام المكتملة"
-
-#. i18n: file: printer-applet.ui:152
-#. i18n: ectx: property (text), widget (QStatusBar, statusbar)
-#: printer-applet.py:277 rc.py:63
-msgid "Show Printer Status"
-msgstr "أظهر حالة الطابعة"
-
-#: printer-applet.py:348
-msgid "Not authorized"
-msgstr "غير مصرح"
-
-#: printer-applet.py:349
-msgid "The password may be incorrect."
-msgstr "قد تكون كلمة السر خاطئة"
-
-#: printer-applet.py:352
-msgid "CUPS server error"
-msgstr "خطأ خادم CUPS"
-
-#: printer-applet.py:353
-msgid "There was an error during the CUPS operation: '%1'."
-msgstr "هناك خطأ خلال عملية CUPS: '%1'."
-
-#: printer-applet.py:358
-msgid "Error"
-msgstr "خطأ"
-
-#: printer-applet.py:402
-msgctxt "%1 in the '%1 and %2 ago' message below"
-msgid "1 hour"
-msgid_plural "%1 hours"
-msgstr[0] ""
-msgstr[1] "ساعة واحدة"
-msgstr[2] "ساعتين"
-msgstr[3] "%1 ساعات"
-msgstr[4] "%1 ساعة"
-msgstr[5] "%1 ساعة"
-
-#: printer-applet.py:403
-msgctxt "%2 in the '%1 and %2 ago' message below"
-msgid "1 minute"
-msgid_plural "%1 minutes"
-msgstr[0] ""
-msgstr[1] "دقيقة واحدة"
-msgstr[2] "دقيقتين"
-msgstr[3] "%1 دقائق"
-msgstr[4] "%1 دقيقة"
-msgstr[5] "%1 دقيقة"
-
-#: printer-applet.py:404
-msgctxt "Arguments are formatted hours and minutes from the messages above"
-msgid "%1 and %2 ago"
-msgstr "منذ %1 و %2"
-
-#: printer-applet.py:406
-msgid "1 hour ago"
-msgid_plural "%1 hours ago"
-msgstr[0] "منذ أقل من ساعة"
-msgstr[1] "منذ ساعة واحدة"
-msgstr[2] "منذ ساعتين"
-msgstr[3] "منذ %1 ساعات"
-msgstr[4] "منذ %1 ساعة"
-msgstr[5] "منذ %1 ساعة"
-
-#: printer-applet.py:410
-msgid "a minute ago"
-msgid_plural "%1 minutes ago"
-msgstr[0] "منذ أقل من دقيقة"
-msgstr[1] "منذ دقيقة واحدة"
-msgstr[2] "منذ دقيقتين"
-msgstr[3] "منذ %1 دقائق"
-msgstr[4] "منذ %1 دقيقة"
-msgstr[5] "منذ %1 دقيقة"
-
-#: printer-applet.py:439
-msgctxt "User who printed is not known"
-msgid "Unknown"
-msgstr "مجهول"
-
-#: printer-applet.py:440
-msgctxt "Print job name is not known"
-msgid "Unknown"
-msgstr "مجهول"
-
-#: printer-applet.py:453
-msgid "Unknown"
-msgstr "مجهول"
-
-#: printer-applet.py:468
-msgctxt "Job state"
-msgid "Held for authentication"
-msgstr "توقف للاستيثاق"
-
-#: printer-applet.py:470
-msgctxt "Job state"
-msgid "Pending"
-msgstr "ينتظر"
-
-#: printer-applet.py:471
-msgctxt "Job state"
-msgid "Held"
-msgstr "ممسوك"
-
-#: printer-applet.py:472
-msgctxt "Job state"
-msgid "Processing"
-msgstr "يعالج"
-
-#: printer-applet.py:473
-msgctxt "Job state"
-msgid "Stopped"
-msgstr "موقوف"
-
-#: printer-applet.py:474
-msgctxt "Job state"
-msgid "Canceled"
-msgstr "ملغي"
-
-#: printer-applet.py:475
-msgctxt "Job state"
-msgid "Aborted"
-msgstr "مجهض"
-
-#: printer-applet.py:476
-msgctxt "Job state"
-msgid "Completed"
-msgstr "مكتمل"
-
-#: printer-applet.py:483
-msgctxt "Job state"
-msgid "Unknown"
-msgstr "مجهول"
-
-#: printer-applet.py:647
-msgid "No documents queued"
-msgstr "لا يوجد مستندات في الصف"
-
-#: printer-applet.py:649
-msgid "1 document queued"
-msgid_plural "%1 documents queued"
-msgstr[0] "لا شيء"
-msgstr[1] "وثيقة واحد في الصف"
-msgstr[2] "وثيقتان في الصف"
-msgstr[3] "%1 وثائق في الصف"
-msgstr[4] "%1 وثيقة في الصف"
-msgstr[5] "%1 وثيقة في الصف"
-
-#: printer-applet.py:651
-msgid "Print Status"
-msgstr "حالة الطابعة"
-
-#: printer-applet.py:860
-msgid "There was a problem sending document `%1' (job %2) to the printer."
-msgstr "توجد مشكلة في ارسال الوثيقة إلى `%1' (المهمة %2) الطابعة."
-
-#: printer-applet.py:863
-msgid "There was a problem processing document `%1' (job %2)."
-msgstr "توجد مشكلة في معالجة الوثيقة `%1' (المهمة %2)"
-
-#: printer-applet.py:869
-msgid "There was a problem printing document `%1' (job %2): `%3'."
-msgstr "توجد مشكلة في طباعة الوثيقة `%1' (المهمة %2): `%3'."
-
-#: printer-applet.py:876 printer-applet.py:888
-msgid "Print Error"
-msgstr "خطأ الطابعة"
-
-#: printer-applet.py:882
-msgid "The printer called `%1' has been disabled."
-msgstr "ألغي نداء الطابعة لـ `%1' ."
-
-#: printer-applet.py:1061
-msgid "Configuring New Printer"
-msgstr "ضبط طابعة جديدة"
-
-#: printer-applet.py:1115
-msgid "'%1' is ready for printing."
-msgstr "'%1' جاهز للطباعة."
-
-#: printer-applet.py:1117
-msgid "'%1' has been added, using the '%2' driver."
-msgstr "تمت إضافة '%1' باستعمال المعرف '%2'."
-
-#: printer-applet.py:1126
-msgid "Printer Applet"
-msgstr "بريمج الطابعة"
-
-#: printer-applet.py:1128
-msgid "Applet to view current print jobs and configure new printers"
-msgstr "بريمج لرؤية أعمال الطباعة الحالية و ضبط الطابعات الجديدة"
-
-#: printer-applet.py:1130
-msgid "2007-2008 Canonical Ltd"
-msgstr "2007-2008 شركة كونيكل"
-
-#: printer-applet.py:1137
-msgid "Jonathan Riddell"
-msgstr "Jonathan Riddell"
-
-#: printer-applet.py:1137
-msgid "Author"
-msgstr "المؤلف"
-
-#: printer-applet.py:1138
-msgid "Tim Waugh/Red Hat"
-msgstr "Tim Waugh/رد هات"
-
-#: printer-applet.py:1138
-msgid "System Config Printer Author"
-msgstr "مؤلف ضبط نظام الطابعة"
-
-#: printer-applet.py:1141
-msgid "Show even when nothing printing"
-msgstr "أظهر حتى و إن كان لا يوجد شيء للطباعة"
-
-#. i18n: file: printer-appletui.rc:4
-#. i18n: ectx: Menu (view)
-#: rc.py:3
-msgid "&View"
-msgstr "ا&عرض"
-
-#. i18n: file: printer-appletui.rc:9
-#. i18n: ectx: Menu (settings)
-#: rc.py:6
-msgid "&Settings"
-msgstr "إ&عدادات"
-
-#. i18n: file: printer-applet-printers.ui:13
-#. i18n: ectx: property (windowTitle), widget (QWidget, Form)
-#: rc.py:9
-msgid "Printer Status"
-msgstr "حالة الطابعة"
-
-#. i18n: file: printer-applet-printers.ui:41
-#. i18n: ectx: property (text), widget (QTreeWidget, treeWidget)
-#. i18n: file: printer-applet.ui:56
-#. i18n: ectx: property (text), widget (QTreeWidget, treeWidget)
-#: rc.py:12 rc.py:30
-msgid "Printer"
-msgstr "الطابعة"
-
-#. i18n: file: printer-applet-printers.ui:46
-#. i18n: ectx: property (text), widget (QTreeWidget, treeWidget)
-#: rc.py:15
-msgid "Message"
-msgstr "الرسالة"
-
-#. i18n: file: printer-applet.ui:14
-#. i18n: ectx: property (windowTitle), widget (QMainWindow, MainWindow)
-#: rc.py:18
-msgid "Document Print Status"
-msgstr "حالة طباعة المستند"
-
-#. i18n: file: printer-applet.ui:41
-#. i18n: ectx: property (text), widget (QTreeWidget, treeWidget)
-#: rc.py:21
-msgid "Job"
-msgstr "العمل"
-
-#. i18n: file: printer-applet.ui:46
-#. i18n: ectx: property (text), widget (QTreeWidget, treeWidget)
-#: rc.py:24
-msgid "User"
-msgstr "المستخدم"
-
-#. i18n: file: printer-applet.ui:51
-#. i18n: ectx: property (text), widget (QTreeWidget, treeWidget)
-#: rc.py:27
-msgid "Document"
-msgstr "الوثيقة"
-
-#. i18n: file: printer-applet.ui:61
-#. i18n: ectx: property (text), widget (QTreeWidget, treeWidget)
-#: rc.py:33
-msgid "Size"
-msgstr "الحجم"
-
-#. i18n: file: printer-applet.ui:66
-#. i18n: ectx: property (text), widget (QTreeWidget, treeWidget)
-#: rc.py:36
-msgid "Time Submitted"
-msgstr "وقت التسليم"
-
-#. i18n: file: printer-applet.ui:71
-#. i18n: ectx: property (text), widget (QTreeWidget, treeWidget)
-#: rc.py:39
-msgid "Status"
-msgstr "الحالة"
-
-#. i18n: file: printer-applet.ui:89
-#. i18n: ectx: property (title), widget (QMenu, menuFile)
-#: rc.py:42
-msgid "File"
-msgstr "الملف"
-
-#. i18n: file: printer-applet.ui:95
-#. i18n: ectx: property (title), widget (QMenu, menuView)
-#: rc.py:45
-msgid "View"
-msgstr "اعرض"
-
-#. i18n: file: printer-applet.ui:104
-#. i18n: ectx: property (title), widget (QMenu, menuSettings)
-#: rc.py:48
-msgid "Settings"
-msgstr "الإعدادات"
-
-#. i18n: file: printer-applet.ui:124
-#. i18n: ectx: property (text), widget (QStatusBar, statusbar)
-#: rc.py:54
-msgid "Refresh"
-msgstr "أنعش"
-
-#. i18n: file: printer-applet.ui:141
-#. i18n: ectx: property (text), widget (QStatusBar, statusbar)
-#: rc.py:60
-msgid "Close"
-msgstr "أغلق"
-
-#: statereason.py:80
-msgid "Toner low"
-msgstr "حبر التصوير منخفض"
-
-#: statereason.py:81
-msgid "Printer '%1' is low on toner."
-msgstr "حبر تصوير الطابعة '%1' منخفض"
-
-#: statereason.py:82
-msgid "Toner empty"
-msgstr "حبر التصوير فارغ"
-
-#: statereason.py:83
-msgid "Printer '%1' has no toner left."
-msgstr "لم يتبقى حبر تصوير في الطابعة '%1'"
-
-#: statereason.py:84
-msgid "Cover open"
-msgstr "فتح الغطاء"
-
-#: statereason.py:85
-msgid "The cover is open on printer '%1'."
-msgstr "لقد فتح غطاء الطابعة '%1'."
-
-#: statereason.py:86
-msgid "Door open"
-msgstr "فتح الباب"
-
-#: statereason.py:87
-msgid "The door is open on printer '%1'."
-msgstr "لقد فتح باب الطابعة '%1'."
-
-#: statereason.py:88
-msgid "Paper low"
-msgstr "الورق منخفض"
-
-#: statereason.py:89
-msgid "Printer '%1' is low on paper."
-msgstr "عدد الأوراق في الطابعة '%1' منخفض."
-
-#: statereason.py:90
-msgid "Out of paper"
-msgstr "بدون ورق"
-
-#: statereason.py:91
-msgid "Printer '%1' is out of paper."
-msgstr "الطابعة '%1' بدون ورق."
-
-#: statereason.py:92
-msgid "Ink low"
-msgstr "الحبر منخفض"
-
-#: statereason.py:93
-msgid "Printer '%1' is low on ink."
-msgstr "مستوى حبر الطابعة '%1' منخفض."
-
-#: statereason.py:94
-msgid "Ink empty"
-msgstr "لا يوجد حبر"
-
-#: statereason.py:95
-msgid "Printer '%1' has no ink left."
-msgstr "لم يتبقى حبر في الطابعة '%1'."
-
-#: statereason.py:96
-msgid "Printer off-line"
-msgstr "الطابعة خارج الخط"
-
-#: statereason.py:97
-msgid "Printer `%1' is currently offline."
-msgstr "الطابعة '%1' حاليا خارج الخط."
-
-#: statereason.py:98
-msgid "Not connected?"
-msgstr "ليست متصلة ؟"
-
-#: statereason.py:99
-msgid "Printer '%1' may not be connected."
-msgstr "قد تكون الطابعة '%1' غير متصلة."
-
-#: statereason.py:100 statereason.py:112
-msgid "Printer error"
-msgstr "خطأ الطابعة"
-
-#: statereason.py:101
-msgid "There is a problem on printer `%1'."
-msgstr "توجد مشكلة في الطابعة '%1'."
-
-#: statereason.py:108
-msgid "Printer report"
-msgstr "تقرير الطابعة"
-
-#: statereason.py:110
-msgid "Printer warning"
-msgstr "تحذير الطابعة"
-
-#: statereason.py:113
-msgid "Printer '%1': '%2'."
-msgstr "الطابعة '%1': '%2'."
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/processcore.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/processcore.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/processcore.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/processcore.po	2012-03-23 06:42:06.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:08+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:47+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: process.cpp:37 process.cpp:47
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/processui.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/processui.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/processui.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/processui.po	2012-03-23 06:42:06.000000000 +0000
@@ -13,7 +13,7 @@
 "Project-Id-Version: processui\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:13+0000\n"
+"PO-Revision-Date: 2012-03-12 22:26+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: American English <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
@@ -21,8 +21,8 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:08+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:48+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: ProcessModel.cpp:65
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/randrmonitor.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/randrmonitor.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/randrmonitor.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/randrmonitor.po	2012-03-23 06:42:06.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:09+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:48+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: randrmonitor.cpp:91
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/rellinks.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/rellinks.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/rellinks.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/rellinks.po	2012-03-23 06:42:00.000000000 +0000
@@ -15,8 +15,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:53+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:27+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: plugin_rellinks.cpp:56
 msgid "Rellinks"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/remote-widgets-browser.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/remote-widgets-browser.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/remote-widgets-browser.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/remote-widgets-browser.po	2012-03-23 06:42:06.000000000 +0000
@@ -14,8 +14,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:10+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:49+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: main.cpp:38
 msgid "Explore the Plasma Widgets shared on the network"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/searchbarplugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/searchbarplugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/searchbarplugin.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/searchbarplugin.po	2012-03-23 06:42:00.000000000 +0000
@@ -3,40 +3,41 @@
 #
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: searchbarplugin\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2009-03-20 14:18+0000\n"
+"PO-Revision-Date: 2012-03-12 22:31+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:54+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:28+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: WebShortcutWidget.cpp:43
 msgid "Set Uri Shortcuts"
-msgstr ""
+msgstr "ضع اختصار الرابط"
 
 #: WebShortcutWidget.cpp:57
 msgid "Name:"
-msgstr ""
+msgstr "الاسم:"
 
 #: WebShortcutWidget.cpp:61
 msgid "Shortcuts:"
-msgstr ""
+msgstr "الاختصارات:"
 
 #: WebShortcutWidget.cpp:71
 msgid "Ok"
-msgstr ""
+msgstr "موافق"
 
 #: WebShortcutWidget.cpp:76
 msgid "Cancel"
-msgstr ""
+msgstr "ألغ"
 
 #. i18n: file: searchbar.rc:3
 #. i18n: ectx: ToolBar (locationToolBar)
@@ -71,8 +72,8 @@
 #: searchbar.cpp:325
 #, kde-format
 msgid "Add %1..."
-msgstr ""
+msgstr "أضف %1..."
 
 #: searchbar.cpp:571
 msgid "Enable Suggestion"
-msgstr ""
+msgstr "مكن الاقتراحات"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/solidcontrol.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/solidcontrol.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/solidcontrol.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/solidcontrol.po	2012-03-23 06:42:06.000000000 +0000
@@ -17,8 +17,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:12+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:49+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: managerbase.cpp:61
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/solid-hardware.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/solid-hardware.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/solid-hardware.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/solid-hardware.po	2012-03-23 06:41:59.000000000 +0000
@@ -7,24 +7,25 @@
 # Abdulaziz AlSharif <a.a-a.s@hotmail.com>, 2007.
 # Usama Akkad <uak@aya.sy>, 2008.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: solid-hardware\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-08-25 17:23+0000\n"
-"PO-Revision-Date: 2009-07-24 13:27+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
+"PO-Revision-Date: 2012-03-12 22:42+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:27+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:12+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: solid-hardware.cpp:45
 msgid "solid-hardware"
-msgstr "العتاد-سولد"
+msgstr "العتاد-الثابت"
 
 #: solid-hardware.cpp:47
 msgid "KDE tool for querying your hardware from the command line"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/solid-network.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/solid-network.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/solid-network.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/solid-network.po	2012-03-23 06:42:06.000000000 +0000
@@ -18,8 +18,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:11+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:49+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: solid-network.cpp:53
 msgid "solid-network"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/solid_qt.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/solid_qt.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/solid_qt.po	2012-02-23 06:20:16.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/solid_qt.po	2012-03-23 06:41:47.000000000 +0000
@@ -1,27 +1,26 @@
-# SOME DESCRIPTIVE TITLE.
 # Copyright (C) YEAR THE PACKAGE'S COPYRIGHT HOLDER
 # This file is distributed under the same license as the PACKAGE package.
-# FIRST AUTHOR <EMAIL@ADDRESS>, YEAR.
 #
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: solid_qt\n"
 "Report-Msgid-Bugs-To: \n"
 "POT-Creation-Date: 2011-09-07 13:46+0000\n"
-"PO-Revision-Date: 2010-08-04 05:29+0000\n"
-"Last-Translator: محمد الحرقان <Unknown>\n"
+"PO-Revision-Date: 2012-03-12 23:04+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 22:56+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:14+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: deviceinterface.cpp:68
 msgctxt "Unknown device type"
 msgid "Unknown"
-msgstr "غير معروف"
+msgstr "مجهول"
 
 #: deviceinterface.cpp:70
 msgctxt "Generic Interface device type"
@@ -121,16 +120,16 @@
 #: deviceinterface.cpp:109
 msgctxt "Internet Gateway device type"
 msgid "Internet Gateway Device"
-msgstr ""
+msgstr "جهاز واجهة الشابكة"
 
 #: deviceinterface.cpp:111
 msgctxt "Network Share device type"
 msgid "Network Share"
-msgstr ""
+msgstr "المشاركة عبر الشبكة"
 
 #: backends/udev/udevmanager.cpp:187
 msgid "Devices"
-msgstr ""
+msgstr "أجهزة"
 
 #: backends/udev/udevmanager.cpp:188
 msgid "Devices declared in your system"
@@ -138,19 +137,19 @@
 
 #: backends/udev/udevdevice.cpp:176
 msgid "Computer"
-msgstr ""
+msgstr "الحاسوب"
 
 #: backends/udev/udevdevice.cpp:180
 msgid "Processor"
-msgstr ""
+msgstr "معالج"
 
 #: backends/udev/udevdevice.cpp:183
 msgid "Portable Media Player"
-msgstr ""
+msgstr "مشغل الوسائط المحمول"
 
 #: backends/udev/udevdevice.cpp:185
 msgid "Camera"
-msgstr ""
+msgstr "آلة تصوير"
 
 #: backends/hal/haldevice.cpp:351
 msgid "WLAN Interface"
@@ -162,15 +161,15 @@
 
 #: backends/upnp/upnpdevicemanager.cpp:104
 msgid "UPnP Devices"
-msgstr ""
+msgstr "أجهزة UPnP"
 
 #: backends/upnp/upnpdevicemanager.cpp:105
 msgid "UPnP devices detected on your network"
-msgstr ""
+msgstr "اكتشف جهاز UPnP على شبكتك"
 
 #: backends/fstab/fstabmanager.cpp:85
 msgid "Network Shares"
-msgstr ""
+msgstr "المشاركات عبر الشبكة"
 
 #: backends/fstab/fstabmanager.cpp:86
 msgid "NFS and SMB shares declared in your system"
@@ -178,46 +177,46 @@
 
 #: backends/upower/upowermanager.cpp:83
 msgid "Power Management"
-msgstr ""
+msgstr "إدارة الطاقة"
 
 #: backends/upower/upowermanager.cpp:84
 msgid "Batteries and other sources of power"
-msgstr ""
+msgstr "البطاريات ومصادر الطاقة الأخرى"
 
 #: backends/upower/upowerdevice.cpp:102
 msgid "A/C Adapter"
-msgstr ""
+msgstr "محوّل كهرباء"
 
 #: backends/upower/upowerdevice.cpp:104
 #, qt-format
 msgctxt "%1 is battery technology"
 msgid "%1 Battery"
-msgstr ""
+msgstr "البطارية %1"
 
 #: backends/upower/upowerdevice.cpp:115
 msgctxt "battery technology"
 msgid "Lithium Ion"
-msgstr ""
+msgstr "أيونات الليثيوم"
 
 #: backends/upower/upowerdevice.cpp:117
 msgctxt "battery technology"
 msgid "Lithium Polymer"
-msgstr ""
+msgstr "الليثيوم المبلمر"
 
 #: backends/upower/upowerdevice.cpp:119
 msgctxt "battery technology"
 msgid "Lithium Iron Phosphate"
-msgstr ""
+msgstr "فوسفات حديد الليثيوم"
 
 #: backends/upower/upowerdevice.cpp:121
 msgctxt "battery technology"
 msgid "Lead Acid"
-msgstr ""
+msgstr "حمض ورصاص"
 
 #: backends/upower/upowerdevice.cpp:123
 msgctxt "battery technology"
 msgid "Nickel Cadmium"
-msgstr ""
+msgstr "نكل وكاديوم"
 
 #: backends/upower/upowerdevice.cpp:125
 msgctxt "battery technology"
@@ -227,7 +226,7 @@
 #: backends/upower/upowerdevice.cpp:127
 msgctxt "battery technology"
 msgid "Unknown"
-msgstr ""
+msgstr "مجهول"
 
 #: backends/hal/haldevice.cpp:72
 #, qt-format
@@ -358,14 +357,14 @@
 msgctxt ""
 "%1 is CD-ROM/CD-R/etc; %2 is '/DVD-ROM'/'/DVD-R'/etc (with leading slash)"
 msgid "External %1%2 Drive"
-msgstr ""
+msgstr "سواقة %1%2 خارجيه"
 
 #: backends/hal/haldevice.cpp:622 backends/udisks/udisksdevice.cpp:292
 #, qt-format
 msgctxt ""
 "%1 is CD-ROM/CD-R/etc; %2 is '/DVD-ROM'/'/DVD-R'/etc (with leading slash)"
 msgid "%1%2 Drive"
-msgstr ""
+msgstr "سواقة %1%2"
 
 #: backends/hal/haldevice.cpp:619
 msgid "External Floppy Drive"
@@ -553,27 +552,27 @@
 
 #: backends/udisks/udisksmanager.cpp:89
 msgid "Storage"
-msgstr ""
+msgstr "تخزين"
 
 #: backends/udisks/udisksmanager.cpp:90
 msgid "Storage devices"
-msgstr ""
+msgstr "وسائط تخزين"
 
 #: backends/udisks/udisksdevice.cpp:727
 msgid "You are not authorized to perform this operation."
-msgstr ""
+msgstr "غير مصرّح لك بتنفيذ هذه العمليّة."
 
 #: backends/udisks/udisksdevice.cpp:729
 msgid "The device is currently busy."
-msgstr ""
+msgstr "هذا الجهاز مشغول حاليًّا."
 
 #: backends/udisks/udisksdevice.cpp:731
 msgid "The requested operation has failed."
-msgstr ""
+msgstr "فشلت العمليّة المطلوبة."
 
 #: backends/udisks/udisksdevice.cpp:733
 msgid "The requested operation has been canceled."
-msgstr ""
+msgstr "ألغيت العمليةالمطلوبة."
 
 #: backends/udisks/udisksdevice.cpp:735
 msgid "An invalid or malformed option has been given."
@@ -581,11 +580,11 @@
 
 #: backends/udisks/udisksdevice.cpp:737
 msgid "The kernel driver for this filesystem type is not available."
-msgstr ""
+msgstr "مشغّل نظام الملفات هذا غير متوفّر."
 
 #: backends/udisks/udisksdevice.cpp:739
 msgid "An unspecified error has occurred."
-msgstr ""
+msgstr "حدث خطأ غير محدّد."
 
 #: backends/kupnp/internetgatewaydevice1.cpp:68
 msgid "UPnP Internet Gateway Device"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/soliduiserver.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/soliduiserver.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/soliduiserver.po	2012-02-23 06:20:27.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/soliduiserver.po	2012-03-23 06:41:59.000000000 +0000
@@ -18,8 +18,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:27+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:12+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 
 #: devicenothingaction.cpp:28
 msgid "Do nothing"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/spy.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/spy.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/spy.po	1970-01-01 00:00:00.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/spy.po	2012-03-23 06:41:43.000000000 +0000
@@ -0,0 +1,60 @@
+# translation of spy.po to
+# Copyright (C) 2004, 2007 Free Software Foundation, Inc.
+#
+# Ahmad M. Zawawi <azawawi@emirates.net.ae>, 2004.
+# Youssef Chahibi <chahibi@gmail.com>, 2007.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
+msgid ""
+msgstr ""
+"Project-Id-Version: spy\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-09-08 16:09+0000\n"
+"PO-Revision-Date: 2012-03-12 23:01+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:27+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: \n"
+
+#: classinfoview.cpp:31 navview.cpp:31 propsview.cpp:34
+msgid "Name"
+msgstr "الاسم"
+
+#: classinfoview.cpp:31 propsview.cpp:34
+msgid "Value"
+msgstr "القيمة"
+
+#: navview.cpp:31 propsview.cpp:34
+msgid "Type"
+msgstr "النوع"
+
+#: propsview.cpp:35
+msgid "Access"
+msgstr "النفاذ"
+
+#: propsview.cpp:35
+msgid "Designable"
+msgstr "ممكن تصميمه"
+
+#: propsview.cpp:35
+msgid "Type Flags"
+msgstr "أعلام النوع"
+
+#: sigslotview.cpp:29
+msgid "Signals/Slots"
+msgstr "الإشارات أو المقابس"
+
+#: spy.cpp:69
+msgid "Properties"
+msgstr "خصائص"
+
+#: spy.cpp:72
+msgid "Signals && Slots"
+msgstr "الإشارات والمقابس"
+
+#: spy.cpp:75
+msgid "Class Info"
+msgstr "معلومات الفئة"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/strigila_diff.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/strigila_diff.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/strigila_diff.po	1970-01-01 00:00:00.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/strigila_diff.po	2012-03-23 06:41:43.000000000 +0000
@@ -0,0 +1,73 @@
+# translation of strigila_diff.po to
+# Copyright (C) YEAR This_file_is_part_of_KDE
+# This file is distributed under the same license as the PACKAGE package.
+#
+# Youssef Chahibi <chahibi@gmail.com>, 2007.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
+msgid ""
+msgstr ""
+"Project-Id-Version: strigila_diff\n"
+"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
+"POT-Creation-Date: 2011-09-08 16:09+0000\n"
+"PO-Revision-Date: 2012-03-12 23:02+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
+"Language-Team: Arabic <doc@arabeyes.org>\n"
+"MIME-Version: 1.0\n"
+"Content-Type: text/plain; charset=UTF-8\n"
+"Content-Transfer-Encoding: 8bit\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:27+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: \n"
+
+#: difflineanalyzer.cpp:388
+msgid "CVSDiff"
+msgstr ""
+
+#: difflineanalyzer.cpp:389
+msgid "Diff"
+msgstr "الاختلافات"
+
+#: difflineanalyzer.cpp:390
+msgid "Diff3"
+msgstr ""
+
+#: difflineanalyzer.cpp:391
+msgid "Perforce"
+msgstr ""
+
+#: difflineanalyzer.cpp:392
+msgid "Subversion"
+msgstr "Subversion"
+
+#: difflineanalyzer.cpp:393 difflineanalyzer.cpp:395 difflineanalyzer.cpp:409
+#: difflineanalyzer.cpp:412
+msgid "Unknown"
+msgstr "مجهول"
+
+#: difflineanalyzer.cpp:403
+msgid "Context"
+msgstr "السياق"
+
+#: difflineanalyzer.cpp:404
+msgid "Ed"
+msgstr ""
+
+#: difflineanalyzer.cpp:405
+msgid "Normal"
+msgstr "عادي"
+
+#: difflineanalyzer.cpp:406
+msgid "RCS"
+msgstr "RCS"
+
+#: difflineanalyzer.cpp:407
+msgid "Unified"
+msgstr "موحّد"
+
+#: difflineanalyzer.cpp:408
+msgid "Not Available (file empty)"
+msgstr "غير متوفّر (الملف فارغ)"
+
+#: difflineanalyzer.cpp:410
+msgid "Side by Side"
+msgstr "جنبًا إلى جنب"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/superkaramba.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/superkaramba.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/superkaramba.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/superkaramba.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,337 +0,0 @@
-# translation of superkaramba.po to
-#
-# Khaled Hosny <dr.khaled.hosny@gmail.com>, 2006.
-# Fahad Al-Saidi <fahad.alsaidi@gmail.com>, 2007.
-# Youssef Chahibi <chahibi@gmail.com>, 2007.
-# Youness BOUTYOUR <niceboy@linuxac.org>, 2008.
-msgid ""
-msgstr ""
-"Project-Id-Version: superkaramba\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 13:31+0000\n"
-"PO-Revision-Date: 2012-01-25 08:07+0000\n"
-"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
-"Language-Team: French <kde-i18n-doc@lists.kde.org>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
-"3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:13+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"Language: fr\n"
-
-#: karamba.cpp:1457
-msgid "Update"
-msgstr "حدث"
-
-#: karamba.cpp:1460 karamba.cpp:1463
-msgid "&Locked Position"
-msgstr "إقفال الم&وضع"
-
-#: karamba.cpp:1470
-msgid "Configure &Theme"
-msgstr "أعد ال&سمة"
-
-#: karamba.cpp:1481
-msgid "To Des&ktop"
-msgstr "إلى &سطح المكتب"
-
-#: karamba.cpp:1484
-msgid "&All Desktops"
-msgstr "كل أ&سطح المكتب"
-
-#: karamba.cpp:1490
-msgid "Desktop"
-msgstr "سطح المكتب"
-
-#: karamba.cpp:1498
-msgid "&Reload Theme"
-msgstr "أ&عد تحميل السمة"
-
-#: karamba.cpp:1504
-msgid "&Close This Theme"
-msgstr "أ&غلق هذه السمة"
-
-#: karambaapp.cpp:148
-msgid ""
-"Please enable the desktop effects to get full transparency support in "
-"SuperKaramba."
-msgstr ""
-"الرجاء تفعيل تأثيرات سطح المكتب للحصول على الشفافية المدعومة في سوبركارامبا."
-
-#: karambaapp.cpp:168 main.cpp:84
-msgid "SuperKaramba"
-msgstr "سوبركارامبا"
-
-#: karambaapp.cpp:175
-#, kde-format
-msgid "1 Running Theme:"
-msgid_plural "%1 Running Themes:"
-msgstr[0] "لم تشغل أي سمة:"
-msgstr[1] "سمة واحدة تعمل:"
-msgstr[2] "سمتان تعملان:"
-msgstr[3] "%1 سمات تعمل"
-msgstr[4] "%1 سمة تعمل:"
-msgstr[5] "%1 سمة تعمل:"
-
-#: karambaapp.cpp:196
-msgid ""
-"<qt>Hiding the system tray icon will keep SuperKaramba running in "
-"background. To show it again use the theme menu.</qt>"
-msgstr ""
-"<qt>إخفاء أيقونة لوحة النظام سيبقى سوبركارامبا يعمل فى الخلفية. لإظهارة مرة "
-"أخرى استخدم قائمة خيارات السمات.</qt>"
-
-#: karambaapp.cpp:198
-msgid "Hiding System Tray Icon"
-msgstr "إخفاء أيقونة لوحة النظام"
-
-#: karambaapp.cpp:220
-msgid "Show System Tray Icon"
-msgstr "أظهر أيقونة لوحة النظام"
-
-#: karambaapp.cpp:225
-msgid "&Manage Themes..."
-msgstr "أ&دّر السمات..."
-
-#: karambaapp.cpp:229
-msgid "&Quit SuperKaramba"
-msgstr "أنهئ سوبركارامبا"
-
-#: karambaapp.cpp:264
-msgid "Hide System Tray Icon"
-msgstr "أخفي أيقونة لوحة النظام"
-
-#: karambainterface.cpp:107
-msgid ""
-"SuperKaramba cannot continue to run this theme.One or more of the required "
-"components of the Kross scripting architecture is not installed. Please "
-"consult this theme's documentation and install the necessary Kross "
-"components."
-msgstr ""
-"سوبركارمبا لا يمكن أن يستمر في تشغيل هذه السمة. متطلب أو أكثر من مكونات "
-"معمارية سكربتات kross لم تثبت. رجاءا راجع مستندات هذه السمة و ثبت مكونات "
-"kross الضرورية."
-
-#: karambainterface.cpp:110
-msgid "Please install additional Kross components"
-msgstr "رجاءا ثبت مكونات kross الإضافية"
-
-#: main.cpp:42
-msgid "A KDE Eye-candy Application"
-msgstr "تطبيق كدى جمالى"
-
-#: main.cpp:87
-msgid "(c) 2003-2007 The SuperKaramba developers"
-msgstr ""
-
-#: main.cpp:89
-msgid "Adam Geitgey"
-msgstr "Adam Geitgey"
-
-#: main.cpp:90
-msgid "Hans Karlsson"
-msgstr "Hans Karlsson"
-
-#: main.cpp:91
-msgid "Ryan Nickell"
-msgstr "Ryan Nickell"
-
-#: main.cpp:92
-msgid "Petri Damstén"
-msgstr "Petri Damstén"
-
-#: main.cpp:93
-msgid "Alexander Wiedenbruch"
-msgstr "Alexander Wiedenbruch"
-
-#: main.cpp:94
-msgid "Luke Kenneth Casson Leighton"
-msgstr "Luke Kenneth Casson Leighton"
-
-#: main.cpp:95
-msgid "Sebastian Sauer"
-msgstr "Sebastian Sauer"
-
-#: main.cpp:95
-msgid "Work on Kross, tutorials and examples"
-msgstr "العمل على Kross و الأمثلة والدروس"
-
-#: main.cpp:102
-msgid ""
-"Use the original python bindings as scripting backend. Off by default."
-msgstr "استخدم روابط بايثون الأصلية كخلفية للسكربتات. معطل بشكل افتراضي."
-
-#: main.cpp:104
-msgid "A required argument 'file'"
-msgstr "معامل مطلوب 'file'"
-
-#: rc.cpp:40
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr ""
-"خالد حسنى , فهد السعيدي, ,Launchpad Contributions:,Khaled Hosny,Youssef "
-"Chahibi,o88o"
-
-#: rc.cpp:41
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr ""
-"dr.khaled.hosny@gmail.com, Fahad.alsaidi@gmail.com,,,khaledhosny@eglug.org,,"
-
-#. i18n: file: superkarambaui.rc:4
-#. i18n: ectx: Menu (custom)
-#: rc.cpp:9
-msgid "C&ustom"
-msgstr "مُ&خصَّص"
-
-#. i18n: file: superkaramba.kcfg:7
-#. i18n: ectx: label, entry (ShowSysTray), group (general)
-#: rc.cpp:3
-msgid "Show system tray icon."
-msgstr "إظهار أيقونة لوحة النظام."
-
-#. i18n: file: superkaramba.kcfg:13
-#. i18n: ectx: label, entry (UserAddedThemes), group (themes)
-#: rc.cpp:6
-msgid "Themes that user added to theme list."
-msgstr "السمات التى أضافها المستخدم الى قائمة السمات."
-
-#. i18n: file: themes_layout.ui:19
-#. i18n: ectx: property (windowTitle), widget (QDialog, ThemesLayout)
-#: rc.cpp:12 rc.cpp:44
-msgid "SuperKaramba Themes"
-msgstr "سمات سوبر كارامبا"
-
-#. i18n: file: themes_layout.ui:39
-#. i18n: ectx: property (text), widget (QLabel, labelSearch)
-#: rc.cpp:15 rc.cpp:47
-msgid "&Search:"
-msgstr "&بحث:"
-
-#. i18n: file: themes_layout.ui:52
-#. i18n: ectx: property (text), widget (QLabel, labelShow)
-#: rc.cpp:18 rc.cpp:50
-msgid "S&how:"
-msgstr "&إظهار:"
-
-#. i18n: file: themes_layout.ui:63
-#. i18n: ectx: property (text), item, widget (QComboBox, comboShow)
-#: rc.cpp:21 rc.cpp:53
-msgid "All"
-msgstr "الكل"
-
-#. i18n: file: themes_layout.ui:68
-#. i18n: ectx: property (text), item, widget (QComboBox, comboShow)
-#: rc.cpp:24 rc.cpp:56
-msgid "Running"
-msgstr "يعمل"
-
-#. i18n: file: themes_layout.ui:123
-#. i18n: ectx: property (text), widget (KPushButton, buttonAddToDesktop)
-#: rc.cpp:27 rc.cpp:59
-msgid "&Add to Desktop"
-msgstr "الإضافة إلى سطح المكتب"
-
-#. i18n: file: themes_layout.ui:139
-#. i18n: ectx: property (text), widget (KPushButton, buttonClose)
-#: rc.cpp:30 rc.cpp:62
-msgid "&Close"
-msgstr "&أغلق"
-
-#. i18n: file: themewidget_layout.ui:53
-#. i18n: ectx: property (text), widget (QLabel, running)
-#: rc.cpp:33 rc.cpp:65
-msgid "<p align=\"center\">1 running</p>"
-msgstr "<p align=\"center\">1 يعمل</p>"
-
-#. i18n: file: themewidget_layout.ui:83
-#. i18n: ectx: property (text), widget (QLabel, themeName)
-#: rc.cpp:36 rc.cpp:68
-msgid "Header"
-msgstr "ترويسة"
-
-#. i18n: file: themewidget_layout.ui:98
-#. i18n: ectx: property (text), widget (QLabel, description)
-#: rc.cpp:39 rc.cpp:71
-msgid "Description"
-msgstr "الوصف"
-
-#: taskmanager.cpp:742
-msgid "modified"
-msgstr "معدّل"
-
-#: themefile.cpp:279
-#, kde-format
-msgid ""
-"You are about to install and run %1 SuperKaramba theme. Since themes can "
-"contain executable code you should only install themes from sources that you "
-"trust. Continue?"
-msgstr ""
-"أنت على وشك تثبيت وتشغيل سمة سوبركارامبا %1. حيث أنه من الممكن أن تحتوى "
-"السمة على نص برمجى تنفيذى يجب عليك تثبيت السمات من مصادر موثوقة فقط. أترغب "
-"فى المتابعة؟"
-
-#: themefile.cpp:283
-msgid "Executable Code Warning"
-msgstr "تحذير نص برمجى تنفيذى"
-
-#: themefile.cpp:284
-msgid "Install"
-msgstr "ثبّت"
-
-#: themefile.cpp:295
-#, kde-format
-msgid "%1 already exists. Do you want to overwrite it?"
-msgstr "%1 موجودة بالفعل. أترغب فى الكتابة فوقها؟"
-
-#: themefile.cpp:296
-msgid "File Exists"
-msgstr "الملف موجود"
-
-#: themefile.cpp:297
-msgid "Overwrite"
-msgstr "اكتب فوقه"
-
-#: themesdlg.cpp:113
-msgid "Get New Stuff"
-msgstr "احصل على مواد جديدة"
-
-#: themesdlg.cpp:114
-msgid "Download new themes."
-msgstr "نزل سمات جديدة."
-
-#: themesdlg.cpp:116
-msgid "New Stuff..."
-msgstr "مواد جديدة..."
-
-#: themesdlg.cpp:126
-msgid "Open Local Theme"
-msgstr "افتح سمة محلية"
-
-#: themesdlg.cpp:127
-msgid "Add local theme to the list."
-msgstr "أضف سمة محلية إلى القائمة."
-
-#: themesdlg.cpp:129
-msgctxt "Open theme button"
-msgid "Open..."
-msgstr "افتح ..."
-
-#: themesdlg.cpp:147 themesdlg.cpp:159 themesdlg.cpp:337
-msgid "Uninstall"
-msgstr "أزل التثبيت"
-
-#: themesdlg.cpp:193
-msgid "*.theme *.skz|Themes"
-msgstr "سمات|*.theme *.skz"
-
-#: themesdlg.cpp:194
-msgid "Open Themes"
-msgstr "افتح السمات"
-
-#: themewidget.cpp:78
-#, kde-format
-msgid "<p align=\"center\">%1 running</p>"
-msgstr "<p align=\"center\">%1 يعمل</p>"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/sweeper.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/sweeper.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/sweeper.po	2012-02-23 06:20:12.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/sweeper.po	1970-01-01 00:00:00.000000000 +0000
@@ -1,258 +0,0 @@
-# translation of sweeper.po to
-# Copyright (C) 2004, 2006, 2007 Free Software Foundation, Inc.
-# Ahmad M. Zawawi <azawawi@emirates.net.ae>, 2004.
-# Munzir Taha <munzir@kacst.edu.sa>, 2004.
-# محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
-# Fahad Al-Saidi <fahad.alsaidi@gmail.com>, 2007.
-# Youssef Chahibi <chahibi@gmail.com>, 2007.
-# Youness BOUTYOUR <niceboy@linuxac.org>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
-#
-msgid ""
-msgstr ""
-"Project-Id-Version: sweeper\n"
-"Report-Msgid-Bugs-To: http://bugs.kde.org\n"
-"POT-Creation-Date: 2011-09-08 13:31+0000\n"
-"PO-Revision-Date: 2012-01-25 11:07+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
-"MIME-Version: 1.0\n"
-"Content-Type: text/plain; charset=UTF-8\n"
-"Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 21:14+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
-"Language: ar\n"
-
-#: main.cpp:28
-msgid "Sweeper"
-msgstr "سويبر ( الكناس)"
-
-#: main.cpp:29
-msgid "Helps clean unwanted traces the user leaves on the system."
-msgstr "يساعد في تنظيف الأثار غير المرغوب بها التي يتركها المستخدم في النظام"
-
-#: main.cpp:30
-msgid "(c) 2003-2005, Ralf Hoelzer"
-msgstr "(c) 2003-2005, Ralf Hoelzer"
-
-#: main.cpp:33
-msgid "Ralf Hoelzer"
-msgstr "Ralf Hoelzer"
-
-#: main.cpp:33
-msgid "Original author"
-msgstr "المؤلف الأصلي"
-
-#: main.cpp:34
-msgid "Brian S. Stephan"
-msgstr "Brian S. Stephan"
-
-#: main.cpp:34
-msgid "Maintainer"
-msgstr "المشرف"
-
-#: main.cpp:35
-msgid "Benjamin Meyer"
-msgstr "Benjamin Meyer"
-
-#: main.cpp:35 privacyfunctions.h:67
-msgid "Thumbnail Cache"
-msgstr "خابية المصغرة"
-
-#: main.cpp:42
-msgid "Sweeps without user interaction"
-msgstr "نظف بدون تدخل المستخدم"
-
-#: privacyfunctions.cpp:50 privacyfunctions.cpp:59 privacyfunctions.cpp:68
-msgid "A thumbnail could not be removed."
-msgstr "االمصغرة لا يمكن أن تزال."
-
-#: privacyfunctions.cpp:132
-msgid "The file exists but could not be removed."
-msgstr "الملف موجود ولكن لا يمكن أن يزال."
-
-#: privacyfunctions.cpp:202
-msgid "A favicon could not be removed."
-msgstr "فايكون لا يمكن أن يزال."
-
-#: rc.cpp:22
-msgctxt "NAME OF TRANSLATORS"
-msgid "Your names"
-msgstr ""
-"أحمد محمد زواوي,منذر طه,Mohamed SAAD محمد سعد, فهد السعيدي, ,Launchpad "
-"Contributions:,Youssef Chahibi"
-
-#: rc.cpp:23
-msgctxt "EMAIL OF TRANSLATORS"
-msgid "Your emails"
-msgstr ""
-"azawawi@emirates.net.ae,munzir@kacst.edu.sa,metehyi@free.fr, "
-"Fahad.alsaidi@gmail.com,,,"
-
-#. i18n: file: sweeperdialog.ui:27
-#. i18n: ectx: property (whatsThis), widget (QTreeWidget, privacyListView)
-#: rc.cpp:3
-msgid ""
-"Check all cleanup actions you would like to perform. These will be executed "
-"by pressing the button below."
-msgstr ""
-"إختر كل عمليّات التنظيف التي تريد إنجازها. وهذه سوف تنفّذ بالضغط على الزر في "
-"الأسفل."
-
-#. i18n: file: sweeperdialog.ui:37
-#. i18n: ectx: property (text), widget (QTreeWidget, privacyListView)
-#: rc.cpp:6
-msgid "Privacy Settings"
-msgstr "إعدادات الخصوصية"
-
-#. i18n: file: sweeperdialog.ui:42
-#. i18n: ectx: property (text), widget (QTreeWidget, privacyListView)
-#: rc.cpp:9
-msgid "Description"
-msgstr "الوصف"
-
-#. i18n: file: sweeperdialog.ui:58
-#. i18n: ectx: property (text), widget (KPushButton, selectAllButton)
-#: rc.cpp:12
-msgid "Select &All"
-msgstr "اختر &كل شيء"
-
-#. i18n: file: sweeperdialog.ui:65
-#. i18n: ectx: property (text), widget (KPushButton, selectNoneButton)
-#: rc.cpp:15
-msgid "Select &None"
-msgstr "اختر &لا شيء"
-
-#. i18n: file: sweeperdialog.ui:88
-#. i18n: ectx: property (whatsThis), widget (KPushButton, cleanupButton)
-#: rc.cpp:18
-msgid "Immediately performs the cleanup actions selected above"
-msgstr "يقوم بإنجاز عمليّات التنظيف المحدّدة أعلاه فوراً"
-
-#. i18n: file: sweeperdialog.ui:91
-#. i18n: ectx: property (text), widget (KPushButton, cleanupButton)
-#: rc.cpp:21
-msgid "&Clean Up"
-msgstr "&نظّف"
-
-#: sweeper.cpp:51
-msgctxt "General system content"
-msgid "General"
-msgstr "عام"
-
-#: sweeper.cpp:53
-msgctxt "Web browsing content"
-msgid "Web Browsing"
-msgstr "تصفح الويب"
-
-#: sweeper.cpp:128
-msgid ""
-"You are deleting data that is potentially valuable to you. Are you sure?"
-msgstr "أنت تقوم بمحو بيانات ربما قد تكون ذات أهمية لك ، هل أنت متأكِّد ؟"
-
-#: sweeper.cpp:134
-msgid "Starting cleanup..."
-msgstr "جاري بدء التنظيف..."
-
-#: sweeper.cpp:140
-#, kde-format
-msgid "Clearing %1..."
-msgstr "جاري المحو %1..."
-
-#: sweeper.cpp:145
-#, kde-format
-msgid "Clearing of %1 failed: %2"
-msgstr "فشل محو %1: %2"
-
-#: sweeper.cpp:151
-msgid "Clean up finished."
-msgstr "انتهت عملية التنظيف."
-
-#: privacyfunctions.h:36
-msgid "Cookies"
-msgstr "الكعكات"
-
-#: privacyfunctions.h:37
-msgid "Clears all stored cookies set by websites"
-msgstr "يمحي كل الكعكات المخزّنة من المواقع"
-
-#: privacyfunctions.h:47
-msgid "Cookie Policies"
-msgstr "سياسات الكعكات"
-
-#: privacyfunctions.h:48
-msgid "Clears the cookie policies for all visited websites"
-msgstr "يمحي سياسات الكعكات لكل المواقع المزارة."
-
-#: privacyfunctions.h:57
-msgid "Saved Clipboard Contents"
-msgstr "محتويات الحافظة المحفوظة"
-
-#: privacyfunctions.h:58
-msgid "Clears the clipboard contents stored by Klipper"
-msgstr "يمحي محتويات الحافظة المخزّنة بواسطة Klipper"
-
-#: privacyfunctions.h:68
-msgid "Clears all cached thumbnails"
-msgstr "يمحي كلّ المصغرات"
-
-#: privacyfunctions.h:77
-msgid "Run Command History"
-msgstr "خطّ زمن أوامر التّشغيل"
-
-#: privacyfunctions.h:78
-msgid ""
-"Clears the history of commands run through the Run Command tool on the "
-"desktop"
-msgstr ""
-"يمحي سجلّ الخطّ الزمني للأوامر التي تمّ تنفيذها من خلال أداة تشغيل الأوامر "
-"على سطح المكتب"
-
-#: privacyfunctions.h:87
-msgid "Form Completion Entries"
-msgstr "خانات إتمام النموذج"
-
-#: privacyfunctions.h:88
-msgid "Clears values which were entered into forms on websites"
-msgstr "يمحي القيم التي أدخلت بالنماذج على المواقع"
-
-#: privacyfunctions.h:97
-msgid "Web History"
-msgstr "الخط الزمني للتَصفَح"
-
-#: privacyfunctions.h:98
-msgid "Clears the history of visited websites"
-msgstr "يمحي سجل خط الزمن لزيارات المواقع"
-
-#: privacyfunctions.h:107
-msgid "Web Cache"
-msgstr "خابية الشبكة"
-
-#: privacyfunctions.h:108
-msgid "Clears the temporary cache of websites visited"
-msgstr "يمحي الخابية المؤقّتة لزيارات المواقع"
-
-#: privacyfunctions.h:117
-msgid "Recent Documents"
-msgstr "المستندات الحديثة"
-
-#: privacyfunctions.h:118
-msgid ""
-"Clears the list of recently used documents from the KDE applications menu"
-msgstr "يمحي لائحة المستندات المستخدمة مؤخراً من قائمة تطبيقات KDE"
-
-#: privacyfunctions.h:127
-msgid "Favorite Icons"
-msgstr "الأيقونات المفضَلة"
-
-#: privacyfunctions.h:128
-msgid "Clears the FavIcons cached from visited websites"
-msgstr "يمحي أيقونات المواقع المخبأة من زيارات المواقع"
-
-#: privacyfunctions.h:137
-msgid "Recent Applications"
-msgstr "التطبيقات الحديثة"
-
-#: privacyfunctions.h:138
-msgid "Clears the list of recently used applications from KDE menu"
-msgstr "يمحي لائحة التطبيقات  المستخدمة  مؤخراً من قائمة تطبيقات كدي"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/systemsettings.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/systemsettings.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/systemsettings.po	2012-02-23 06:20:33.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/systemsettings.po	2012-03-23 06:42:06.000000000 +0000
@@ -11,7 +11,7 @@
 "Project-Id-Version: systemsettings\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 19:16+0000\n"
-"PO-Revision-Date: 2012-01-25 11:12+0000\n"
+"PO-Revision-Date: 2012-03-12 22:26+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
 "Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
 "MIME-Version: 1.0\n"
@@ -19,10 +19,9 @@
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 06:12+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-23 00:50+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: core/ModuleView.cpp:84
 msgid "Reset all current changes to previous values"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/uachangerplugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/uachangerplugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/uachangerplugin.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/uachangerplugin.po	2012-03-23 06:42:00.000000000 +0000
@@ -7,20 +7,21 @@
 # Isam Bayazidi <bayazidi@arabeyes.org>, 2002.
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: uachangerplugin\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2009-07-10 17:30+0000\n"
+"PO-Revision-Date: 2012-03-12 22:33+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:55+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:28+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: rc.cpp:1
 msgctxt "NAME OF TRANSLATORS"
@@ -64,19 +65,19 @@
 #, kde-format
 msgctxt "%1 = browser version (e.g. 2.0)"
 msgid "Version %1"
-msgstr ""
+msgstr "الإصدار %1"
 
 #: uachangerplugin.cpp:169
 #, kde-format
 msgctxt "%1 = browser name, %2 = browser version (e.g. Firefox, 2.0)"
 msgid "%1 %2"
-msgstr ""
+msgstr "%1 %2"
 
 #: uachangerplugin.cpp:175
 #, kde-format
 msgctxt "%1 = browser version, %2 = platform (e.g. 2.0, Windows XP)"
 msgid "Version %1 on %2"
-msgstr ""
+msgstr "الإصدار %1 على %2"
 
 #: uachangerplugin.cpp:178
 #, kde-format
@@ -84,7 +85,7 @@
 "%1 = browser name, %2 = browser version, %3 = platform (e.g. Firefox, 2.0, "
 "Windows XP)"
 msgid "%1 %2 on %3"
-msgstr ""
+msgstr "%1 %2 على %3"
 
 #: uachangerplugin.cpp:232
 msgid "Identify As"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/umbrello.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/umbrello.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/umbrello.po	2012-02-23 06:20:11.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/umbrello.po	2012-03-23 06:41:43.000000000 +0000
@@ -13,8 +13,8 @@
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 20:59+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 19:27+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: \n"
 
 #: cmds/cmd_set_stereotype.cpp:25
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/useraccount.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/useraccount.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/useraccount.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/useraccount.po	2012-03-23 06:42:00.000000000 +0000
@@ -5,27 +5,26 @@
 # AbdulAziz AlSharif <a.a-a.s@hotmail.com>, 2007.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
 # zayed <zayed.alsaidi@gmail.com>, 2008.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010.
+# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2010, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: useraccount\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2012-01-25 11:02+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"PO-Revision-Date: 2012-03-14 17:23+0000\n"
+"Last-Translator: Launchpad Translations Administrators <Unknown>\n"
+"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:56+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:28+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
-"X-Poedit-Language: Arabic\n"
 
 #: chfacedlg.cpp:56
 msgctxt "@title:window"
 msgid "Change your Face"
-msgstr ""
+msgstr "غيّر وجهك"
 
 #: chfacedlg.cpp:60
 msgid "Custom image"
@@ -61,7 +60,7 @@
 #: chfacedlg.cpp:149
 msgctxt "@title:window"
 msgid "Choose Image"
-msgstr ""
+msgstr "اختر الصورة"
 
 #: main.cpp:76
 msgid "Change &Password..."
@@ -164,6 +163,8 @@
 "message was:\n"
 "%1"
 msgstr ""
+"حصل خطأ و من الاحتمال أنّ اسمك لم يتغير.  رسالة الخطأ كانت:\n"
+"%1"
 
 #: main.cpp:263
 #, kde-format
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/validatorsplugin.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/validatorsplugin.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/validatorsplugin.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/validatorsplugin.po	2012-03-23 06:42:00.000000000 +0000
@@ -6,22 +6,23 @@
 # Isam Bayazidi <bayazidi@arabeyes.org>, 2002.
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# zayed <zayed.alsaidi@gmail.com>, 2008, 2009.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2009, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: validatorsplugin\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2010-12-31 11:16+0000\n"
+"PO-Revision-Date: 2012-03-12 22:33+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
 "Plural-Forms: nplurals=6; plural=n==0 ? 0 : n==1 ? 1 : n==2 ? 2 : n % 100 >= "
 "3 && n % 100 <= 10 ? 3 : n % 100 >= 11 && n % 100 <= 99 ? 4 : 5;\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:57+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:29+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: plugin_validators.cpp:60
 msgid "Validate Web Page"
@@ -162,7 +163,7 @@
 #: plugin_validators.cpp:534
 msgctxt "@title:window"
 msgid "Cannot Validate Source"
-msgstr ""
+msgstr "لم أستطع التأكد من الصلاحية المصدر"
 
 #: plugin_validators.cpp:535
 msgid "You cannot validate anything except web pages with this plugin."
@@ -171,7 +172,7 @@
 #: plugin_validators.cpp:546
 msgctxt "@title:window"
 msgid "Malformed URL"
-msgstr ""
+msgstr "عنوان مشوَّه"
 
 #: plugin_validators.cpp:547
 msgid "The URL you entered is not valid, please correct it and try again."
@@ -315,7 +316,7 @@
 #: reportdialog.cpp:63
 msgctxt "@title:window"
 msgid "Validation Report"
-msgstr ""
+msgstr "تقرير المصادقة"
 
 #: reportdialog.cpp:77
 msgctxt "Validation status"
@@ -335,7 +336,7 @@
 #: validatorsdialog.cpp:35
 msgctxt "@title:window"
 msgid "Configure Validator Plugin"
-msgstr ""
+msgstr "اضبط ملحق المصادقة"
 
 #: validatorsdialog.cpp:42
 msgid "Internal Validation"
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/webarchiver.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/webarchiver.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/webarchiver.po	2012-02-23 06:20:28.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/webarchiver.po	2012-03-23 06:42:00.000000000 +0000
@@ -6,25 +6,26 @@
 # Isam Bayazidi <bayazidi@arabeyes.org>, 2002.
 # محمد سعد  Mohamed SAAD <metehyi@free.fr>, 2006.
 # Youssef Chahibi <chahibi@gmail.com>, 2007.
-# zayed <zayed.alsaidi@gmail.com>, 2008.
+# zayed <zayed.alsaidi@gmail.com>, 2008, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: webarchiver\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-09-07 16:13+0000\n"
-"PO-Revision-Date: 2009-03-20 15:09+0000\n"
+"PO-Revision-Date: 2012-03-12 22:33+0000\n"
 "Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
-"Language-Team: Arabic <linuxac-kde-arabic-team@googlegroups.com>\n"
+"Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-22 03:57+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 23:29+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
+"Language: ar\n"
 
 #: archivedialog.cpp:161
 msgctxt "@title:window"
 msgid "Web Archiver"
-msgstr ""
+msgstr "مؤرشف الويب"
 
 #: archivedialog.cpp:171
 msgid "Status"
@@ -37,7 +38,7 @@
 #: archivedialog.cpp:240
 msgctxt "@title:window"
 msgid "Unable to Open Web-Archive"
-msgstr ""
+msgstr "عاجز عن فتح مؤرشف الويب"
 
 #: archivedialog.cpp:241
 #, kde-format
@@ -65,7 +66,7 @@
 #: archivedialog.cpp:421
 #, kde-format
 msgid "I/O error occurred while writing to web archive file %1."
-msgstr ""
+msgstr "خطأ في الدخل/الخرج حدث عند كتابة ملف أرشيف الويب %1."
 
 #: plugin_webarchiver.cpp:58
 msgid "Archive &Web Page..."
@@ -86,7 +87,7 @@
 #: plugin_webarchiver.cpp:100
 msgctxt "@title:window"
 msgid "Invalid URL"
-msgstr ""
+msgstr "رابط غير صالح"
 
 #: plugin_webarchiver.cpp:101
 #, kde-format
@@ -102,7 +103,7 @@
 #: plugin_webarchiver.cpp:115
 msgctxt "@title:window"
 msgid "File Exists"
-msgstr ""
+msgstr "الملف موجود"
 
 #: plugin_webarchiver.cpp:116
 #, kde-format
diff -Nru language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/xml_mimetypes.po language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/xml_mimetypes.po
--- language-pack-kde-ar-base-12.04+20120221/data/ar/LC_MESSAGES/xml_mimetypes.po	2012-02-23 06:20:16.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/data/ar/LC_MESSAGES/xml_mimetypes.po	2012-03-23 06:41:47.000000000 +0000
@@ -1,20 +1,21 @@
 # Copyright (C) YEAR This_file_is_part_of_KDE
 # This file is distributed under the same license as the PACKAGE package.
-# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
 #
+# Zayed Al-Saidi <zayed.alsaidi@gmail.com>, 2009.
+# Abdalrahim Fakhouri <abdilra7eem@yahoo.com>, 2012.
 msgid ""
 msgstr ""
 "Project-Id-Version: xml_mimetypes\n"
 "Report-Msgid-Bugs-To: http://bugs.kde.org\n"
 "POT-Creation-Date: 2011-04-19 13:04+0000\n"
-"PO-Revision-Date: 2011-01-05 22:01+0000\n"
-"Last-Translator: Zayed Amer Al-Saidi <zayed.alsaidi@gmail.com>\n"
+"PO-Revision-Date: 2012-03-12 23:04+0000\n"
+"Last-Translator: Abdalrahim G. Fakhouri <Unknown>\n"
 "Language-Team: Arabic <kde-i18n-doc@kde.org>\n"
 "MIME-Version: 1.0\n"
 "Content-Type: text/plain; charset=UTF-8\n"
 "Content-Transfer-Encoding: 8bit\n"
-"X-Launchpad-Export-Date: 2012-02-21 22:56+0000\n"
-"X-Generator: Launchpad (build 14838)\n"
+"X-Launchpad-Export-Date: 2012-03-22 20:14+0000\n"
+"X-Generator: Launchpad (build 14981)\n"
 "Language: ar\n"
 
 #: kde.xml.podir/kde.xml.in.h:1
@@ -35,11 +36,11 @@
 
 #: kde.xml.podir/kde.xml.in.h:5
 msgid "Calligra Plan project management document"
-msgstr ""
+msgstr "وثيقة إدارة مشاريع Calligra Plan"
 
 #: kde.xml.podir/kde.xml.in.h:6
 msgid "Calligra Plan work package document"
-msgstr ""
+msgstr "وثيقة حزمة عمل Calligra Plan"
 
 #: kde.xml.podir/kde.xml.in.h:7
 msgid "Dr. Geo figure"
@@ -171,7 +172,7 @@
 
 #: kde.xml.podir/kde.xml.in.h:46
 msgid "Mobipocket e-book"
-msgstr ""
+msgstr "كتاب إلكتروني Mobipocket"
 
 #: kde.xml.podir/kde.xml.in.h:48
 msgid "NewzBin usenet index"
@@ -203,7 +204,7 @@
 
 #: kde.xml.podir/kde.xml.in.h:57
 msgid "Softimage PIC image"
-msgstr ""
+msgstr "صورة PIC"
 
 #: kde.xml.podir/kde.xml.in.h:58
 msgid "SuperKaramba theme"
diff -Nru language-pack-kde-ar-base-12.04+20120221/debian/changelog language-pack-kde-ar-base-12.04+20120322/debian/changelog
--- language-pack-kde-ar-base-12.04+20120221/debian/changelog	2012-02-23 06:20:05.000000000 +0000
+++ language-pack-kde-ar-base-12.04+20120322/debian/changelog	2012-03-23 06:41:36.000000000 +0000
@@ -1,6 +1,6 @@
-language-pack-kde-ar-base (1:12.04+20120221) precise; urgency=low
+language-pack-kde-ar-base (1:12.04+20120322) precise; urgency=low
 
   * Initial Release.
 
- -- Ubuntu automatic language-pack builder <language-packs@ubuntu.com>  Thu, 23 Feb 2012 06:20:05 +0000
+ -- Ubuntu automatic language-pack builder <language-packs@ubuntu.com>  Fri, 23 Mar 2012 06:41:36 +0000