diff -Nru gnote-3.14.2/configure gnote-3.16.0/configure --- gnote-3.14.2/configure 2015-01-17 15:38:00.000000000 +0000 +++ gnote-3.16.0/configure 2015-03-29 19:56:38.000000000 +0000 @@ -1,6 +1,6 @@ #! /bin/sh # Guess values for system-dependent variables and create Makefiles. -# Generated by GNU Autoconf 2.69 for gnote 3.14.2. +# Generated by GNU Autoconf 2.69 for gnote 3.16.0. # # # Copyright (C) 1992-1996, 1998-2012 Free Software Foundation, Inc. @@ -587,8 +587,8 @@ # Identity of this package. PACKAGE_NAME='gnote' PACKAGE_TARNAME='gnote' -PACKAGE_VERSION='3.14.2' -PACKAGE_STRING='gnote 3.14.2' +PACKAGE_VERSION='3.16.0' +PACKAGE_STRING='gnote 3.16.0' PACKAGE_BUGREPORT='' PACKAGE_URL='' @@ -1456,7 +1456,7 @@ # Omit some internal or obsolete options to make the list less imposing. # This message is too long to be a string in the A/UX 3.1 sh. cat <<_ACEOF -\`configure' configures gnote 3.14.2 to adapt to many kinds of systems. +\`configure' configures gnote 3.16.0 to adapt to many kinds of systems. Usage: $0 [OPTION]... [VAR=VALUE]... @@ -1526,7 +1526,7 @@ if test -n "$ac_init_help"; then case $ac_init_help in - short | recursive ) echo "Configuration of gnote 3.14.2:";; + short | recursive ) echo "Configuration of gnote 3.16.0:";; esac cat <<\_ACEOF @@ -1685,7 +1685,7 @@ test -n "$ac_init_help" && exit $ac_status if $ac_init_version; then cat <<\_ACEOF -gnote configure 3.14.2 +gnote configure 3.16.0 generated by GNU Autoconf 2.69 Copyright (C) 2012 Free Software Foundation, Inc. @@ -2325,7 +2325,7 @@ This file contains any messages produced by compilers while running configure, to aid debugging if configure makes a mistake. -It was created by gnote $as_me 3.14.2, which was +It was created by gnote $as_me 3.16.0, which was generated by GNU Autoconf 2.69. Invocation command line was $ $0 $@ @@ -3190,7 +3190,7 @@ # Define the identity of the package. PACKAGE='gnote' - VERSION='3.14.2' + VERSION='3.16.0' cat >>confdefs.h <<_ACEOF @@ -3660,7 +3660,7 @@ #define LIBGNOTE_RELEASE "$LIBGNOTE_RELEASE" _ACEOF -LIBGNOTE_VERSION_INFO=0:1:0 +LIBGNOTE_VERSION_INFO=0:0:0 cat >>confdefs.h <<_ACEOF @@ -17322,7 +17322,7 @@ -echo "$as_me: this is boost.m4 serial 18" >&5 +echo "$as_me: this is boost.m4 serial 24" >&5 boost_save_IFS=$IFS boost_version_req=$BOOST_VERSION IFS=. @@ -17466,17 +17466,29 @@ if ${boost_cv_lib_version+:} false; then : $as_echo_n "(cached) " >&6 else - cat confdefs.h - <<_ACEOF >conftest.$ac_ext + ac_ext=cpp +ac_cpp='$CXXCPP $CPPFLAGS' +ac_compile='$CXX -c $CXXFLAGS $CPPFLAGS conftest.$ac_ext >&5' +ac_link='$CXX -o conftest$ac_exeext $CXXFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' +ac_compiler_gnu=$ac_cv_cxx_compiler_gnu +cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ #include boost-lib-version = BOOST_LIB_VERSION _ACEOF if (eval "$ac_cpp conftest.$ac_ext") 2>&5 | + grep -v '#' | tr -d '\r' | - $SED -n -e "/^boost-lib-version = /{s///;s/\"//g;p;q;}" >conftest.i 2>&1; then : + tr -s '\n' ' ' | + $SED -n -e "/^boost-lib-version = /{s///;s/[\" ]//g;p;q;}" >conftest.i 2>&1; then : boost_cv_lib_version=`cat conftest.i` fi rm -rf conftest* +ac_ext=cpp +ac_cpp='$CXXCPP $CPPFLAGS' +ac_compile='$CXX -c $CXXFLAGS $CPPFLAGS conftest.$ac_ext >&5' +ac_link='$CXX -o conftest$ac_exeext $CXXFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' +ac_compiler_gnu=$ac_cv_cxx_compiler_gnu fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $boost_cv_lib_version" >&5 @@ -17485,7 +17497,7 @@ boost_major_version=`echo "$boost_cv_lib_version" | sed 's/_//;s/_.*//'` case $boost_major_version in #( '' | *[!0-9]*) - as_fn_error $? "invalid value: boost_major_version=$boost_major_version" "$LINENO" 5 + as_fn_error $? "invalid value: boost_major_version='$boost_major_version'" "$LINENO" 5 ;; esac fi @@ -17577,14 +17589,53 @@ # I'm not sure about my test for `il' (be careful: Intel's ICC pre-defines # the same defines as GCC's). for i in \ + "defined __GNUC__ && __GNUC__ == 5 && __GNUC_MINOR__ == 0 && !defined __ICC && \ + (defined WIN32 || defined WINNT || defined _WIN32 || defined __WIN32 \ + || defined __WIN32__ || defined __WINNT || defined __WINNT__) @ mgw50" \ + "defined __GNUC__ && __GNUC__ == 5 && __GNUC_MINOR__ == 0 && !defined __ICC @ gcc50" \ + "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 10 && !defined __ICC && \ + (defined WIN32 || defined WINNT || defined _WIN32 || defined __WIN32 \ + || defined __WIN32__ || defined __WINNT || defined __WINNT__) @ mgw410" \ + "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 10 && !defined __ICC @ gcc410" \ + "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 9 && !defined __ICC && \ + (defined WIN32 || defined WINNT || defined _WIN32 || defined __WIN32 \ + || defined __WIN32__ || defined __WINNT || defined __WINNT__) @ mgw49" \ + "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 9 && !defined __ICC @ gcc49" \ + "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 8 && !defined __ICC && \ + (defined WIN32 || defined WINNT || defined _WIN32 || defined __WIN32 \ + || defined __WIN32__ || defined __WINNT || defined __WINNT__) @ mgw48" \ "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 8 && !defined __ICC @ gcc48" \ + "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 7 && !defined __ICC && \ + (defined WIN32 || defined WINNT || defined _WIN32 || defined __WIN32 \ + || defined __WIN32__ || defined __WINNT || defined __WINNT__) @ mgw47" \ "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 7 && !defined __ICC @ gcc47" \ + "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 6 && !defined __ICC && \ + (defined WIN32 || defined WINNT || defined _WIN32 || defined __WIN32 \ + || defined __WIN32__ || defined __WINNT || defined __WINNT__) @ mgw46" \ "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 6 && !defined __ICC @ gcc46" \ + "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 5 && !defined __ICC && \ + (defined WIN32 || defined WINNT || defined _WIN32 || defined __WIN32 \ + || defined __WIN32__ || defined __WINNT || defined __WINNT__) @ mgw45" \ "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 5 && !defined __ICC @ gcc45" \ + "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 4 && !defined __ICC && \ + (defined WIN32 || defined WINNT || defined _WIN32 || defined __WIN32 \ + || defined __WIN32__ || defined __WINNT || defined __WINNT__) @ mgw44" \ "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 4 && !defined __ICC @ gcc44" \ + "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 3 && !defined __ICC && \ + (defined WIN32 || defined WINNT || defined _WIN32 || defined __WIN32 \ + || defined __WIN32__ || defined __WINNT || defined __WINNT__) @ mgw43" \ "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 3 && !defined __ICC @ gcc43" \ + "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 2 && !defined __ICC && \ + (defined WIN32 || defined WINNT || defined _WIN32 || defined __WIN32 \ + || defined __WIN32__ || defined __WINNT || defined __WINNT__) @ mgw42" \ "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 2 && !defined __ICC @ gcc42" \ + "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 1 && !defined __ICC && \ + (defined WIN32 || defined WINNT || defined _WIN32 || defined __WIN32 \ + || defined __WIN32__ || defined __WINNT || defined __WINNT__) @ mgw41" \ "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 1 && !defined __ICC @ gcc41" \ + "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 0 && !defined __ICC && \ + (defined WIN32 || defined WINNT || defined _WIN32 || defined __WIN32 \ + || defined __WIN32__ || defined __WINNT || defined __WINNT__) @ mgw40" \ "defined __GNUC__ && __GNUC__ == 4 && __GNUC_MINOR__ == 0 && !defined __ICC @ gcc40" \ "defined __GNUC__ && __GNUC__ == 3 && !defined __ICC \ && (defined WIN32 || defined WINNT || defined _WIN32 || defined __WIN32 \ @@ -17671,6 +17722,11 @@ fi # Check whether we do better use `mt' even though we weren't ask to. +ac_ext=cpp +ac_cpp='$CXXCPP $CPPFLAGS' +ac_compile='$CXX -c $CXXFLAGS $CPPFLAGS conftest.$ac_ext >&5' +ac_link='$CXX -o conftest$ac_exeext $CXXFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' +ac_compiler_gnu=$ac_cv_cxx_compiler_gnu cat confdefs.h - <<_ACEOF >conftest.$ac_ext /* end confdefs.h. */ @@ -17694,6 +17750,11 @@ boost_guess_use_mt=false fi rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +ac_ext=cpp +ac_cpp='$CXXCPP $CPPFLAGS' +ac_compile='$CXX -c $CXXFLAGS $CPPFLAGS conftest.$ac_ext >&5' +ac_link='$CXX -o conftest$ac_exeext $CXXFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' +ac_compiler_gnu=$ac_cv_cxx_compiler_gnu if test x"$boost_cv_inc_path" = xno; then { $as_echo "$as_me:${as_lineno-$LINENO}: Boost not available, not searching for the Boost unit_test_framework library" >&5 @@ -17735,13 +17796,6 @@ boost_save_CPPFLAGS=$CPPFLAGS CPPFLAGS="$CPPFLAGS $BOOST_CPPFLAGS" -# Now let's try to find the library. The algorithm is as follows: first look -# for a given library name according to the user's PREFERRED-RT-OPT. For each -# library name, we prefer to use the ones that carry the tag (toolset name). -# Each library is searched through the various standard paths were Boost is -# usually installed. If we can't find the standard variants, we try to -# enforce -mt (for instance on MacOSX, libboost_threads.dylib doesn't exist -# but there's -obviously- libboost_threads-mt.dylib). { $as_echo "$as_me:${as_lineno-$LINENO}: checking for the Boost unit_test_framework library" >&5 $as_echo_n "checking for the Boost unit_test_framework library... " >&6; } if ${boost_cv_lib_unit_test_framework+:} false; then : @@ -17749,19 +17803,19 @@ else boost_cv_lib_unit_test_framework=no case "s" in #( - mt | mt-) boost_mt=-mt; boost_rtopt=;; #( - mt* | mt-*) boost_mt=-mt; boost_rtopt=`expr "Xs" : 'Xmt-*\(.*\)'`;; #( - *) boost_mt=; boost_rtopt=s;; + (mt | mt-) boost_mt=-mt; boost_rtopt=;; #( + (mt* | mt-*) boost_mt=-mt; boost_rtopt=`expr "Xs" : 'Xmt-*\(.*\)'`;; #( + (*) boost_mt=; boost_rtopt=s;; esac if test $enable_static_boost = yes; then boost_rtopt="s$boost_rtopt" fi # Find the proper debug variant depending on what we've been asked to find. case $boost_rtopt in #( - *d*) boost_rt_d=$boost_rtopt;; #( - *[sgpn]*) # Insert the `d' at the right place (in between `sg' and `pn') + (*d*) boost_rt_d=$boost_rtopt;; #( + (*[sgpn]*) # Insert the `d' at the right place (in between `sg' and `pn') boost_rt_d=`echo "$boost_rtopt" | sed 's/\(s*g*\)\(p*n*\)/\1\2/'`;; #( - *) boost_rt_d='-d';; + (*) boost_rt_d='-d';; esac # If the PREFERRED-RT-OPT are not empty, prepend a `-'. test -n "$boost_rtopt" && boost_rtopt="-$boost_rtopt" @@ -17794,21 +17848,22 @@ rm -f core conftest.err conftest.$ac_objext ac_objext=$boost_save_ac_objext boost_failed_libs= -# Don't bother to ident the 6 nested for loops, only the 2 innermost ones -# matter. +# Don't bother to ident the following nested for loops, only the 2 +# innermost ones matter. +for boost_lib_ in unit_test_framework; do for boost_tag_ in -$boost_cv_lib_tag ''; do for boost_ver_ in -$boost_cv_lib_version ''; do for boost_mt_ in $boost_mt -mt ''; do for boost_rtopt_ in $boost_rtopt '' -d; do for boost_lib in \ - boost_unit_test_framework$boost_tag_$boost_mt_$boost_rtopt_$boost_ver_ \ - boost_unit_test_framework$boost_tag_$boost_rtopt_$boost_ver_ \ - boost_unit_test_framework$boost_tag_$boost_mt_$boost_ver_ \ - boost_unit_test_framework$boost_tag_$boost_ver_ + boost_$boost_lib_$boost_tag_$boost_mt_$boost_rtopt_$boost_ver_ \ + boost_$boost_lib_$boost_tag_$boost_rtopt_$boost_ver_ \ + boost_$boost_lib_$boost_tag_$boost_mt_$boost_ver_ \ + boost_$boost_lib_$boost_tag_$boost_ver_ do # Avoid testing twice the same lib case $boost_failed_libs in #( - *@$boost_lib@*) continue;; + (*@$boost_lib@*) continue;; esac # If with_boost is empty, we'll search in /lib first, which is not quite # right so instead we'll try to a location based on where the headers are. @@ -17818,14 +17873,17 @@ /opt/local/lib* /usr/local/lib* /opt/lib* /usr/lib* \ "$with_boost" C:/Boost/lib /lib* do - test -e "$boost_ldpath" || continue + # Don't waste time with directories that don't exist. + if test x"$boost_ldpath" != x && test ! -e "$boost_ldpath"; then + continue + fi boost_save_LDFLAGS=$LDFLAGS # Are we looking for a static library? case $boost_ldpath:$boost_rtopt_ in #( - *?*:*s*) # Yes (Non empty boost_ldpath + s in rt opt) + (*?*:*s*) # Yes (Non empty boost_ldpath + s in rt opt) boost_cv_lib_unit_test_framework_LIBS="$boost_ldpath/lib$boost_lib.$libext" test -e "$boost_cv_lib_unit_test_framework_LIBS" || continue;; #( - *) # No: use -lboost_foo to find the shared library. + (*) # No: use -lboost_foo to find the shared library. boost_cv_lib_unit_test_framework_LIBS="-l$boost_lib";; esac boost_save_LIBS=$LIBS @@ -17854,11 +17912,11 @@ fi $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; } && { - test -z "$ac_cxx_werror_flag" || - test ! -s conftest.err + test -z "$ac_cxx_werror_flag" || + test ! -s conftest.err } && test -s conftest$ac_exeext && { - test "$cross_compiling" = yes || - $as_executable_p conftest$ac_exeext + test "$cross_compiling" = yes || + $as_executable_p conftest$ac_exeext }; then : boost_cv_lib_unit_test_framework=yes else @@ -17877,17 +17935,22 @@ LDFLAGS=$boost_save_LDFLAGS LIBS=$boost_save_LIBS if test x"$boost_cv_lib_unit_test_framework" = xyes; then - # Check or used cached result of whether or not using -R or -rpath makes sense. - # Some implementations of ld, such as for Mac OSX, require -rpath but - # -R is the flag known to work on other systems. - # https://github.com/tsuna/boost.m4/issues/19 + # Check or used cached result of whether or not using -R or + # -rpath makes sense. Some implementations of ld, such as for + # Mac OSX, require -rpath but -R is the flag known to work on + # other systems. https://github.com/tsuna/boost.m4/issues/19 if ${boost_cv_rpath_link_ldflag+:} false; then : $as_echo_n "(cached) " >&6 else - for boost_cv_rpath_link_ldflag in -Wl,-R, -Wl,-rpath,; do - LDFLAGS="$boost_save_LDFLAGS -L$boost_ldpath $boost_cv_rpath_link_ldflag$boost_ldpath" - LIBS="$boost_save_LIBS $boost_cv_lib_unit_test_framework_LIBS" - rm -f conftest$ac_exeext + case $boost_ldpath in + '') # Nothing to do. + boost_cv_rpath_link_ldflag= + boost_rpath_link_ldflag_found=yes;; + *) + for boost_cv_rpath_link_ldflag in -Wl,-R, -Wl,-rpath,; do + LDFLAGS="$boost_save_LDFLAGS -L$boost_ldpath $boost_cv_rpath_link_ldflag$boost_ldpath" + LIBS="$boost_save_LIBS $boost_cv_lib_unit_test_framework_LIBS" + rm -f conftest$ac_exeext boost_save_ac_ext=$ac_ext boost_use_source=: # If we already have a .o, re-use it. We change $ac_ext so that $ac_link @@ -17910,14 +17973,14 @@ fi $as_echo "$as_me:${as_lineno-$LINENO}: \$? = $ac_status" >&5 test $ac_status = 0; } && { - test -z "$ac_cxx_werror_flag" || - test ! -s conftest.err + test -z "$ac_cxx_werror_flag" || + test ! -s conftest.err } && test -s conftest$ac_exeext && { - test "$cross_compiling" = yes || - $as_executable_p conftest$ac_exeext + test "$cross_compiling" = yes || + $as_executable_p conftest$ac_exeext }; then : boost_rpath_link_ldflag_found=yes - break + break else if $boost_use_source; then $as_echo "$as_me: failed program was:" >&5 @@ -17930,7 +17993,9 @@ ac_ext=$boost_save_ac_ext rm -f core conftest.err conftest_ipa8_conftest.oo \ conftest$ac_exeext - done + done + ;; + esac if test "x$boost_rpath_link_ldflag_found" != "xyes"; then : as_fn_error $? "Unable to determine whether to use -R or -rpath" "$LINENO" 5 fi @@ -17939,9 +18004,10 @@ fi - boost_cv_lib_unit_test_framework_LDFLAGS="-L$boost_ldpath $boost_cv_rpath_link_ldflag$boost_ldpath" + test x"$boost_ldpath" != x && + boost_cv_lib_unit_test_framework_LDFLAGS="-L$boost_ldpath $boost_cv_rpath_link_ldflag$boost_ldpath" boost_cv_lib_unit_test_framework_LDPATH="$boost_ldpath" - break 6 + break 7 else boost_failed_libs="$boost_failed_libs@$boost_lib@" fi @@ -17951,13 +18017,14 @@ done done done +done # boost_lib_ rm -f conftest.$ac_objext fi { $as_echo "$as_me:${as_lineno-$LINENO}: result: $boost_cv_lib_unit_test_framework" >&5 $as_echo "$boost_cv_lib_unit_test_framework" >&6; } case $boost_cv_lib_unit_test_framework in #( - no) $as_echo "$as_me: failed program was:" >&5 + (no) $as_echo "$as_me: failed program was:" >&5 sed 's/^/| /' conftest.$ac_ext >&5 as_fn_error $? "cannot find the flags to link with Boost unit_test_framework" "$LINENO" 5 @@ -20279,7 +20346,7 @@ # report actual input values of CONFIG_FILES etc. instead of their # values after options handling. ac_log=" -This file was extended by gnote $as_me 3.14.2, which was +This file was extended by gnote $as_me 3.16.0, which was generated by GNU Autoconf 2.69. Invocation command line was CONFIG_FILES = $CONFIG_FILES @@ -20345,7 +20412,7 @@ cat >>$CONFIG_STATUS <<_ACEOF || ac_write_fail=1 ac_cs_config="`$as_echo "$ac_configure_args" | sed 's/^ //; s/[\\""\`\$]/\\\\&/g'`" ac_cs_version="\\ -gnote config.status 3.14.2 +gnote config.status 3.16.0 configured by $0, generated by GNU Autoconf 2.69, with options \\"\$ac_cs_config\\" diff -Nru gnote-3.14.2/configure.ac gnote-3.16.0/configure.ac --- gnote-3.14.2/configure.ac 2015-01-17 15:37:24.000000000 +0000 +++ gnote-3.16.0/configure.ac 2015-03-29 19:52:59.000000000 +0000 @@ -1,4 +1,4 @@ -AC_INIT(gnote, 3.14.2) +AC_INIT(gnote, 3.16.0) AC_PREREQ(2.59) AC_CONFIG_SRCDIR(README) AM_INIT_AUTOMAKE([1.11 foreign dist-bzip2]) @@ -17,7 +17,7 @@ LIBGNOTE_RELEASE=${PACKAGE_VERSION%.*} AC_SUBST(LIBGNOTE_RELEASE) AC_DEFINE_UNQUOTED([LIBGNOTE_RELEASE], ["$LIBGNOTE_RELEASE"], [libgnote release.]) -LIBGNOTE_VERSION_INFO=0:1:0 +LIBGNOTE_VERSION_INFO=0:0:0 AC_SUBST(LIBGNOTE_VERSION_INFO) AC_DEFINE_UNQUOTED([LIBGNOTE_VERSION_INFO], ["$LIBGNOTE_VERSION_INFO"], [libgnote release.]) diff -Nru gnote-3.14.2/data/gnote.desktop.in gnote-3.16.0/data/gnote.desktop.in --- gnote-3.14.2/data/gnote.desktop.in 2015-01-17 15:38:23.000000000 +0000 +++ gnote-3.16.0/data/gnote.desktop.in 2015-03-29 19:57:00.000000000 +0000 @@ -14,4 +14,4 @@ X-GNOME-Bugzilla-Bugzilla=GNOME X-GNOME-Bugzilla-Product=gnote X-GNOME-Bugzilla-Component=main -X-GNOME-Bugzilla-Version=3.14.2 +X-GNOME-Bugzilla-Version=3.16.0 diff -Nru gnote-3.14.2/data/org.gnome.gnote.gschema.xml.in gnote-3.16.0/data/org.gnome.gnote.gschema.xml.in --- gnote-3.14.2/data/org.gnome.gnote.gschema.xml.in 2015-01-17 12:53:20.000000000 +0000 +++ gnote-3.16.0/data/org.gnome.gnote.gschema.xml.in 2015-03-07 18:13:27.000000000 +0000 @@ -123,7 +123,7 @@ false <_summary>Use status icon, when started as an application - <_description>Has affect only when started as an application. When set to TRUE, shows a status icon. If set to FALSE, Search All Notes window is used as main application window, closing which makes application to exit. + <_description>Deprecated, has no effect. false @@ -145,27 +145,27 @@ '<Alt>F12' <_summary>Show applet menu - <_description>The global keybinding for showing the Gnote applet's menu. The format looks like "<Control>a" or "<Shift><Alt>F1". The parser is fairly liberal and allows lower or upper case, and also abbreviations such as "<Ctl>" and "<Ctrl>". If you set the option to the special string "disabled", then there will be no keybinding for this action. + <_description>Deprecated, has no effect. '<Alt>F11' <_summary>Open Start Here - <_description>The global keybinding for opening the "Start Here" note. The format looks like "<Control>a" or "<Shift><Alt>F1". The parser is fairly liberal and allows lower or upper case, and also abbreviations such as "<Ctl>" and "<Ctrl>". If you set the option to the special string "disabled", then there will be no keybinding for this action. + <_description>Deprecated, has no effect. 'disabled' <_summary>Create a new Note - <_description>The global keybinding for creating and displaying a new Note. The format looks like "<Control>a" or "<Shift><Alt>F1". The parser is fairly liberal and allows lower or upper case, and also abbreviations such as "<Ctl>" and "<Ctrl>". If you set the option to the special string "disabled", then there will be no keybinding for this action. + <_description>Deprecated, has no effect. 'disabled' <_summary>Open Search Dialog - <_description>The global keybinding for opening the Note Search dialog. The format looks like "<Control>a" or "<Shift><Alt>F1". The parser is fairly liberal and allows lower or upper case, and also abbreviations such as "<Ctl>" and "<Ctrl>". If you set the option to the special string "disabled", then there will be no keybinding for this action. + <_description>Deprecated, has no effect. 'disabled' <_summary>Open Recent Changes - <_description>The global keybinding for opening the Recent Changes dialog. The format looks like "<Control>a" or "<Shift><Alt>F1". The parser is fairly liberal and allows lower or upper case, and also abbreviations such as "<Ctl>" and "<Ctrl>". If you set the option to the special string "disabled", then there will be no keybinding for this action. + <_description>Deprecated, has no effect. diff -Nru gnote-3.14.2/debian/changelog gnote-3.16.0/debian/changelog --- gnote-3.14.2/debian/changelog 2015-01-21 22:29:23.000000000 +0000 +++ gnote-3.16.0/debian/changelog 2015-05-23 17:55:28.000000000 +0000 @@ -1,3 +1,18 @@ +gnote (3.16.0-1ubuntu1) wily; urgency=low + + * Merge from Debian unstable. Remaining changes: + - debian/patches/unity_normal_titlebar.patch: + + Don't use GtkHeaderBar decoration when not running + under GNOME in src/recentchanges.cpp. + + -- Artur Rona Sat, 23 May 2015 19:55:21 +0200 + +gnote (3.16.0-1) unstable; urgency=medium + + * New upstream release. + + -- Vincent Cheng Wed, 29 Apr 2015 17:14:48 -0700 + gnote (3.14.2-1ubuntu1) vivid; urgency=low * Merge from Debian unstable. Remaining changes: diff -Nru gnote-3.14.2/debian/patches/unity_normal_titlebar.patch gnote-3.16.0/debian/patches/unity_normal_titlebar.patch --- gnote-3.14.2/debian/patches/unity_normal_titlebar.patch 2014-11-05 14:37:07.000000000 +0000 +++ gnote-3.16.0/debian/patches/unity_normal_titlebar.patch 2015-05-22 22:19:45.000000000 +0000 @@ -3,11 +3,10 @@ Forwarded: No, Ubuntu-specific Bug-Ubuntu: https://bugs.launchpad.net/ubuntu/+source/gnote/+bug/1389720 -Index: gnote-3.14.0/src/recentchanges.cpp -=================================================================== ---- gnote-3.14.0.orig/src/recentchanges.cpp 2014-04-16 15:20:50.000000000 -0400 -+++ gnote-3.14.0/src/recentchanges.cpp 2014-11-05 09:35:14.192547172 -0500 -@@ -73,11 +73,20 @@ +diff -pruN -x '*~' gnote-3.16.0.orig/src/recentchanges.cpp gnote-3.16.0/src/recentchanges.cpp +--- gnote-3.16.0.orig/src/recentchanges.cpp 2015-03-07 19:13:28.000000000 +0100 ++++ gnote-3.16.0/src/recentchanges.cpp 2015-05-23 00:19:10.445445366 +0200 +@@ -73,11 +73,20 @@ namespace gnote { .connect(sigc::mem_fun(*this, &NoteRecentChanges::on_notes_widget_key_press)); make_header_bar(); @@ -16,7 +15,7 @@ m_content_vbox.set_orientation(Gtk::ORIENTATION_VERTICAL); - m_content_vbox.attach(m_search_box, 0, 0, 1, 1); - m_content_vbox.attach(m_embed_box, 0, 1, 1, 1); -+ ++ + if(Glib::getenv("XDG_CURRENT_DESKTOP") == "GNOME") { + m_header_bar.set_show_close_button(true); + set_titlebar(m_header_bar); @@ -31,24 +30,23 @@ m_embed_box.set_hexpand(true); m_embed_box.set_vexpand(true); m_embed_box.show(); -@@ -115,8 +124,6 @@ +@@ -115,7 +124,6 @@ namespace gnote { void NoteRecentChanges::make_header_bar() { - m_header_bar.set_show_close_button(true); -- + Gtk::Grid *left_box = manage(new Gtk::Grid); left_box->get_style_context()->add_class(GTK_STYLE_CLASS_RAISED); - left_box->set_orientation(Gtk::ORIENTATION_HORIZONTAL); -@@ -170,6 +177,7 @@ +@@ -170,6 +178,7 @@ namespace gnote { right_box->attach(*m_window_actions_button, 1, 0, 1, 1); right_box->show(); + m_header_bar.set_vexpand(false); m_header_bar.pack_start(*left_box); - m_header_bar.pack_end(m_embedded_toolbar); m_header_bar.pack_end(*right_box); -@@ -475,13 +483,24 @@ + m_header_bar.pack_end(m_embedded_toolbar); +@@ -475,13 +484,24 @@ namespace gnote { widget.size_internals(); update_toolbar(widget); @@ -80,7 +78,7 @@ } } catch(std::bad_cast&) { -@@ -691,7 +710,11 @@ +@@ -691,7 +711,11 @@ namespace gnote { void NoteRecentChanges::on_embedded_name_changed(const std::string & name) { Binary files /tmp/TZj0RWsGmM/gnote-3.14.2/help/C/figures/add-to-notebook.png and /tmp/PHFkdwVKGj/gnote-3.16.0/help/C/figures/add-to-notebook.png differ Binary files /tmp/TZj0RWsGmM/gnote-3.14.2/help/C/figures/gnote-new-note.png and /tmp/PHFkdwVKGj/gnote-3.16.0/help/C/figures/gnote-new-note.png differ Binary files /tmp/TZj0RWsGmM/gnote-3.14.2/help/C/figures/gnote-preferences-hotkeys.png and /tmp/PHFkdwVKGj/gnote-3.16.0/help/C/figures/gnote-preferences-hotkeys.png differ Binary files /tmp/TZj0RWsGmM/gnote-3.14.2/help/C/figures/gnote-template-note.png and /tmp/PHFkdwVKGj/gnote-3.16.0/help/C/figures/gnote-template-note.png differ diff -Nru gnote-3.14.2/help/C/gnote-common-problems.page gnote-3.16.0/help/C/gnote-common-problems.page --- gnote-3.14.2/help/C/gnote-common-problems.page 2014-10-19 12:16:30.000000000 +0000 +++ gnote-3.16.0/help/C/gnote-common-problems.page 2015-03-07 18:13:27.000000000 +0000 @@ -26,8 +26,6 @@ Does <app>Gnote</app> work with <app>Tomboy</app>?

You can import Tomboy Notes. A plugin has to be activated.

 - I can't find the Gnote status icon. -

You can activate the Gnote status icon in Gnote Preferences dialog.

 How to automatically start <app>Gnote</app> when I log in?

To start Gnote automatically when you log into GNOME, run gnome-session-properties.

 diff -Nru gnote-3.14.2/help/C/gnote-hotkeys.page gnote-3.16.0/help/C/gnote-hotkeys.page --- gnote-3.14.2/help/C/gnote-hotkeys.page 2013-09-03 20:11:03.000000000 +0000 +++ gnote-3.16.0/help/C/gnote-hotkeys.page 1970-01-01 00:00:00.000000000 +0000 @@ -1,43 +0,0 @@ - - - - - - Gnote hotkey settings -

GNU Free Documentation License (GFDL), Version 1.1

 - - Pierre-Yves Luyten - 2011 - - - Aurimas Cernius - 2011-2013 - - - Adam Dingle - adam@yorba.org - 2013 - - - - Hotkeys -

This tab is only available if Gnote was buit with X11 support.

-

The hotkeys tab lets you set global key combinations to perform different functions in Gnote. In order to set key combinations, you must have the Listen for hotkeys checkbox enabled.

- - Show notes menu

Enter a key combination for opening the notes menu.

 - Open "Start Here"

Enter a key combination for opening the “Start Here” note, which is preinstalled with Gnote.

 - Create New Note

Enter a key combination for creating a new note.

 - Open "Search All Notes"

Enter a key combination for opening a search.

 - - -
- <gui>Hotkeys Preferences</gui> window - Gnote hotkeys - -

Setting up Gnote keyboard shortcuts.

- -
- - diff -Nru gnote-3.14.2/help/C/gnote-working-with-notebooks.page gnote-3.16.0/help/C/gnote-working-with-notebooks.page --- gnote-3.14.2/help/C/gnote-working-with-notebooks.page 2013-09-14 14:20:32.000000000 +0000 +++ gnote-3.16.0/help/C/gnote-working-with-notebooks.page 2015-03-07 18:13:27.000000000 +0000 @@ -60,7 +60,7 @@

Drag the note(s) onto a notebook on the left using the mouse.

Click on a notebook, right-click in notes list and select New from the context menu. A new note will be created and added to the notebook.

 -

As you type a note, you can add the note directly to an existing notebook using the Notebook button. The Notebook button is represented by the icon.

+

As you type a note, you can add the note directly to an existing notebook using the ActionsNotebook menu.

Adding Notes to a Notebook

Add to Notebook.

 @@ -68,7 +68,7 @@

To remove a note from a notebook, use one of the following:

Move the note to Unfiled Notes in the main window.

 -

Select the No Notebook option from the menu which appears when you press the Notebook button in an open note.

 +

Select the No Notebook option from the menu which appears when you press the ActionsNotebook in an open note.

 diff -Nru gnote-3.14.2/help/cs/cs.po gnote-3.16.0/help/cs/cs.po --- gnote-3.14.2/help/cs/cs.po 2015-01-17 12:53:20.000000000 +0000 +++ gnote-3.16.0/help/cs/cs.po 2015-03-29 19:25:24.000000000 +0000 @@ -1,13 +1,14 @@ # Czech translation of gnote help. # Copyright (C) 2009, 2010, 2011 gnote's COPYRIGHT HOLDER # This file is distributed under the same license as the gnote package. -# Marek Černocký , 2011, 2012, 2013, 2014. +# +# Marek Černocký , 2011, 2012, 2013, 2014, 2015. # msgid "" msgstr "" -"Project-Id-Version: gnote gnome-3.14\n" -"POT-Creation-Date: 2014-10-26 09:10+0000\n" -"PO-Revision-Date: 2014-03-17 08:46+0100\n" +"Project-Id-Version: gnote\n" +"POT-Creation-Date: 2015-03-27 09:48+0000\n" +"PO-Revision-Date: 2015-03-27 15:37+0100\n" "Last-Translator: Marek Černocký \n" "Language-Team: Czech \n" "Language: cs\n" @@ -37,11 +38,11 @@ #: C/gnote-addin-timestamp.page:10 C/gnote-addin-underline.page:9 #: C/gnote-bulleted-lists.page:9 C/gnote-common-problems.page:8 #: C/gnote-creating-notes.page:8 C/gnote-deleting-notes.page:8 -#: C/gnote-editing-notes.page:6 C/gnote-hotkeys.page:9 -#: C/gnote-introduction.page:10 C/gnote-links.page:8 -#: C/gnote-notes-preferences.page:10 C/gnote-searching-notes.page:8 -#: C/gnote-synchronization.page:9 C/gnote-template-notes.page:10 -#: C/gnote-working-with-notebooks.page:10 C/index.page:6 +#: C/gnote-editing-notes.page:6 C/gnote-introduction.page:10 +#: C/gnote-links.page:8 C/gnote-notes-preferences.page:10 +#: C/gnote-searching-notes.page:8 C/gnote-synchronization.page:9 +#: C/gnote-template-notes.page:10 C/gnote-working-with-notebooks.page:10 +#: C/index.page:6 msgid "GNU Free Documentation License (GFDL), Version 1.1" msgstr "GNU Free Documentation License (GFDL), verze 1.1" @@ -53,7 +54,7 @@ #: C/gnote-addin-underline.page:11 C/gnote-bulleted-lists.page:11 #: C/gnote-common-problems.page:11 C/gnote-creating-notes.page:11 #: C/gnote-deleting-notes.page:11 C/gnote-editing-notes.page:9 -#: C/gnote-hotkeys.page:11 C/gnote-introduction.page:12 C/gnote-links.page:11 +#: C/gnote-introduction.page:12 C/gnote-links.page:11 #: C/gnote-notes-preferences.page:12 C/gnote-searching-notes.page:11 #: C/gnote-working-with-notebooks.page:12 C/index.page:9 msgid "Pierre-Yves Luyten" @@ -67,10 +68,10 @@ #: C/gnote-addin-underline.page:12 C/gnote-bulleted-lists.page:12 #: C/gnote-bulleted-lists.page:16 C/gnote-common-problems.page:12 #: C/gnote-creating-notes.page:12 C/gnote-deleting-notes.page:12 -#: C/gnote-editing-notes.page:10 C/gnote-hotkeys.page:12 -#: C/gnote-introduction.page:13 C/gnote-links.page:12 -#: C/gnote-notes-preferences.page:13 C/gnote-searching-notes.page:12 -#: C/gnote-working-with-notebooks.page:13 C/index.page:10 C/index.page:14 +#: C/gnote-editing-notes.page:10 C/gnote-introduction.page:13 +#: C/gnote-links.page:12 C/gnote-notes-preferences.page:13 +#: C/gnote-searching-notes.page:12 C/gnote-working-with-notebooks.page:13 +#: C/index.page:10 C/index.page:14 msgid "2011" msgstr "2011" @@ -85,7 +86,7 @@ #: C/gnote-addin-underline.page:15 C/gnote-bulleted-lists.page:15 #: C/gnote-common-problems.page:15 C/gnote-creating-notes.page:15 #: C/gnote-deleting-notes.page:15 C/gnote-editing-notes.page:13 -#: C/gnote-hotkeys.page:15 C/gnote-introduction.page:16 C/gnote-links.page:15 +#: C/gnote-introduction.page:16 C/gnote-links.page:15 #: C/gnote-notes-preferences.page:16 C/gnote-searching-notes.page:15 #: C/gnote-synchronization.page:11 C/gnote-template-notes.page:12 #: C/gnote-working-with-notebooks.page:16 C/index.page:13 @@ -111,7 +112,7 @@ #: C/gnote-addin-underline.page:19 C/gnote-bulleted-lists.page:19 #: C/gnote-common-problems.page:19 C/gnote-creating-notes.page:19 #: C/gnote-deleting-notes.page:19 C/gnote-editing-notes.page:17 -#: C/gnote-hotkeys.page:19 C/gnote-introduction.page:20 C/gnote-links.page:19 +#: C/gnote-introduction.page:20 C/gnote-links.page:19 #: C/gnote-notes-preferences.page:20 C/gnote-searching-notes.page:19 #: C/gnote-synchronization.page:15 C/gnote-template-notes.page:16 #: C/gnote-working-with-notebooks.page:20 @@ -129,11 +130,10 @@ #: C/gnote-addin-timestamp.page:22 C/gnote-addin-underline.page:21 #: C/gnote-bulleted-lists.page:21 C/gnote-common-problems.page:21 #: C/gnote-creating-notes.page:21 C/gnote-deleting-notes.page:21 -#: C/gnote-editing-notes.page:19 C/gnote-hotkeys.page:21 -#: C/gnote-introduction.page:22 C/gnote-links.page:21 -#: C/gnote-notes-preferences.page:22 C/gnote-searching-notes.page:21 -#: C/gnote-synchronization.page:17 C/gnote-template-notes.page:18 -#: C/gnote-working-with-notebooks.page:22 +#: C/gnote-editing-notes.page:19 C/gnote-introduction.page:22 +#: C/gnote-links.page:21 C/gnote-notes-preferences.page:22 +#: C/gnote-searching-notes.page:21 C/gnote-synchronization.page:17 +#: C/gnote-template-notes.page:18 C/gnote-working-with-notebooks.page:22 msgid "2013" msgstr "2013" @@ -1141,25 +1141,11 @@ #. (itstool) path: item/title #: C/gnote-common-problems.page:29 -msgid "I can't find the Gnote status icon." -msgstr "Nemohu najít stavovou ikonu Gnote." - -#. (itstool) path: item/p -#: C/gnote-common-problems.page:30 -msgid "" -"You can activate the Gnote status icon in Gnote Preferences " -"dialog." -msgstr "" -"Stavovou ikonu Gnote můžete aktivovat v dialogovém okně předvoleb " -"Gnote." - -#. (itstool) path: item/title -#: C/gnote-common-problems.page:31 msgid "How to automatically start Gnote when I log in?" msgstr "Jak automaticky spouštět Gnote při přihlášení?" #. (itstool) path: item/p -#: C/gnote-common-problems.page:32 +#: C/gnote-common-problems.page:30 msgid "" "To start Gnote automatically when you log into GNOME, run gnome-session-" "properties." @@ -1168,12 +1154,12 @@ "použijte gnome-session-properties." #. (itstool) path: item/title -#: C/gnote-common-problems.page:34 +#: C/gnote-common-problems.page:32 msgid "I'm not comfortable with new single-window interface" msgstr "Nejsem spokojen s novým jednookenním rozhraním" #. (itstool) path: item/p -#: C/gnote-common-problems.page:34 +#: C/gnote-common-problems.page:32 msgid "" "You can make Gnote behave the old way by selecting Always " "open notes in new window in Preferences dialog." @@ -1296,10 +1282,10 @@ msgctxt "_" msgid "" "external ref='figures/gnote-new-note.png' " -"md5='722aeec3c4f00089d2b8a3884e7559dc'" +"md5='0faf7950ab9f830c3de85713598277f1'" msgstr "" "external ref='figures/gnote-new-note.png' " -"md5='19aba6328987181e2c23bc0664eb3fd1'" +"md5='0faf7950ab9f830c3de85713598277f1'" #. (itstool) path: info/desc #: C/gnote-editing-notes.page:7 @@ -1307,8 +1293,8 @@ msgstr "Úprava obsahu poznámek" #. (itstool) path: credit/years -#: C/gnote-editing-notes.page:14 C/gnote-hotkeys.page:16 -#: C/gnote-notes-preferences.page:17 C/gnote-searching-notes.page:16 +#: C/gnote-editing-notes.page:14 C/gnote-notes-preferences.page:17 +#: C/gnote-searching-notes.page:16 msgid "2011-2013" msgstr "2011 – 2013" @@ -1557,109 +1543,6 @@ #. the file changes, the md5 hash will change to let you know you need to #. update your localized copy. The msgstr is not used at all. Set it to #. whatever you like once you have updated your copy of the file. -#: C/gnote-hotkeys.page:38 -msgctxt "_" -msgid "" -"external ref='figures/gnote-preferences-hotkeys.png' " -"md5='9d159b4e82cad633bf68e8e4a3524950'" -msgstr "" -"external ref='figures/gnote-preferences-hotkeys.png' " -"md5='9d159b4e82cad633bf68e8e4a3524950'" - -#. (itstool) path: info/desc -#: C/gnote-hotkeys.page:8 -msgid "Gnote hotkey settings" -msgstr "Nastavení klávesových zkratek Gnote" - -#. (itstool) path: page/title -#: C/gnote-hotkeys.page:25 -msgid "Hotkeys" -msgstr "Klávesové zkratky" - -#. (itstool) path: page/p -#: C/gnote-hotkeys.page:26 -msgid "" -"This tab is only available if Gnote was buit with X11 support." -msgstr "" -"Tato karta je dostupná jen v případě, že byla aplikace Gnote " -"sestavena s podporou X11." - -#. (itstool) path: page/p -#: C/gnote-hotkeys.page:27 -msgid "" -"The hotkeys tab lets you set global key combinations to perform " -"different functions in Gnote. In order to set key combinations, " -"you must have the Listen for hotkeys checkbox enabled." -msgstr "" -"Karta Klávesové zkratky vám umožňuje nastavit globální kombinace " -"kláves k provádění různých funkcí v aplikaci Gnote. Pokud chcete " -"nastavit klávesové zkratky, musíte zapnout volbu Používat klávesové " -"zkratky." - -#. (itstool) path: item/title -#: C/gnote-hotkeys.page:29 -msgid "Show notes menu" -msgstr "Zobrazit nabídku poznámek" - -#. (itstool) path: item/p -#: C/gnote-hotkeys.page:29 -msgid "Enter a key combination for opening the notes menu." -msgstr "Zadejte kombinaci kláves pro otevírání nabídky poznámek." - -#. (itstool) path: item/title -#: C/gnote-hotkeys.page:30 -msgid "Open \"Start Here\"" -msgstr "Otevřít „Začněte zde“" - -#. (itstool) path: item/p -#: C/gnote-hotkeys.page:30 -msgid "" -"Enter a key combination for opening the “Start Here” note, which is " -"preinstalled with Gnote." -msgstr "" -"Zadejte kombinaci kláves pro otevření poznámky „Začněte zde“, která je v " -"aplikaci Gnote předinstalovaná." - -#. (itstool) path: item/title -#: C/gnote-hotkeys.page:31 -msgid "Create New Note" -msgstr "Vytvořit novou poznámku" - -#. (itstool) path: item/p -#: C/gnote-hotkeys.page:31 -msgid "Enter a key combination for creating a new note." -msgstr "Zadejte kombinaci kláves pro vytvoření nové poznámky." - -#. (itstool) path: item/title -#: C/gnote-hotkeys.page:32 -msgid "Open \"Search All Notes\"" -msgstr "Otevřít „Hledat ve všech poznámkách“" - -#. (itstool) path: item/p -#: C/gnote-hotkeys.page:32 -msgid "Enter a key combination for opening a search." -msgstr "Zadejte kombinaci kláves pro otevření hledání." - -#. (itstool) path: figure/title -#: C/gnote-hotkeys.page:36 -msgid "Hotkeys Preferences window" -msgstr "Okno Předvolby klávesových zkratek window" - -#. (itstool) path: figure/desc -#: C/gnote-hotkeys.page:37 -msgid "Gnote hotkeys" -msgstr "Klávesové zkratky Gnote" - -#. (itstool) path: media/p -#: C/gnote-hotkeys.page:39 -msgid "Setting up Gnote keyboard shortcuts." -msgstr "Nastavení klávesových zkratek Gnote." - -#. (itstool) path: media -#. This is a reference to an external file such as an image or video. When -#. the file changes, the md5 hash will change to let you know you need to -#. update your localized copy. The msgstr is not used at all. Set it to -#. whatever you like once you have updated your copy of the file. #: C/gnote-introduction.page:39 msgctxt "_" msgid "" @@ -2242,10 +2125,10 @@ msgctxt "_" msgid "" "external ref='figures/gnote-template-note.png' " -"md5='692c75e1018398b2eec04b7cefcf3844'" +"md5='f50e2d6d0eb6e68cf726a1b8a969263e'" msgstr "" "external ref='figures/gnote-template-note.png' " -"md5='7502160be8f056e4cdd6dae2565d51a6'" +"md5='f50e2d6d0eb6e68cf726a1b8a969263e'" #. (itstool) path: info/desc #: C/gnote-template-notes.page:9 @@ -2448,28 +2331,14 @@ #. the file changes, the md5 hash will change to let you know you need to #. update your localized copy. The msgstr is not used at all. Set it to #. whatever you like once you have updated your copy of the file. -#: C/gnote-working-with-notebooks.page:63 -msgctxt "_" -msgid "" -"external ref='figures/notebook-icon.png' " -"md5='134ed1f78ff2a35e3cbfb2cc8f6b9afa'" -msgstr "" -"external ref='figures/notebook-icon.png' " -"md5='134ed1f78ff2a35e3cbfb2cc8f6b9afa'" - -#. (itstool) path: media -#. This is a reference to an external file such as an image or video. When -#. the file changes, the md5 hash will change to let you know you need to -#. update your localized copy. The msgstr is not used at all. Set it to -#. whatever you like once you have updated your copy of the file. #: C/gnote-working-with-notebooks.page:66 msgctxt "_" msgid "" "external ref='figures/add-to-notebook.png' " -"md5='7a9f4827e18e8f5d9afa0693538bbc60'" +"md5='fbf2bb1efd152eef10233eee3e262970'" msgstr "" "external ref='figures/add-to-notebook.png' " -"md5='b734a1ed58722fedc481507b3a40d377'" +"md5='fbf2bb1efd152eef10233eee3e262970'" #. (itstool) path: media #. This is a reference to an external file such as an image or video. When @@ -2606,14 +2475,10 @@ #: C/gnote-working-with-notebooks.page:63 msgid "" "As you type a note, you can add the note directly to an existing notebook " -"using the Notebook button. The Notebook button is represented by " -"the icon." +"using the ActionsNotebook menu." msgstr "" "Když poznámku píšete, můžete ji přímo přidat do existujícího sešitu pomocí " -"tlačítka Sešit. Tlačítko Sešit je prezentováno ikonou ." +"nabídky ČinnostiSešit" #. (itstool) path: media/p #: C/gnote-working-with-notebooks.page:66 @@ -2634,10 +2499,11 @@ #: C/gnote-working-with-notebooks.page:71 msgid "" "Select the No Notebook option from the menu which appears when " -"you press the Notebook button in an open note." +"you press the ActionsNotebook in an " +"open note." msgstr "" "Vyberte volbu Žádný sešit v nabídce, která se objeví po zmáčknutí " -"tlačítka Sešit v otevřené poznámce." +"ČinnostiSešit v otevřené poznámce." #. (itstool) path: section/title #. (itstool) path: figure/title Binary files /tmp/TZj0RWsGmM/gnote-3.14.2/help/cs/figures/gnote-preferences-hotkeys.png and /tmp/PHFkdwVKGj/gnote-3.16.0/help/cs/figures/gnote-preferences-hotkeys.png differ diff -Nru gnote-3.14.2/help/cs/gnote-common-problems.page gnote-3.16.0/help/cs/gnote-common-problems.page --- gnote-3.14.2/help/cs/gnote-common-problems.page 2015-01-17 15:47:03.000000000 +0000 +++ gnote-3.16.0/help/cs/gnote-common-problems.page 2015-03-29 20:07:16.000000000 +0000 @@ -24,8 +24,6 @@ Spolupracuje <app>Gnote</app> s poznámkami <app>Tomboy</app>?

Poznámky Tomboy můžete importovat. K tomu musí být aktivován příslušný zásuvný modul.

 - Nemohu najít stavovou ikonu Gnote. -

Stavovou ikonu Gnote můžete aktivovat v dialogovém okně předvoleb Gnote.

 Jak automaticky spouštět <app>Gnote</app> při přihlášení?

Pokud chcete poznámky Gnote spouštět automaticky při přihlášení do GNOME, použijte gnome-session-properties.

 diff -Nru gnote-3.14.2/help/cs/gnote-hotkeys.page gnote-3.16.0/help/cs/gnote-hotkeys.page --- gnote-3.14.2/help/cs/gnote-hotkeys.page 2015-01-17 15:47:03.000000000 +0000 +++ gnote-3.16.0/help/cs/gnote-hotkeys.page 1970-01-01 00:00:00.000000000 +0000 @@ -1,41 +0,0 @@ - - - - - - Nastavení klávesových zkratek Gnote -

GNU Free Documentation License (GFDL), verze 1.1

 - - Pierre-Yves Luyten - 2011 - - - Aurimas Cernius - 2011 – 2013 - - - Adam Dingle - adam@yorba.org - 2013 - - - - Klávesové zkratky -

Tato karta je dostupná jen v případě, že byla aplikace Gnote sestavena s podporou X11.

-

Karta Klávesové zkratky vám umožňuje nastavit globální kombinace kláves k provádění různých funkcí v aplikaci Gnote. Pokud chcete nastavit klávesové zkratky, musíte zapnout volbu Používat klávesové zkratky.

- - Zobrazit nabídku poznámek

Zadejte kombinaci kláves pro otevírání nabídky poznámek.

 - Otevřít „Začněte zde“

Zadejte kombinaci kláves pro otevření poznámky „Začněte zde“, která je v aplikaci Gnote předinstalovaná.

 - Vytvořit novou poznámku

Zadejte kombinaci kláves pro vytvoření nové poznámky.

 - Otevřít „Hledat ve všech poznámkách“

Zadejte kombinaci kláves pro otevření hledání.

 - - -
- Okno <gui>Předvolby klávesových zkratek</gui> window - Klávesové zkratky Gnote - -

Nastavení klávesových zkratek Gnote.

- -
- - diff -Nru gnote-3.14.2/help/cs/gnote-working-with-notebooks.page gnote-3.16.0/help/cs/gnote-working-with-notebooks.page --- gnote-3.14.2/help/cs/gnote-working-with-notebooks.page 2015-01-17 15:47:04.000000000 +0000 +++ gnote-3.16.0/help/cs/gnote-working-with-notebooks.page 2015-03-29 20:07:17.000000000 +0000 @@ -58,7 +58,7 @@

Pomocí myši přetáhněte poznámku, případně několik poznámek, na sešit na levé straně.

Klikněte pravým tlačítkem na sešit a v kontextové nabídce zvolte Nová. Nová poznámka se vytvoří a přidá do sešitu.

 -

Když poznámku píšete, můžete ji přímo přidat do existujícího sešitu pomocí tlačítka Sešit. Tlačítko Sešit je prezentováno ikonou .

+

Když poznámku píšete, můžete ji přímo přidat do existujícího sešitu pomocí nabídky ČinnostiSešit

Přidávání poznámek do sešitu

Přidávání poznámek do sešitu.

 @@ -66,7 +66,7 @@

Poznámku můžete ze sešitu odebrat jedním z těchto postupů:

Přesunout poznámku do Nezařazené poznámky v hlavním okně.

 -

Vyberte volbu Žádný sešit v nabídce, která se objeví po zmáčknutí tlačítka Sešit v otevřené poznámce.

 +

Vyberte volbu Žádný sešit v nabídce, která se objeví po zmáčknutí ČinnostiSešit v otevřené poznámce.

 diff -Nru gnote-3.14.2/help/da/gnote-common-problems.page gnote-3.16.0/help/da/gnote-common-problems.page --- gnote-3.14.2/help/da/gnote-common-problems.page 2015-01-17 15:47:04.000000000 +0000 +++ gnote-3.16.0/help/da/gnote-common-problems.page 2015-03-29 20:07:18.000000000 +0000 @@ -24,8 +24,6 @@ Does <app>Gnote</app> work with <app>Tomboy</app>?

You can import Tomboy Notes. A plugin has to be activated.

 - I can't find the Gnote status icon. -

You can activate the Gnote status icon in Gnote Preferences dialog.

 How to automatically start <app>Gnote</app> when I log in?

To start Gnote automatically when you log into GNOME, run gnome-session-properties.

 diff -Nru gnote-3.14.2/help/da/gnote-hotkeys.page gnote-3.16.0/help/da/gnote-hotkeys.page --- gnote-3.14.2/help/da/gnote-hotkeys.page 2015-01-17 15:47:05.000000000 +0000 +++ gnote-3.16.0/help/da/gnote-hotkeys.page 1970-01-01 00:00:00.000000000 +0000 @@ -1,41 +0,0 @@ - - - - - - Gnote hotkey settings -

GNU Free Documentation License (GFDL), Version 1.1

 - - Pierre-Yves Luyten - 2011 - - - Aurimas Cernius - 2011-2013 - - - Adam Dingle - adam@yorba.org - 2013 - - - - Genvejstaster -

This tab is only available if Gnote was buit with X11 support.

-

The hotkeys tab lets you set global key combinations to perform different functions in Gnote. In order to set key combinations, you must have the Listen for hotkeys checkbox enabled.

- - Vis notesmenu

Enter a key combination for opening the notes menu.

 - Åbn "Start her"

Enter a key combination for opening the “Start Here” note, which is preinstalled with Gnote.

 - Create New Note

Enter a key combination for creating a new note.

 - Open "Search All Notes"

Enter a key combination for opening a search.

 - - -
- <gui>Hotkeys Preferences</gui> window - Gnote hotkeys - -

Setting up Gnote keyboard shortcuts.

- -
- - diff -Nru gnote-3.14.2/help/da/gnote-working-with-notebooks.page gnote-3.16.0/help/da/gnote-working-with-notebooks.page --- gnote-3.14.2/help/da/gnote-working-with-notebooks.page 2015-01-17 15:47:05.000000000 +0000 +++ gnote-3.16.0/help/da/gnote-working-with-notebooks.page 2015-03-29 20:07:18.000000000 +0000 @@ -58,7 +58,7 @@

Drag the note(s) onto a notebook on the left using the mouse.

Click on a notebook, right-click in notes list and select New from the context menu. A new note will be created and added to the notebook.

 -

As you type a note, you can add the note directly to an existing notebook using the Notebook button. The Notebook button is represented by the icon.

+

As you type a note, you can add the note directly to an existing notebook using the ActionsNotebook menu.

Tilføje noter til en notesbog

Add to Notebook.

 @@ -66,7 +66,7 @@

To remove a note from a notebook, use one of the following:

Move the note to Unfiled Notes in the main window.

 -

Select the No Notebook option from the menu which appears when you press the Notebook button in an open note.

 +

Select the No Notebook option from the menu which appears when you press the ActionsNotebook in an open note.

 diff -Nru gnote-3.14.2/help/de/de.po gnote-3.16.0/help/de/de.po --- gnote-3.14.2/help/de/de.po 2015-01-17 12:53:24.000000000 +0000 +++ gnote-3.16.0/help/de/de.po 2015-03-07 18:13:28.000000000 +0000 @@ -4,21 +4,19 @@ # Mario Blättermann , 2009, 2011. # Daniel Winzen , 2012. # This translation is forked from the Tomboy manual. -# Bernd Homuth , 2014. -# msgid "" msgstr "" "Project-Id-Version: gnote master\n" -"POT-Creation-Date: 2014-12-19 21:19+0000\n" -"PO-Revision-Date: 2014-12-25 21:54+0100\n" -"Last-Translator: Bernd Homuth \n" -"Language-Team: Deutsch <>\n" +"POT-Creation-Date: 2014-03-17 09:14+0000\n" +"PO-Revision-Date: 2014-03-17 17:39+0100\n" +"Last-Translator: Christian Kirbach \n" +"Language-Team: German \n" "Language: de\n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" -"Plural-Forms: nplurals=2; plural=(n!=1);\n" -"X-Generator: Gtranslator 2.91.6\n" +"Plural-Forms: nplurals=2; plural=(n != 1);\n" +"X-Generator: Poedit 1.5.4\n" #. Put one translator per line, in the form NAME , YEAR1, YEAR2 msgctxt "_" @@ -27,8 +25,7 @@ "Jochen Skulj , 2008\n" "Christian Kirbach , 2009, 2013, 2014\n" "Mario Blättermann , 2009, 2011, 2012\n" -"Daniel Winzen , 2012\n" -"Bernd Homuth , 2014" +"Daniel Winzen , 2012" #. (itstool) path: info/desc #: C/gnote-addin-bugzillalink.page:9 @@ -89,7 +86,7 @@ #: C/gnote-addins-preferences.page:15 C/gnote-addin-readonly.page:11 #: C/gnote-addin-replacetitle.page:15 C/gnote-addin-specialnotes.page:11 #: C/gnote-addin-sync-local.page:12 C/gnote-addin-sync-webdav.page:12 -#: C/gnote-addin-tableofcontents.page:58 C/gnote-addin-timestamp.page:16 +#: C/gnote-addin-tableofcontents.page:59 C/gnote-addin-timestamp.page:16 #: C/gnote-addin-underline.page:15 C/gnote-bulleted-lists.page:15 #: C/gnote-common-problems.page:15 C/gnote-creating-notes.page:15 #: C/gnote-deleting-notes.page:15 C/gnote-editing-notes.page:13 @@ -103,9 +100,9 @@ #. (itstool) path: credit/years #: C/gnote-addin-bugzillalink.page:17 C/gnote-addin-fixedwidth.page:16 #: C/gnote-addin-html.page:16 C/gnote-addin-noteoftheday.page:16 -#: C/gnote-addin-print.page:16 C/gnote-addin-replacetitle.page:16 -#: C/gnote-addin-timestamp.page:17 C/gnote-addin-underline.page:16 -#: C/gnote-links.page:16 +#: C/gnote-addin-print.page:16 C/gnote-addins-preferences.page:16 +#: C/gnote-addin-replacetitle.page:16 C/gnote-addin-timestamp.page:17 +#: C/gnote-addin-underline.page:16 C/gnote-links.page:16 msgid "2011,2013" msgstr "2011,2013" @@ -115,7 +112,7 @@ #: C/gnote-addin-noteoftheday.page:19 C/gnote-addin-print.page:19 #: C/gnote-addins-preferences.page:19 C/gnote-addin-replacetitle.page:19 #: C/gnote-addin-sync-local.page:16 C/gnote-addin-sync-webdav.page:16 -#: C/gnote-addin-tableofcontents.page:53 C/gnote-addin-timestamp.page:20 +#: C/gnote-addin-tableofcontents.page:54 C/gnote-addin-timestamp.page:20 #: C/gnote-addin-underline.page:19 C/gnote-bulleted-lists.page:19 #: C/gnote-common-problems.page:19 C/gnote-creating-notes.page:19 #: C/gnote-deleting-notes.page:19 C/gnote-editing-notes.page:17 @@ -133,12 +130,12 @@ #: C/gnote-addins-preferences.page:21 C/gnote-addin-readonly.page:12 #: C/gnote-addin-replacetitle.page:21 C/gnote-addin-specialnotes.page:12 #: C/gnote-addin-sync-local.page:18 C/gnote-addin-sync-webdav.page:18 -#: C/gnote-addin-tableofcontents.page:51 C/gnote-addin-tableofcontents.page:55 -#: C/gnote-addin-timestamp.page:22 C/gnote-addin-underline.page:21 -#: C/gnote-bulleted-lists.page:21 C/gnote-common-problems.page:21 -#: C/gnote-creating-notes.page:21 C/gnote-deleting-notes.page:21 -#: C/gnote-editing-notes.page:19 C/gnote-hotkeys.page:21 -#: C/gnote-introduction.page:22 C/gnote-links.page:21 +#: C/gnote-addin-tableofcontents.page:52 C/gnote-addin-tableofcontents.page:56 +#: C/gnote-addin-tableofcontents.page:61 C/gnote-addin-timestamp.page:22 +#: C/gnote-addin-underline.page:21 C/gnote-bulleted-lists.page:21 +#: C/gnote-common-problems.page:21 C/gnote-creating-notes.page:21 +#: C/gnote-deleting-notes.page:21 C/gnote-editing-notes.page:19 +#: C/gnote-hotkeys.page:21 C/gnote-introduction.page:22 C/gnote-links.page:21 #: C/gnote-notes-preferences.page:22 C/gnote-searching-notes.page:21 #: C/gnote-synchronization.page:17 C/gnote-template-notes.page:18 #: C/gnote-working-with-notebooks.page:22 @@ -148,15 +145,19 @@ #. (itstool) path: page/title #: C/gnote-addin-bugzillalink.page:26 msgid "Bugzilla Links Add-in" -msgstr "Erweiterung Bugzilla-Links" +msgstr "Bugzilla-Links-Add-in" #. (itstool) path: page/p #: C/gnote-addin-bugzillalink.page:27 +#| msgid "" +#| "This add-in lets you drag a Bugzilla URL directly into a Gnote " +#| "note. The bug number is inserted as a link with a little bug icon next to " +#| "it." msgid "" "This plugin lets you drag a Bugzilla URL directly into a Gnote " "note. The bug number is inserted as a link with a little bug icon next to it." msgstr "" -"Diese Erweiterung ermöglicht es Ihnen, eine Bugzilla-Adresse direkt in eine " +"Dieses Add-in ermöglicht es Ihnen, eine Bugzilla-Adresse direkt in eine " "Gnote-Notiz zu ziehen. Die Fehlernummer wird als Verknüpfung mit " "einem kleinen Bug-Symbol angezeigt." @@ -175,17 +176,22 @@ #. (itstool) path: page/title #: C/gnote-addin-fixedwidth.page:25 msgid "Fixed Width Add-in" -msgstr "Erweiterung Feste-Breite" +msgstr "Feste-Breite-Add-In" #. (itstool) path: page/p #: C/gnote-addin-fixedwidth.page:26 +#| msgid "" +#| "The Fixed Width add-in allows text to use a fixed width font. " +#| "To change existing text, first select the text you want to modify. Then " +#| "select Fixed Width from the Text menu. You can also " +#| "select Fixed Width from the menu before you start typing." msgid "" "The Fixed Width plugin allows text to use a fixed width font. To " "change existing text, first select the text you want to modify. Then select " "Fixed Width from the Text menu. You can also select " "Fixed Width from the menu before you start typing." msgstr "" -"Die Erweiterung Feste Breite ermöglicht es, einen Text in einer " +"Das Add-in Feste Breite ermöglicht es, einen Text in einer " "Schriftart mit fester Breite darzustellen. Um einen Text zu ändern, " "markieren Sie zuerst den Text, den Sie ändern möchten. Danach wählen Sie die " "Option Feste Breite aus dem Menü Text. Sie können auch " @@ -204,13 +210,16 @@ #. (itstool) path: page/p #: C/gnote-addin-html.page:26 +#, fuzzy +#| msgid "" +#| "When the Replace title add-in is installed, the command " +#| "Replace title is present in the Actions menu." msgid "" "When the Export to HTML plugin is installed, the command " "Export to HTML is present in the Actions menu." msgstr "" -"Wenn die Erweiterung Als HTML exportieren installiert ist, stellt " -"das Menü Aktionen den Befehl Als HTML exportieren zur " -"Verfügung." +"Wenn das Titel ersetzen-Add-In installiert ist, stellt das Menü " +"Aktionen einen Menüpunkt Titel ersetzen zur Verfügung." #. (itstool) path: page/p #: C/gnote-addin-html.page:27 @@ -242,6 +251,7 @@ #. (itstool) path: credit/years #: C/gnote-addin-notedirwatcher.page:12 +#| msgid "2011-2013" msgid "2012-2013" msgstr "2012-2013" @@ -252,20 +262,31 @@ #. (itstool) path: page/p #: C/gnote-addin-notedirwatcher.page:22 +#| msgid "" +#| "This add-in lets you work with notes on the file system while Gnote is running. When enabled, this add-in monitors note files for " +#| "changes and reloads them when any change is detected. This way any " +#| "external change to a note file will automatically be reflected in " +#| "Gnote." msgid "" "This plugin lets you work with notes on the file system while Gnote is running. When enabled, this plugin monitors note files for changes " "and reloads them when any change is detected. This way any external change " "to a note file will automatically be reflected in Gnote." msgstr "" -"Diese Erweiterung ermöglicht es mit Notizen auf einem Dateisystem zu " -"arbeiten, während Gnote läuft. Wenn es aktiviert ist, überwacht " -"es Notizdateien auf Änderungen und lädt sie gegebenenfalls neu, sobald eine " +"Dieses Add-In ermöglicht es mit Notizen auf einem Dateisystem zu arbeiten, " +"während Gnote läuft. Wenn es aktiviert ist, überwacht es " +"Notizdateien auf Änderungen und lädt sie gegebenenfalls neu, sobald eine " "Änderung erkannt wurde. Auf diese Weise werden externe Änderungen an einer " "Notizdatei automatisch in Gnote übernommen." #. (itstool) path: page/p #: C/gnote-addin-notedirwatcher.page:23 +#| msgid "" +#| "Gnote stores notes in the ~/.local/share/gnote " +#| "folder. With this add-in is enabled, you can perform actions at the file " +#| "system level on this directory, such as synchronizing note files with " +#| "some other location, while Gnote is running." msgid "" "Gnote stores notes in the ~/.local/share/gnote " "folder. With this plugin is enabled, you can perform actions at the file " @@ -273,14 +294,15 @@ "other location, while Gnote is running." msgstr "" "Gnote speichert Notizen im Ordner ~/.local/share/gnote. Wenn diese Erweiterung aktiv ist, können Sie in diesem Ordner auf " +"file>. Wenn dieses Add-In aktiv ist, können Sie in diesem Ordner auf " "Dateisystemebene arbeiten, wie z.B. Inhaltsabgleich mit einem anderen Ort, " "während Gnote läuft." #. (itstool) path: info/desc #: C/gnote-addin-noteoftheday.page:8 +#, fuzzy msgid "A \"Today\" note" -msgstr "Eine »Notiz des Tages«" +msgstr "Achtelnote" #. (itstool) path: page/title #: C/gnote-addin-noteoftheday.page:25 @@ -289,24 +311,31 @@ #. (itstool) path: page/p #: C/gnote-addin-noteoftheday.page:26 +#| msgid "" +#| "This add-in automatically creates a \"Today\" note for jotting daily " +#| "thoughts down. As an example, a \"Today\" note created on February 28, " +#| "2013 would be called \"Today: Thursday, February 28 2013\"." msgid "" "This plugin automatically creates a \"Today\" note for jotting daily " "thoughts down. As an example, a \"Today\" note created on February 28, 2013 " "would be called \"Today: Thursday, February 28 2013\"." msgstr "" -"Diese Erweiterung erzeugt automatisch eine »Heute«-Notiz, um tägliche " -"Gedanken festzuhalten. Das aktuelle Datum dient als Basis für den Titel " -"dieser Notiz. Beispielsweise ist der Titel einer »Heute«-Notiz, die am 28. " -"Februar 2013 angelegt wurde, »Heute: Donnerstag, 28. Februar 2013«." +"Dieses Add-In erzeugt automatisch eine »Heute«-Notiz, um tägliche Gedanken " +"festzuhalten. Das aktuelle Datum dient als Basis für den Titel dieser Notiz. " +"Beispielsweise ist der Titel einer »Heute«-Notiz, die am 28. Februar 2013 " +"angelegt wurde, »Heute: Donnerstag, 28. Februar 2013«." #. (itstool) path: page/p #: C/gnote-addin-noteoftheday.page:27 +#| msgid "" +#| "If you leave a \"Today\" note unmodified, the add-in will automatically " +#| "delete the note." msgid "" "If you leave a \"Today\" note unmodified, the plugin will automatically " "delete the note." msgstr "" -"Wenn Sie die »Heute«-Notiz unverändert lassen, wird die Erweiterung die " -"Notiz automatisch löschen." +"Wenn Sie die »Heute«-Notiz unverändert lassen, wird das Add-In die Notiz " +"automatisch löschen." #. (itstool) path: page/p #: C/gnote-addin-noteoftheday.page:28 @@ -338,9 +367,6 @@ "is present in the Actions menu. This command opens a " "standard Print dialog which lets you print a note." msgstr "" -"Wenn die Erweiterung Drucken installiert ist, so erscheint der " -"Befehl Drucken im Menü Aktionen. Dieser Befehl öffnet " -"den Standard-Druckdialog zum Drucken einer Notiz." #. (itstool) path: media #. This is a reference to an external file such as an image or video. When @@ -348,6 +374,10 @@ #. update your localized copy. The msgstr is not used at all. Set it to #. whatever you like once you have updated your copy of the file. #: C/gnote-addins-preferences.page:30 +#| msgctxt "_" +#| msgid "" +#| "external ref='figures/gnote-preferences-add-ins.png' " +#| "md5='656cb88e6f7df1661cd359bac9602f60'" msgctxt "_" msgid "" "external ref='figures/gnote-preferences-add-ins.png' " @@ -356,63 +386,58 @@ #. (itstool) path: info/desc #: C/gnote-addins-preferences.page:8 +#| msgid "Settings for Gnote add-ins" msgid "Settings for Gnote plugins" -msgstr "Einstellungen für Gnote-Erweiterungen" - -#. (itstool) path: credit/years -#: C/gnote-addins-preferences.page:16 -#| msgid "2011,2013" -msgid "2011,2013,2014" -msgstr "2011,2013,2014" +msgstr "Einstellungen für Gnote-Add-Ins" #. (itstool) path: page/title #: C/gnote-addins-preferences.page:25 msgid "Add-in Preferences" -msgstr "Erweiterungseinstellungen" +msgstr "Add-In-Einstellungen" #. (itstool) path: page/p #: C/gnote-addins-preferences.page:26 +#, fuzzy #| msgid "" -#| "You can activate or deactivate plugins in this tab. To do this, select an " -#| "plugin and click the Enable button. Use the Disable " -#| "button to disable an plugin." +#| "You can activate or deactivate add-ins in this tab. To do this, select an " +#| "add-in and click the Enable button. Use the Disable " +#| "button to disable an add-in." msgid "" -"You can activate or deactivate plugins in this tab. To do this, select a " +"You can activate or deactivate plugins in this tab. To do this, select an " "plugin and click the Enable button. Use the Disable " -"button to disable a plugin." +"button to disable an plugin." msgstr "" -"Sie können in diesem Reiter Erweiterungen aktivieren und deaktivieren. " -"Wählen Sie dazu eine Erweiterung aus und klicken Sie auf den Knopf " -"Aktivieren. Klicken Sie auf Deaktivieren zum " -"Deaktivieren der Erweiterung." +"Sie können in diesem Reiter Add-Ins aktivieren oder deaktivieren. Wählen Sie " +"dazu ein Add-In aus und klicken Sie auf den Knopf Aktivieren. " +"Klicken Sie auf Deaktivieren zum Deaktivieren eines Add-Ins." #. (itstool) path: page/p #: C/gnote-addins-preferences.page:27 +#, fuzzy #| msgid "" -#| "Some plugins have preferences, which you can access by selecting an " -#| "plugin and pressing the Preferences button." +#| "Some add-ins have preferences, which you can access by selecting an add-" +#| "in and pressing the Preferences button." msgid "" -"Some plugins have preferences, which you can access by selecting a plugin " +"Some plugins have preferences, which you can access by selecting an plugin " "and pressing the Preferences button." msgstr "" -"Einige Erweiterungen haben Einstellungen, auf die Sie zugreifen können, " -"indem Sie eine Erweiterung wählen und auf den Knopf Einstellungen " -"klicken." +"Einige Add-Ins haben Einstellmöglichkeiten. Wählen Sie für die Einstellungen " +"das Add-In aus und klicken Sie auf den Einstellungen-Knopf." #. (itstool) path: figure/title #: C/gnote-addins-preferences.page:28 msgid "Gnote Addin Preferences" -msgstr "Erweiterungseinstellungen für Gnote" +msgstr "Add-in-Einstellungen für Gnote" #. (itstool) path: figure/desc #: C/gnote-addins-preferences.page:29 msgid "Gnote Add-ins window" -msgstr "Erweiterung-Fenster von Gnote" +msgstr "Add-In-Fenster von Gnote" #. (itstool) path: media/p #: C/gnote-addins-preferences.page:31 msgid "Add-ins window." -msgstr "Erweiterung-Fenster von Gnote" +msgstr "Add-in-Fenster von Gnote" #. (itstool) path: info/desc #: C/gnote-addin-readonly.page:8 @@ -433,11 +458,6 @@ "until the menu item is unchecked. Use this to prevent notes from accidental " "modification." msgstr "" -"Wenn die Erweiterung Nur lesen installiert ist, stellt das Menü " -"Aktionen den Eintrag Nur lesen zur Verfügung. Wenn " -"dieser Eintrag ausgewählt wird, so ist die Notiz nur lesbar. Somit kann die " -"Notiz nicht geändert werden, solange die Funktion ausgewählt ist. Verwenden " -"Sie diese Funktion, um Notizen vor versehentlichen Änderungen zu schützen." #. (itstool) path: info/desc #: C/gnote-addin-replacetitle.page:8 @@ -451,13 +471,15 @@ #. (itstool) path: page/p #: C/gnote-addin-replacetitle.page:26 +#| msgid "" +#| "When the Replace title add-in is installed, the command " +#| "Replace title is present in the Actions menu." msgid "" "When the Replace title plugin is installed, the command " "Replace title is present in the Actions menu." msgstr "" -"Wenn die Erweiterung Titel ersetzen installiert ist, stellt das " -"Menü Aktionen einen Menüpunkt Titel ersetzen zur " -"Verfügung." +"Wenn das Titel ersetzen-Add-In installiert ist, stellt das Menü " +"Aktionen einen Menüpunkt Titel ersetzen zur Verfügung." #. (itstool) path: page/p #: C/gnote-addin-replacetitle.page:27 @@ -479,8 +501,10 @@ #. (itstool) path: info/desc #: C/gnote-addin-specialnotes.page:8 +#, fuzzy +#| msgid "Special Notebooks" msgid "See special notes" -msgstr "Lesen Sie zu besonderen Notizen" +msgstr "Besondere Notizbücher" #. (itstool) path: page/title #: C/gnote-addin-specialnotes.page:16 @@ -495,11 +519,6 @@ "notebook contains notes that are otherwise not visible, such as template " "notes. This might be convenient way to go through all your templates." msgstr "" -"Wenn die Erweiterung Besondere Notizen installiert ist, so ist " -"das besondere Notizbuch Besondere Notizen in der Liste der " -"Notizbücher verfügbar. Dieses Notizbuch enthält Notizen, die andernfalls " -"nicht sichtbar sind, wie z.B. Notizvorlagen. Es ist eine bequeme Möglichkeit " -"alle Ihre Vorlagen durchzusehen." #. (itstool) path: media #. This is a reference to an external file such as an image or video. When @@ -507,6 +526,10 @@ #. update your localized copy. The msgstr is not used at all. Set it to #. whatever you like once you have updated your copy of the file. #: C/gnote-addin-sync-local.page:27 +#| msgctxt "_" +#| msgid "" +#| "external ref='figures/gnote-syncprefs-local.png' " +#| "md5='1cddc428aab1c3a18624f950260a4f23'" msgctxt "_" msgid "" "external ref='figures/gnote-syncprefs-local.png' " @@ -570,6 +593,10 @@ #. update your localized copy. The msgstr is not used at all. Set it to #. whatever you like once you have updated your copy of the file. #: C/gnote-addin-sync-webdav.page:32 +#| msgctxt "_" +#| msgid "" +#| "external ref='figures/gnote-syncprefs-webdav.png' " +#| "md5='f860508443cba1f3d9518ac171361016'" msgctxt "_" msgid "" "external ref='figures/gnote-syncprefs-webdav.png' " @@ -629,7 +656,11 @@ #. the file changes, the md5 hash will change to let you know you need to #. update your localized copy. The msgstr is not used at all. Set it to #. whatever you like once you have updated your copy of the file. -#: C/gnote-addin-tableofcontents.page:116 +#: C/gnote-addin-tableofcontents.page:117 +#| msgctxt "_" +#| msgid "" +#| "external ref='figures/gnote-new-note.png' " +#| "md5='715712e6322a5bf8c9aa1a6de1bb619b'" msgctxt "_" msgid "" "external ref='figures/gnote-addin-table-of-contents.png' " @@ -637,7 +668,7 @@ msgstr "" #. (itstool) path: license/p -#: C/gnote-addin-tableofcontents.page:42 +#: C/gnote-addin-tableofcontents.page:43 msgid "" "This help topic is licensed under the GNU Free Documentation License, Version 1.1Navigate long structured notes" -msgstr "Lange strukturierte Notizen durchsuchen" +msgstr "" #. (itstool) path: note/p -#: C/gnote-addin-tableofcontents.page:87 -#| msgid "" -#| "This is an plugin to Gnotes. When this plugin is installed, " -#| "there is a Table of Contents entry in the actions " -#| "menu. See to learn how to activate an " -#| "plugin." +#: C/gnote-addin-tableofcontents.page:88 msgid "" -"This is a plugin to Gnotes. When this plugin is installed, there " +"This is an plugin to Gnotes. When this plugin is installed, there " "is a Table of Contents entry in the actions menu. See " -" to learn how to activate a plugin." +" to learn how to activate an plugin." msgstr "" -"Dies ist eine Erweiterung für Gnotes. Wenn diese Erweiterung " -"installiert ist, enthält das Menü Aktionen den Eintrag " -"Inhaltsverzeichnis. Lesen Sie , um zu erfahren, wie Erweiterungen aktiviert werden." #. (itstool) path: section/title -#: C/gnote-addin-tableofcontents.page:95 +#: C/gnote-addin-tableofcontents.page:96 msgid "In a nutshell" msgstr "Kurz und bündig" #. (itstool) path: item/p -#: C/gnote-addin-tableofcontents.page:99 +#: C/gnote-addin-tableofcontents.page:100 msgid "" "A heading is a full line of text, formatted with Bold+Huge or " "Bold+Large." msgstr "" -"Eine Überschrift ist eine vollständige Zeile Text, die Fett+Groß " -"oder Fett+Riesig formatiert ist." #. (itstool) path: item/p -#: C/gnote-addin-tableofcontents.page:102 +#: C/gnote-addin-tableofcontents.page:103 msgid "" "Set headings with Ctrl1 or " "Ctrl2." @@ -712,7 +726,7 @@ "oder Strg2 fest." #. (itstool) path: item/p -#: C/gnote-addin-tableofcontents.page:107 +#: C/gnote-addin-tableofcontents.page:108 msgid "" "Open the table of contents with CtrlAlt1, and jump to any heading." @@ -722,118 +736,98 @@ "Überschrift." #. (itstool) path: section/title -#: C/gnote-addin-tableofcontents.page:113 +#: C/gnote-addin-tableofcontents.page:114 msgid "Screenshot" msgstr "Bildschirmfoto" #. (itstool) path: figure/title -#: C/gnote-addin-tableofcontents.page:115 +#: C/gnote-addin-tableofcontents.page:116 msgid "A structured note with its table of contents" -msgstr "Eine strukturierte Notiz mit Inhaltsverzeichnis" +msgstr "" #. (itstool) path: section/title -#: C/gnote-addin-tableofcontents.page:122 +#: C/gnote-addin-tableofcontents.page:123 msgid "Navigating through long notes" -msgstr "Lange Notizen durchsuchen" +msgstr "" #. (itstool) path: section/p -#: C/gnote-addin-tableofcontents.page:124 +#: C/gnote-addin-tableofcontents.page:125 msgid "" "A long note may become difficult to navigate. It is then natural to " "structure the note by marking sections and subsections with headings." msgstr "" -"Eine lange Notiz wird schwer durchsuchbar. Es erscheint sinnvoll, die Notiz " -"mit Überschriften für Abschnitte und Unterabschnitte zu strukturieren." #. (itstool) path: section/p -#: C/gnote-addin-tableofcontents.page:130 +#: C/gnote-addin-tableofcontents.page:131 msgid "" "This plugin makes it easy to navigate through long structured notes. Once " "you have set headings in your note, the table of contents of the note will " "show in actions menu. Then you can jump directly from the menu to any " "heading." msgstr "" -"Mit dieser Erweiterung orientieren Sie sich leicht in langen strukturierten " -"Notizen. Sobald Sie Überschriften in Ihrer Notiz verwenden, erscheint das " -"Inhaltsverzeichnis im Aktionen-Menü. Springen Sie dann direkt mit Hilfe des " -"Menüs zu einer beliebigen Überschrift." #. (itstool) path: section/title -#: C/gnote-addin-tableofcontents.page:140 +#: C/gnote-addin-tableofcontents.page:141 msgid "Structuring your notes with headings" msgstr "Ihre Notizen mit Hilfe von Überschriften strukturieren" #. (itstool) path: section/p -#: C/gnote-addin-tableofcontents.page:142 +#: C/gnote-addin-tableofcontents.page:143 msgid "A heading is simply a complete line with specific text formatting:" msgstr "" -"Eine Überschrift ist einfach eine vollständige Zeile mit einer spezifischen " -"Textformatierung:" #. (itstool) path: item/p -#: C/gnote-addin-tableofcontents.page:146 +#: C/gnote-addin-tableofcontents.page:147 msgid "" "Level 1 headings, for sections, are lines formatted with a Bold+Huge font." msgstr "" -"Überschriften der Ebene 1 für Abschnitte sind Zeilen, die mit der Schrift " -"Fett+Riesig formatiert werden." #. (itstool) path: item/p -#: C/gnote-addin-tableofcontents.page:147 +#: C/gnote-addin-tableofcontents.page:148 msgid "" "Level 2 headings, for subsections, are lines formatted with a Bold" "+Large font." msgstr "" -"Überschriften der Ebene 1 für Unterabschnitte sind Zeilen, die mit der " -"Schrift Fett+Groß formatiert werden." #. (itstool) path: section/p -#: C/gnote-addin-tableofcontents.page:151 +#: C/gnote-addin-tableofcontents.page:152 msgid "To format a heading line, either:" -msgstr "Eine Kopfzeile formatieren Sie auf eine der folgenden Weisen:" +msgstr "" #. (itstool) path: item/p -#: C/gnote-addin-tableofcontents.page:155 +#: C/gnote-addin-tableofcontents.page:156 msgid "" "Use the commands Heading 1 and Heading 2 in the " "ActionsTable of Contents menu." msgstr "" -"Verwenden Sie die Befehle Überschrift 1 und Überschrift 2 im Menü AktionenInhaltsverzeichnis." #. (itstool) path: item/p -#: C/gnote-addin-tableofcontents.page:160 +#: C/gnote-addin-tableofcontents.page:161 msgid "" "Use the keyboard shortcuts Ctrl1 and " "Ctrl2 for headings of level 1 and 2." msgstr "" "Verwenden Sie die Tastenkombinationen Strg1 und Strg2 für Überschriften " -"der Ebenen 1 und 2." +"der Stufe 1 und 2." #. (itstool) path: note/p -#: C/gnote-addin-tableofcontents.page:165 +#: C/gnote-addin-tableofcontents.page:166 msgid "" "These commands apply the formatting to the complete line. You don't need to " "select it first. It is enough if the cursor is on the line." msgstr "" -"Diese Befehle wenden die Formatierung auf die vollständige Zeile an. Sie " -"muss nicht zuvor ausgewählt werden. Es ist ausreichend, wenn sich die " -"Eingabemarke in der Zeile befindet." #. (itstool) path: note/p -#: C/gnote-addin-tableofcontents.page:169 +#: C/gnote-addin-tableofcontents.page:170 msgid "" "Alternatively, with the cursor on a new line, activate the heading command " "and then enter the heading title." msgstr "" -"Setzen Sie alternativ die Eingabemarke in eine neue Zeile, aktivieren Sie " -"den Befehl »Überschrift« und geben Sie dann die Überschrifteinzeile ein." #. (itstool) path: section/p -#: C/gnote-addin-tableofcontents.page:173 +#: C/gnote-addin-tableofcontents.page:174 msgid "" "You can even use the normal formatting commands from the Text " "menu: Bold, Large and Huge, and their " @@ -842,25 +836,19 @@ "gui> to turn it into a heading 1. See to " "learn how to set text styles." msgstr "" -"Verwenden Sie die normalen Formatierungsbefehle im Textmenü: " -"Fett, Groß und Riesig sowie die " -"entsprechenden Tastenkombinationen. Falls Ihre Zeile z.B. als riesig formatiert ist, so müssen Sie diese ebenfalls Fett setzen, " -"um sie in eine Überschrift der Ebene 1 zu verwandeln. Lesen Sie um zu erfahren, wie man Textstile festlegt." #. (itstool) path: section/title -#: C/gnote-addin-tableofcontents.page:182 +#: C/gnote-addin-tableofcontents.page:183 msgid "Showing the table of contents" msgstr "Das Inhaltsverzeichnis anzeigen" #. (itstool) path: section/p -#: C/gnote-addin-tableofcontents.page:184 +#: C/gnote-addin-tableofcontents.page:185 msgid "You can access the table of contents either:" -msgstr "Sie können auf das Inhaltsverzeichnis zugreifen entweder:" +msgstr "" #. (itstool) path: item/p -#: C/gnote-addin-tableofcontents.page:186 +#: C/gnote-addin-tableofcontents.page:187 msgid "" "In the menu ActionsTable of Contents." msgstr "" @@ -868,74 +856,58 @@ "guiseq> aus." #. (itstool) path: item/p -#: C/gnote-addin-tableofcontents.page:187 +#: C/gnote-addin-tableofcontents.page:188 msgid "" "In context menuTable of Contents " "(right-click on the note window)." msgstr "" -"Über KontextmenüInhaltsverzeichnis " -"(Klick mit der rechten Maustaste in das Notizfenster)." #. (itstool) path: item/p -#: C/gnote-addin-tableofcontents.page:188 +#: C/gnote-addin-tableofcontents.page:189 msgid "" "In a popup menu, with the keyboard shortcut CtrlAlt1." msgstr "" -"Über ein Einblendmenü mit der Tastenkombination " -"StrgAlt1." #. (itstool) path: list/p -#: C/gnote-addin-tableofcontents.page:189 +#: C/gnote-addin-tableofcontents.page:190 msgid "" "Then you can navigate up and down with the arrow keys and jump to the " "selected heading with enter. Or just click with your mouse on the " "heading to jump to." msgstr "" -"Wählen Sie anschließend mit den Pfeiltasten eine Überschrift und springen " -"Sie mit der Eingabetaste dort hin. Klicken Sie zum Springen " -"alternativ mit Ihrer Maus auf die entsprechende Überschrift." #. (itstool) path: section/title -#: C/gnote-addin-tableofcontents.page:195 +#: C/gnote-addin-tableofcontents.page:196 msgid "Troubleshooting" msgstr "Fehlersuche" #. (itstool) path: item/title -#: C/gnote-addin-tableofcontents.page:197 +#: C/gnote-addin-tableofcontents.page:198 msgid "" "One heading does not show in the table of contents" msgstr "" -"Eine Überschrift erscheint nicht im Inhaltsverzeichnis" #. (itstool) path: item/p -#: C/gnote-addin-tableofcontents.page:197 +#: C/gnote-addin-tableofcontents.page:198 msgid "" "There might be some characters in the heading line, such as whitespace " "characters, which are not formatted as a heading. Make sure that the " "whole line is formatted as a heading. See ." msgstr "" -"Eventuell sind einige Zeichen in der Überschrift enthalten wie z.B. " -"untrennbare Lesezeichen, die nicht als Überschrift formatiert werden. " -"Stellen Sie sicher, dass die vollständige Zeile als Überschrift " -"formatiert ist. Lesen Sie auch ." #. (itstool) path: item/title -#: C/gnote-addin-tableofcontents.page:200 +#: C/gnote-addin-tableofcontents.page:201 msgid "" "There is an empty line in the table of contents" -msgstr "Eine leere Zeile ist im Inhaltsverzeichnis" +msgstr "" #. (itstool) path: item/p -#: C/gnote-addin-tableofcontents.page:200 +#: C/gnote-addin-tableofcontents.page:201 msgid "" "An empty line, possibly including whitespaces, is formatted as a heading. " "Jump to this line and delete the area." msgstr "" -"Eine leere Zeile ist als Überschrift formatiert, die möglicherweise ein " -"nicht trennbares Leerzeichen enthält. Wechseln Sie in diese Zeile und " -"löschen Sie den Bereich." #. (itstool) path: info/desc #: C/gnote-addin-timestamp.page:9 @@ -945,19 +917,23 @@ #. (itstool) path: page/title #: C/gnote-addin-timestamp.page:26 msgid "Insert Timestamp Add-in" -msgstr "Erweiterung Zeitstempel-einfügen" +msgstr "Zeitstempel-einfügen-Add-In" #. (itstool) path: page/p #: C/gnote-addin-timestamp.page:28 +#| msgid "" +#| "When the Insert Timestamp add-in is installed, " +#| "the Actions menu will include a Insert Timestamp " +#| "command. Select this command to insert the current date and time." msgid "" "When the Insert Timestamp plugin is installed, the Actions menu will include a Insert Timestamp command. Select this " "command to insert the current date and time." msgstr "" -"Wenn die Erweiterung Zeitstempel einfügen installiert ist, stellt " -"das Menü Werkzeuge einen Eintrag namens Zeitstempel " -"einfügen zur Verfügung. Verwenden Sie diesen Befehl, um die aktuelle " -"Uhrzeit und das aktuelle Datum einzufügen." +"Wenn das Zeitstempel einfügen-Add-In installiert ist, stellt das " +"Menü Werkzeuge einen Eintrag namens Zeitstempel einfügen zur Verfügung. Verwenden Sie diesen Befehl, um die aktuelle Uhrzeit und " +"das aktuelle Datum einzufügen." #. (itstool) path: info/desc #: C/gnote-addin-underline.page:8 @@ -967,16 +943,19 @@ #. (itstool) path: page/title #: C/gnote-addin-underline.page:25 msgid "Underline Text Add-In" -msgstr "Erweiterung Text-unterstreichen" +msgstr "Text-unterstreichen-Add-In" #. (itstool) path: page/p #: C/gnote-addin-underline.page:26 +#| msgid "" +#| "When the Underline add-in is installed, the Text menu will have a Underline option available." msgid "" "When the Underline plugin is installed, the Text menu " "will have a Underline option available." msgstr "" -"Wenn die Erweiterung Unterstreichen installiert ist, stellt das " -"Menü Text einen Menüpunkt Unterstreichen zur Verfügung." +"Wenn das Unterstreichen-Add-In installiert ist, stellt das Menü " +"Text einen Menüpunkt Unterstreichen zur Verfügung." #. (itstool) path: page/p #: C/gnote-addin-underline.page:27 @@ -1164,10 +1143,11 @@ msgstr "Häufig gestellte Fragen" #. (itstool) path: credit/years -#: C/gnote-common-problems.page:16 -#| msgid "2011-2013" -msgid "2011-2014" -msgstr "2011-2014" +#: C/gnote-common-problems.page:16 C/gnote-editing-notes.page:14 +#: C/gnote-hotkeys.page:16 C/gnote-notes-preferences.page:17 +#: C/gnote-searching-notes.page:16 +msgid "2011-2013" +msgstr "2011-2013" #. (itstool) path: page/title #: C/gnote-common-problems.page:25 @@ -1182,11 +1162,11 @@ #. (itstool) path: item/p #: C/gnote-common-problems.page:27 #| msgid "" -#| "You can import Tomboy Notes. An plugin has to be activated." -msgid "You can import Tomboy Notes. A plugin has to be activated." +#| "You can import Tomboy Notes. An add-in has to be activated." +msgid "You can import Tomboy Notes. An plugin has to be activated." msgstr "" -"Sie können Tomboy-Notizen importieren. Hierfür muss eine " -"Erweiterung aktiviert werden." +"Sie können Tomboy-Notizen importieren. Hierfür muss ein Add-In " +"aktiviert werden." #. (itstool) path: item/title #: C/gnote-common-problems.page:29 @@ -1199,8 +1179,6 @@ "You can activate the Gnote status icon in Gnote Preferences " "dialog." msgstr "" -"Aktivieren Sie das Statussymbol von Gnote im Einstellungsdialog " -"von Gnote." #. (itstool) path: item/title #: C/gnote-common-problems.page:31 @@ -1222,7 +1200,6 @@ #: C/gnote-common-problems.page:34 msgid "I'm not comfortable with new single-window interface" msgstr "" -"Ich kenne mich nicht mit der neuen Ein-Fenster-Benutzerschnittstelle aus" #. (itstool) path: item/p #: C/gnote-common-problems.page:34 @@ -1230,9 +1207,6 @@ "You can make Gnote behave the old way by selecting Always " "open notes in new window in Preferences dialog." msgstr "" -"Gnote kann sich im traditionellen Stil präsentieren, wenn Sie " -"Notizen immer in neuem Fenster öffnen im Einstellungsdialog " -"wählen." #. (itstool) path: info/desc #: C/gnote-creating-notes.page:9 @@ -1348,15 +1322,14 @@ #. update your localized copy. The msgstr is not used at all. Set it to #. whatever you like once you have updated your copy of the file. #: C/gnote-editing-notes.page:30 -#, fuzzy #| msgctxt "_" #| msgid "" #| "external ref='figures/gnote-new-note.png' " -#| "md5='19aba6328987181e2c23bc0664eb3fd1'" +#| "md5='715712e6322a5bf8c9aa1a6de1bb619b'" msgctxt "_" msgid "" "external ref='figures/gnote-new-note.png' " -"md5='722aeec3c4f00089d2b8a3884e7559dc'" +"md5='19aba6328987181e2c23bc0664eb3fd1'" msgstr "ok" #. (itstool) path: info/desc @@ -1364,12 +1337,6 @@ msgid "Editing note contents" msgstr "Inhalt von Notizen bearbeiten" -#. (itstool) path: credit/years -#: C/gnote-editing-notes.page:14 C/gnote-hotkeys.page:16 -#: C/gnote-notes-preferences.page:17 C/gnote-searching-notes.page:16 -msgid "2011-2013" -msgstr "2011-2013" - #. (itstool) path: page/title #: C/gnote-editing-notes.page:23 msgid "Editing Notes" @@ -1381,8 +1348,6 @@ "When you open a note, Gnote will replace the note overview with " "the note's contents." msgstr "" -"Wenn Sie eine Notiz öffnen, ersetzt Gnote die Notizübersicht mit " -"dem Inhalt der Notiz." #. (itstool) path: page/p #: C/gnote-editing-notes.page:26 @@ -1390,8 +1355,6 @@ "Toolbar at the top of the window will now contain note specific items in it. " "Bellow toolbar is the note's content area." msgstr "" -"Die Werkzeugleiste oben im Fenster enthält nun Objekte für Notizen. " -"Unterhalb der Werkzeugleiste ist der Inhalt der Notiz." #. (itstool) path: figure/title #: C/gnote-editing-notes.page:28 @@ -1416,10 +1379,6 @@ "\"New Note (number)\". To change the title, click on the first line and use " "the keyboard to change the title." msgstr "" -"Klicken Sie einfach in eine Notiz und tippen Sie, um die Notiz zu " -"bearbeiten. Die erste Zeile ist automatisch der Notiztitel. Per Vorgabe ist " -"sie mit dem Text »Neue Notiz (Zahl)« belegt. Klicken Sie in die erste Zeile " -"und verwenden Sie die Tastatur, um den Titel zu ändern." #. (itstool) path: page/p #: C/gnote-editing-notes.page:36 @@ -1427,8 +1386,6 @@ "Use the Text button to format text within your notes. This button " "displays a menu with several commands:" msgstr "" -"Verwenden Sie den Knopf Text, um Text in Ihrer Notiz zu " -"formatieren. Der Knopf öffnet ein Menü mit verschiedenen Befehlen:" #. (itstool) path: item/title #: C/gnote-editing-notes.page:39 @@ -1459,10 +1416,6 @@ "Undo feature. To redo your last change using the keyboard, press " "ShiftCtrlZ." msgstr "" -"Der Befehl Wiederholen stellt die Änderungen, die über den " -"Rückgängig machen-Befehl eingeleitet wurden, wieder her. Um das " -"letzte Rückgängig machen wiederherzustellen, drücken Sie auf Ihrer Tastatur " -"UmschalttasteStrgZ." #. (itstool) path: item/title #: C/gnote-editing-notes.page:45 @@ -1592,6 +1545,16 @@ #. (itstool) path: page/p #: C/gnote-editing-notes.page:66 +#, fuzzy +#| msgid "" +#| "Use this to search for text within the current note. A small find bar " +#| "will open up at the bottom of the note. To open the find bar using the " +#| "keyboard, use the standard keybinding, CtrlF. Enter text to find. After entering text, the matches will " +#| "be highlighted. Click Next to highlight the next match and " +#| "place the cursor there. Click Previous to move to the previous " +#| "match. To close the find bar, click X (Close Button) on the far left or " +#| "press the Escape key." msgid "" "The toolbar at the top of note has search button. Use it to search for text " "within the current note. A small find bar will appear above the note. To " @@ -1602,17 +1565,15 @@ "match. To close the find bar, click the search button again or press the " "Escape key." msgstr "" -"Die Werkzeugleiste oben in einer Notiz enthält einen Suchknopf. Mit dieser " -"Option können Sie nach Text in der aktuellen Notiz suchen. Eine kleine " -"Suchleiste wird oberhalb der Notiz geöffnet. Um die Suchleiste mit der " -"Tastatur zu öffnen, verwenden Sie die Standard-Tastenkombination " +"Mit dieser Option können Sie nach Text in der aktuellen Notiz suchen. Ein " +"Eingabefeld wird am unteren Rand der Notiz geöffnet. Um das Eingabefeld mit " +"der Tastatur zu öffnen, verwenden Sie die Standard-Tastenkombination " "StrgF. Geben Sie den zu suchenden " -"Text ein und drücken Sie die Eingabetaste. Die Treffer werden " -"hervorgehoben. Klicken Sie auf Nächster Treffer, um das nächste " -"Vorkommen des Suchbegriffs hervorzuheben und die Eingabemarke dort zu " -"platzieren. Klicken Sie auf Vorheriger Treffer, um zum vorherigen " -"Vorkommen zu springen. Um die Suchleiste zu schließen, klicken Sie erneut " -"auf den Suchknopf oder drücken Sie die Esc-Taste." +"Text ein. Nach der Texteingabe werden die Treffer hervorgehoben. Klicken Sie " +"auf Nächster Treffer, um das nächste Vorkommen des Suchbegriffs " +"hervorzuheben, oder auf Vorheriger Treffer, um zum vorherigen " +"Vorkommen zu springen. Um das Suchfeld zu schließen, klicken Sie auf das X " +"(den Schließen-Knopf), oder drücken Sie die Esc-Taste." #. (itstool) path: section/title #: C/gnote-editing-notes.page:70 @@ -1646,11 +1607,14 @@ msgid "" "This tab is only available if Gnote was buit with X11 support." msgstr "" -"Dieser Reiter ist nur verfügbar, sofern Gnote mit Unterstützung " -"für X11 erstellt wurde." #. (itstool) path: page/p #: C/gnote-hotkeys.page:27 +#, fuzzy +#| msgid "" +#| "The hotkeys tab allows you to set global key combinations to perform " +#| "different functions in Gnote. In order to set key " +#| "combinations, you must have the Listen for Hotkeys checkbox enabled." msgid "" "The hotkeys tab lets you set global key combinations to perform " "different functions in Gnote. In order to set key combinations, " @@ -1659,7 +1623,7 @@ "Der Reiter Tastenkombinationen ermöglicht es Ihnen, globale " "Tastenkombinationen zum Durchführen verschiedener Funktionen in Gnote festzulegen. Um Tastenkombinationen festzulegen, muss das Ankreuzfeld " -"Auf Tastenkombinationen achten aktiviert sein." +"Hotkeys aktivieren??? aktiviert sein." #. (itstool) path: item/title #: C/gnote-hotkeys.page:29 @@ -1726,6 +1690,10 @@ #. update your localized copy. The msgstr is not used at all. Set it to #. whatever you like once you have updated your copy of the file. #: C/gnote-introduction.page:39 +#| msgctxt "_" +#| msgid "" +#| "external ref='figures/gnote-new-note.png' " +#| "md5='715712e6322a5bf8c9aa1a6de1bb619b'" msgctxt "_" msgid "" "external ref='figures/gnote-search-all-notes.png' " @@ -1836,19 +1804,23 @@ #. (itstool) path: section/title #: C/gnote-links.page:30 msgid "Backlinks Add-in" -msgstr "Erweiterung Backlinks" +msgstr "Backlinks-Add-In" #. (itstool) path: section/p #: C/gnote-links.page:31 +#, fuzzy +#| msgid "" +#| "When the Backlinks add-in is installed, the Actions " +#| "menu will contain an item What links here?, which provides a " +#| "sub-menu listing all notes containing a link to the current note." msgid "" "When the Backlinks plugin is installed, the Actions " "menu will contain an item What links here?, which provides a sub-" "menu listing all notes containing a link to the current note." msgstr "" -"Wenn die Erweiterung Backlinks installiert ist, so enthält das " -"Menü Aktionen den Eintrag Was verweist hierauf?, " -"welcher ein Untermenü hat, in dem alle Notizen enthalten sind, die einen " -"Verweis auf die aktuelle Notiz enthalten." +" den Eintrag Was verweist hierauf?, welcher ein Untermenü hat, in " +"welchem alle Notizen enthalten sind, die einen Verweis auf die aktuelle " +"Notiz enthalten." #. (itstool) path: media #. This is a reference to an external file such as an image or video. When @@ -1856,11 +1828,16 @@ #. update your localized copy. The msgstr is not used at all. Set it to #. whatever you like once you have updated your copy of the file. #: C/gnote-notes-preferences.page:41 +#, fuzzy +#| msgctxt "_" +#| msgid "" +#| "external ref='figures/gnote-preferences-add-ins.png' " +#| "md5='656cb88e6f7df1661cd359bac9602f60'" msgctxt "_" msgid "" "external ref='figures/gnote-preferences-editing.png' " "md5='e927c4921c89e274fddc0bbac7cdee25'" -msgstr "" +msgstr "ok" #. (itstool) path: media #. This is a reference to an external file such as an image or video. When @@ -1905,7 +1882,7 @@ "gui> and Add-Ins." msgstr "" "Es gibt drei Kategorien in den Einstellungen: Allgemein, " -"Tastenkombinationen und Erweiterungen." +"Tastenkombinationen und Add-Ins." #. (itstool) path: section/p #: C/gnote-notes-preferences.page:31 @@ -1948,8 +1925,6 @@ "When checked, instead of replacing current window content, note is opened in " "the new window." msgstr "" -"Legt fest, ob die Notiz in einem neuen Fenster geöffnet wird, anstatt den " -"Inhalt des aktuellen Fensters zu ersetzen." #. (itstool) path: item/title #: C/gnote-notes-preferences.page:35 @@ -2304,16 +2279,15 @@ #. update your localized copy. The msgstr is not used at all. Set it to #. whatever you like once you have updated your copy of the file. #: C/gnote-template-notes.page:41 -#, fuzzy #| msgctxt "_" #| msgid "" -#| "external ref='figures/note-template.png' " -#| "md5='5cec5ca5dd34b252cd6e45b90c01e572'" +#| "external ref='figures/gnote-template-note.png' " +#| "md5='8e1767ef0d459c0fbdae83c0532e7097'" msgctxt "_" msgid "" "external ref='figures/gnote-template-note.png' " -"md5='692c75e1018398b2eec04b7cefcf3844'" -msgstr "ok" +"md5='7502160be8f056e4cdd6dae2565d51a6'" +msgstr "" #. (itstool) path: info/desc #: C/gnote-template-notes.page:9 @@ -2533,16 +2507,15 @@ #. update your localized copy. The msgstr is not used at all. Set it to #. whatever you like once you have updated your copy of the file. #: C/gnote-working-with-notebooks.page:66 -#, fuzzy #| msgctxt "_" #| msgid "" -#| "external ref='figures/notebook-icon.png' " -#| "md5='134ed1f78ff2a35e3cbfb2cc8f6b9afa'" +#| "external ref='figures/delete-notebook.png' " +#| "md5='caff034a1883e01a81cc0b7369ec9f27'" msgctxt "_" msgid "" "external ref='figures/add-to-notebook.png' " -"md5='7a9f4827e18e8f5d9afa0693538bbc60'" -msgstr "original" +"md5='b734a1ed58722fedc481507b3a40d377'" +msgstr "" #. (itstool) path: media #. This is a reference to an external file such as an image or video. When @@ -2567,6 +2540,10 @@ #. update your localized copy. The msgstr is not used at all. Set it to #. whatever you like once you have updated your copy of the file. #: C/gnote-working-with-notebooks.page:98 +#| msgctxt "_" +#| msgid "" +#| "external ref='figures/delete-notebook.png' " +#| "md5='caff034a1883e01a81cc0b7369ec9f27'" msgctxt "_" msgid "" "external ref='figures/delete-notebook.png' " @@ -2864,6 +2841,10 @@ #. update your localized copy. The msgstr is not used at all. Set it to #. whatever you like once you have updated your copy of the file. #: C/index.page:18 +#| msgctxt "_" +#| msgid "" +#| "external ref='figures/gnote-tools.png' " +#| "md5='6a1c7800cd20071381ea591f49c32b6c'" msgctxt "_" msgid "" "external ref='figures/logo32.png' md5='a7b1fb2d2c427a0ca5043b7e836d69a7'" Binary files /tmp/TZj0RWsGmM/gnote-3.14.2/help/de/figures/gnote-preferences-hotkeys.png and /tmp/PHFkdwVKGj/gnote-3.16.0/help/de/figures/gnote-preferences-hotkeys.png differ diff -Nru gnote-3.14.2/help/de/gnote-addin-bugzillalink.page gnote-3.16.0/help/de/gnote-addin-bugzillalink.page --- gnote-3.14.2/help/de/gnote-addin-bugzillalink.page 2015-01-17 15:47:05.000000000 +0000 +++ gnote-3.16.0/help/de/gnote-addin-bugzillalink.page 2015-03-29 20:07:18.000000000 +0000 @@ -43,16 +43,10 @@ d@winzen4.de 2012 - - - Bernd Homuth - dev@hmt.im - 2014 - - Erweiterung Bugzilla-Links -

Diese Erweiterung ermöglicht es Ihnen, eine Bugzilla-Adresse direkt in eine Gnote-Notiz zu ziehen. Die Fehlernummer wird als Verknüpfung mit einem kleinen Bug-Symbol angezeigt.

+ Bugzilla-Links-Add-in +

Dieses Add-in ermöglicht es Ihnen, eine Bugzilla-Adresse direkt in eine Gnote-Notiz zu ziehen. Die Fehlernummer wird als Verknüpfung mit einem kleinen Bug-Symbol angezeigt.

In den Einstellungen können Sie spezielle Symbole für bestimmte Rechner festlegen.

diff -Nru gnote-3.14.2/help/de/gnote-addin-fixedwidth.page gnote-3.16.0/help/de/gnote-addin-fixedwidth.page --- gnote-3.14.2/help/de/gnote-addin-fixedwidth.page 2015-01-17 15:47:05.000000000 +0000 +++ gnote-3.16.0/help/de/gnote-addin-fixedwidth.page 2015-03-29 20:07:19.000000000 +0000 @@ -42,15 +42,9 @@ d@winzen4.de 2012 - - - Bernd Homuth - dev@hmt.im - 2014 - - Erweiterung Feste-Breite -

Die Erweiterung Feste Breite ermöglicht es, einen Text in einer Schriftart mit fester Breite darzustellen. Um einen Text zu ändern, markieren Sie zuerst den Text, den Sie ändern möchten. Danach wählen Sie die Option Feste Breite aus dem Menü Text. Sie können auch die Option Feste Breite aus dem Menü auswählen, bevor Sie Text eingeben.

+ Feste-Breite-Add-In +

Das Add-in Feste Breite ermöglicht es, einen Text in einer Schriftart mit fester Breite darzustellen. Um einen Text zu ändern, markieren Sie zuerst den Text, den Sie ändern möchten. Danach wählen Sie die Option Feste Breite aus dem Menü Text. Sie können auch die Option Feste Breite aus dem Menü auswählen, bevor Sie Text eingeben.

diff -Nru gnote-3.14.2/help/de/gnote-addin-html.page gnote-3.16.0/help/de/gnote-addin-html.page --- gnote-3.14.2/help/de/gnote-addin-html.page 2015-01-17 15:47:05.000000000 +0000 +++ gnote-3.16.0/help/de/gnote-addin-html.page 2015-03-29 20:07:19.000000000 +0000 @@ -42,16 +42,10 @@ d@winzen4.de 2012 - - - Bernd Homuth - dev@hmt.im - 2014 - In HTML exportieren -

Wenn die Erweiterung Als HTML exportieren installiert ist, stellt das Menü Aktionen den Befehl Als HTML exportieren zur Verfügung.

+

When the Export to HTML plugin is installed, the command Export to HTML is present in the Actions menu.

Wählen Sie diesen Befehl, um ein HTML-Dokument von einer oder mehrerer Notizen zu erstellen. Es wird dann ein Dialog angezeigt, in welchem Sie wählen können, wo die HTML-Datei gespeichert werden soll. Legen Sie die Zieldatei fest und klicken Sie auf Speichern, um die Datei zu speichern, oder auf Abbrechen, um den Vorgang abzubrechen.

Um alle Notizen zu exportieren, auf die in der aktuellen Notiz verwiesen wird, wählen Sie das Ankreuzfeld Verknüpfte Notizen exportieren.

diff -Nru gnote-3.14.2/help/de/gnote-addin-notedirwatcher.page gnote-3.16.0/help/de/gnote-addin-notedirwatcher.page --- gnote-3.14.2/help/de/gnote-addin-notedirwatcher.page 2015-01-17 15:47:05.000000000 +0000 +++ gnote-3.16.0/help/de/gnote-addin-notedirwatcher.page 2015-03-29 20:07:19.000000000 +0000 @@ -38,16 +38,10 @@ d@winzen4.de 2012 - - - Bernd Homuth - dev@hmt.im - 2014 - Notizordner-Überwachung -

Diese Erweiterung ermöglicht es mit Notizen auf einem Dateisystem zu arbeiten, während Gnote läuft. Wenn es aktiviert ist, überwacht es Notizdateien auf Änderungen und lädt sie gegebenenfalls neu, sobald eine Änderung erkannt wurde. Auf diese Weise werden externe Änderungen an einer Notizdatei automatisch in Gnote übernommen.

-

Gnote speichert Notizen im Ordner ~/.local/share/gnote. Wenn diese Erweiterung aktiv ist, können Sie in diesem Ordner auf Dateisystemebene arbeiten, wie z.B. Inhaltsabgleich mit einem anderen Ort, während Gnote läuft.

+

Dieses Add-In ermöglicht es mit Notizen auf einem Dateisystem zu arbeiten, während Gnote läuft. Wenn es aktiviert ist, überwacht es Notizdateien auf Änderungen und lädt sie gegebenenfalls neu, sobald eine Änderung erkannt wurde. Auf diese Weise werden externe Änderungen an einer Notizdatei automatisch in Gnote übernommen.

+

Gnote speichert Notizen im Ordner ~/.local/share/gnote. Wenn dieses Add-In aktiv ist, können Sie in diesem Ordner auf Dateisystemebene arbeiten, wie z.B. Inhaltsabgleich mit einem anderen Ort, während Gnote läuft.

diff -Nru gnote-3.14.2/help/de/gnote-addin-noteoftheday.page gnote-3.16.0/help/de/gnote-addin-noteoftheday.page --- gnote-3.14.2/help/de/gnote-addin-noteoftheday.page 2015-01-17 15:47:05.000000000 +0000 +++ gnote-3.16.0/help/de/gnote-addin-noteoftheday.page 2015-03-29 20:07:19.000000000 +0000 @@ -3,7 +3,7 @@ - Eine »Notiz des Tages« + A "Today" note

GNU Free Documentation License (GFDL), Version 1.1

 Pierre-Yves Luyten @@ -42,17 +42,11 @@ d@winzen4.de 2012 - - - Bernd Homuth - dev@hmt.im - 2014 - Notiz des Tages -

Diese Erweiterung erzeugt automatisch eine »Heute«-Notiz, um tägliche Gedanken festzuhalten. Das aktuelle Datum dient als Basis für den Titel dieser Notiz. Beispielsweise ist der Titel einer »Heute«-Notiz, die am 28. Februar 2013 angelegt wurde, »Heute: Donnerstag, 28. Februar 2013«.

-

Wenn Sie die »Heute«-Notiz unverändert lassen, wird die Erweiterung die Notiz automatisch löschen.

+

Dieses Add-In erzeugt automatisch eine »Heute«-Notiz, um tägliche Gedanken festzuhalten. Das aktuelle Datum dient als Basis für den Titel dieser Notiz. Beispielsweise ist der Titel einer »Heute«-Notiz, die am 28. Februar 2013 angelegt wurde, »Heute: Donnerstag, 28. Februar 2013«.

+

Wenn Sie die »Heute«-Notiz unverändert lassen, wird das Add-In die Notiz automatisch löschen.

Um den Inhalt der standardmäßigen »Heute«-Notiz anzupassen, erzeugen Sie eine neue Notiz und ändern Sie den Titel in »Heute: Vorlage«. Passen Sie den Inhalt der Vorlage so an, wie Sie es wünschen. Wenn eine neue »Heute«-Notiz angelegt wird, wird der Inhalt der Notiz »Heute: Vorlage« verwendet.

diff -Nru gnote-3.14.2/help/de/gnote-addin-print.page gnote-3.16.0/help/de/gnote-addin-print.page --- gnote-3.14.2/help/de/gnote-addin-print.page 2015-01-17 15:47:05.000000000 +0000 +++ gnote-3.16.0/help/de/gnote-addin-print.page 2015-03-29 20:07:19.000000000 +0000 @@ -42,15 +42,9 @@ d@winzen4.de 2012 - - - Bernd Homuth - dev@hmt.im - 2014 - Drucken -

Wenn die Erweiterung Drucken installiert ist, so erscheint der Befehl Drucken im Menü Aktionen. Dieser Befehl öffnet den Standard-Druckdialog zum Drucken einer Notiz.

+

When the Print plugin is installed, the Print command is present in the Actions menu. This command opens a standard Print dialog which lets you print a note.

diff -Nru gnote-3.14.2/help/de/gnote-addin-readonly.page gnote-3.16.0/help/de/gnote-addin-readonly.page --- gnote-3.14.2/help/de/gnote-addin-readonly.page 2015-01-17 15:47:05.000000000 +0000 +++ gnote-3.16.0/help/de/gnote-addin-readonly.page 2015-03-29 20:07:19.000000000 +0000 @@ -33,15 +33,9 @@ d@winzen4.de 2012 - - - Bernd Homuth - dev@hmt.im - 2014 - Nur lesen -

Wenn die Erweiterung Nur lesen installiert ist, stellt das Menü Aktionen den Eintrag Nur lesen zur Verfügung. Wenn dieser Eintrag ausgewählt wird, so ist die Notiz nur lesbar. Somit kann die Notiz nicht geändert werden, solange die Funktion ausgewählt ist. Verwenden Sie diese Funktion, um Notizen vor versehentlichen Änderungen zu schützen.

+

When the ReadOnly plugin is installed, the Read Only item is present in the Actions menu for open note. When this item is checked, note is marked as read-only. This does not allow to change note until the menu item is unchecked. Use this to prevent notes from accidental modification.

diff -Nru gnote-3.14.2/help/de/gnote-addin-replacetitle.page gnote-3.16.0/help/de/gnote-addin-replacetitle.page --- gnote-3.14.2/help/de/gnote-addin-replacetitle.page 2015-01-17 15:47:05.000000000 +0000 +++ gnote-3.16.0/help/de/gnote-addin-replacetitle.page 2015-03-29 20:07:19.000000000 +0000 @@ -42,16 +42,10 @@ d@winzen4.de 2012 - - - Bernd Homuth - dev@hmt.im - 2014 - Titel ersetzen -

Wenn die Erweiterung Titel ersetzen installiert ist, stellt das Menü Aktionen einen Menüpunkt Titel ersetzen zur Verfügung.

+

Wenn das Titel ersetzen-Add-In installiert ist, stellt das Menü Aktionen einen Menüpunkt Titel ersetzen zur Verfügung.

Der Befehl Titel ersetzen ersetzt den Notiztitel durch den aktuell ausgewählten Text (in jeder Anwendung).

Drücken Sie alternativ die Tastenkombination StrgR.

diff -Nru gnote-3.14.2/help/de/gnote-addin-specialnotes.page gnote-3.16.0/help/de/gnote-addin-specialnotes.page --- gnote-3.14.2/help/de/gnote-addin-specialnotes.page 2015-01-17 15:47:05.000000000 +0000 +++ gnote-3.16.0/help/de/gnote-addin-specialnotes.page 2015-03-29 20:07:19.000000000 +0000 @@ -3,7 +3,7 @@ - Lesen Sie zu besonderen Notizen + See special notes

GNU Free Documentation License (GFDL), Version 1.1

 Aurimas Cernius @@ -33,15 +33,9 @@ d@winzen4.de 2012 - - - Bernd Homuth - dev@hmt.im - 2014 - Besondere Notizen -

Wenn die Erweiterung Besondere Notizen installiert ist, so ist das besondere Notizbuch Besondere Notizen in der Liste der Notizbücher verfügbar. Dieses Notizbuch enthält Notizen, die andernfalls nicht sichtbar sind, wie z.B. Notizvorlagen. Es ist eine bequeme Möglichkeit alle Ihre Vorlagen durchzusehen.

+

When the SpecialNotes plugin is installed, the new special notebook Special Notes is present in the list of notebooks. This notebook contains notes that are otherwise not visible, such as template notes. This might be convenient way to go through all your templates.

diff -Nru gnote-3.14.2/help/de/gnote-addins-preferences.page gnote-3.16.0/help/de/gnote-addins-preferences.page --- gnote-3.14.2/help/de/gnote-addins-preferences.page 2015-01-17 15:47:05.000000000 +0000 +++ gnote-3.16.0/help/de/gnote-addins-preferences.page 2015-03-29 20:07:19.000000000 +0000 @@ -3,7 +3,7 @@ - Einstellungen für Gnote-Erweiterungen + Einstellungen für Gnote-Add-Ins

GNU Free Documentation License (GFDL), Version 1.1

 Pierre-Yves Luyten @@ -42,21 +42,15 @@ d@winzen4.de 2012 - - - Bernd Homuth - dev@hmt.im - 2014 - - Erweiterungseinstellungen -

Sie können in diesem Reiter Erweiterungen aktivieren und deaktivieren. Wählen Sie dazu eine Erweiterung aus und klicken Sie auf den Knopf Aktivieren. Klicken Sie auf Deaktivieren zum Deaktivieren der Erweiterung.

-

Einige Erweiterungen haben Einstellungen, auf die Sie zugreifen können, indem Sie eine Erweiterung wählen und auf den Knopf Einstellungen klicken.

-
Erweiterungseinstellungen für <app>Gnote</app> - Erweiterung-Fenster von Gnote + Add-In-Einstellungen +

You can activate or deactivate plugins in this tab. To do this, select a plugin and click the Enable button. Use the Disable button to disable a plugin.

+

Some plugins have preferences, which you can access by selecting a plugin and pressing the Preferences button.

+
Add-in-Einstellungen für <app>Gnote</app> + Add-In-Fenster von Gnote -

Erweiterung-Fenster von Gnote

+

Add-in-Fenster von Gnote
diff -Nru gnote-3.14.2/help/de/gnote-addin-sync-local.page gnote-3.16.0/help/de/gnote-addin-sync-local.page --- gnote-3.14.2/help/de/gnote-addin-sync-local.page 2015-01-17 15:47:05.000000000 +0000 +++ gnote-3.16.0/help/de/gnote-addin-sync-local.page 2015-03-29 20:07:19.000000000 +0000 @@ -39,12 +39,6 @@ d@winzen4.de 2012 - - - Bernd Homuth - dev@hmt.im - 2014 - Abgleich mit lokalem Ordner diff -Nru gnote-3.14.2/help/de/gnote-addin-sync-webdav.page gnote-3.16.0/help/de/gnote-addin-sync-webdav.page --- gnote-3.14.2/help/de/gnote-addin-sync-webdav.page 2015-01-17 15:47:06.000000000 +0000 +++ gnote-3.16.0/help/de/gnote-addin-sync-webdav.page 2015-03-29 20:07:19.000000000 +0000 @@ -39,12 +39,6 @@ d@winzen4.de 2012 - - - Bernd Homuth - dev@hmt.im - 2014 - Abgleich mit WebDAV-Freigabe diff -Nru gnote-3.14.2/help/de/gnote-addin-tableofcontents.page gnote-3.16.0/help/de/gnote-addin-tableofcontents.page --- gnote-3.14.2/help/de/gnote-addin-tableofcontents.page 2015-01-17 15:47:06.000000000 +0000 +++ gnote-3.16.0/help/de/gnote-addin-tableofcontents.page 2015-03-29 20:07:19.000000000 +0000 @@ -71,7 +71,7 @@ - Lange strukturierte Notizen durchsuchen + Navigate long structured notes Jochen Skulj @@ -96,27 +96,26 @@ d@winzen4.de 2012 - - - Bernd Homuth - dev@hmt.im - 2014 - Inhaltsverzeichnis hinzufügen -Lange strukturierte Notizen durchsuchen +Navigate long structured notes -

Dies ist eine Erweiterung für Gnotes. Wenn diese Erweiterung installiert ist, enthält das Menü Aktionen den Eintrag Inhaltsverzeichnis. Lesen Sie , um zu erfahren, wie Erweiterungen aktiviert werden.

 +

+ This is a plugin to Gnotes. + When this plugin is installed, + there is a Table of Contents entry in the actions menu. + See to learn how to activate a plugin. +
Kurz und bündig -

Eine Überschrift ist eine vollständige Zeile Text, die Fett+Groß oder Fett+Riesig formatiert ist.

+

A heading is a full line of text, formatted with Bold+Huge or Bold+Large.

Legen Sie Überschriften mit Strg1 oder Strg2 fest.

@@ -130,58 +129,80 @@
Bildschirmfoto
- Eine strukturierte Notiz mit Inhaltsverzeichnis + A structured note with its table of contents
- diff -Nru gnote-3.14.2/help/sl/gnote-common-problems.page gnote-3.16.0/help/sl/gnote-common-problems.page --- gnote-3.14.2/help/sl/gnote-common-problems.page 2015-01-17 15:47:16.000000000 +0000 +++ gnote-3.16.0/help/sl/gnote-common-problems.page 2015-03-29 20:07:28.000000000 +0000 @@ -24,8 +24,6 @@ Ali <app>Gnote</app> deluje s progamom <app>Tomboy</app>?

You can import Tomboy Notes. A plugin has to be activated.

 - I can't find the Gnote status icon. -

You can activate the Gnote status icon in Gnote Preferences dialog.

 Kako naj nastavim, da se <app>Gnote</app> samodejno zažene ob prijavi?

To start Gnote automatically when you log into GNOME, run gnome-session-properties.

 diff -Nru gnote-3.14.2/help/sl/gnote-hotkeys.page gnote-3.16.0/help/sl/gnote-hotkeys.page --- gnote-3.14.2/help/sl/gnote-hotkeys.page 2015-01-17 15:47:16.000000000 +0000 +++ gnote-3.16.0/help/sl/gnote-hotkeys.page 1970-01-01 00:00:00.000000000 +0000 @@ -1,41 +0,0 @@ - - - - - - Gnote hotkey settings -

GNU Free Documentation License (GFDL), različica 1.1

 - - Pierre-Yves Luyten - 2011 - - - Aurimas Cernius - 2011-2013 - - - Adam Dingle - adam@yorba.org - 2013 - - - - Tipkovne bližnjice -

This tab is only available if Gnote was buit with X11 support.

-

The hotkeys tab lets you set global key combinations to perform different functions in Gnote. In order to set key combinations, you must have the Listen for hotkeys checkbox enabled.

- - Pokaže meni sporočilc

Enter a key combination for opening the notes menu.

 - Odpre sporočilo "začnite tukaj"

Enter a key combination for opening the “Start Here” note, which is preinstalled with Gnote.

 - Ustvari novo sporočilce

Enter a key combination for creating a new note.

 - Odpri "Išči po _vseh sporočilcih"

Enter a key combination for opening a search.

 - - -
- Okno <gui>Možnosti tipkovnih bližnjica</gui> - Tipkovne bližnjice Gnote - -

Nastavitev tipkovnih bližnjic Gnote.

- -
- - diff -Nru gnote-3.14.2/help/sl/gnote-working-with-notebooks.page gnote-3.16.0/help/sl/gnote-working-with-notebooks.page --- gnote-3.14.2/help/sl/gnote-working-with-notebooks.page 2015-01-17 15:47:16.000000000 +0000 +++ gnote-3.16.0/help/sl/gnote-working-with-notebooks.page 2015-03-29 20:07:29.000000000 +0000 @@ -58,7 +58,7 @@

Drag the note(s) onto a notebook on the left using the mouse.

Click on a notebook, right-click in notes list and select New from the context menu. A new note will be created and added to the notebook.

 -

Medtem ko vnašate sporočilce ga lahko dodate neposredno obstoječi beležki z uporabo gumba Beležka. Gumb Beležka predstavlja ikona .

+

As you type a note, you can add the note directly to an existing notebook using the ActionsNotebook menu.

Dodajanje sporočilc beležnici

Dodaj v beležnico.

 @@ -66,7 +66,7 @@

To remove a note from a notebook, use one of the following:

Move the note to Unfiled Notes in the main window.

 -

Select the No Notebook option from the menu which appears when you press the Notebook button in an open note.

 +

Select the No Notebook option from the menu which appears when you press the ActionsNotebook in an open note.
diff -Nru gnote-3.14.2/help/sv/gnote-addin-bugzillalink.page gnote-3.16.0/help/sv/gnote-addin-bugzillalink.page --- gnote-3.14.2/help/sv/gnote-addin-bugzillalink.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-addin-bugzillalink.page 2015-03-29 20:07:29.000000000 +0000 @@ -0,0 +1,28 @@ + + + + + + + Insert Bugzilla links +

GNU Free Documentation License (GFDL), Version 1.1

 + + Pierre-Yves Luyten + 2011 + + + Aurimas Cernius + 2011,2013 + + + Adam Dingle + adam@yorba.org + 2013 + + + + Bugzilla Links Add-in +

This plugin lets you drag a Bugzilla URL directly into a Gnote note. The bug number is inserted as a link with a little bug icon next to it.

+

In the preferences, you can add special icons for certain hosts.

+ + diff -Nru gnote-3.14.2/help/sv/gnote-addin-fixedwidth.page gnote-3.16.0/help/sv/gnote-addin-fixedwidth.page --- gnote-3.14.2/help/sv/gnote-addin-fixedwidth.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-addin-fixedwidth.page 2015-03-29 20:07:29.000000000 +0000 @@ -0,0 +1,26 @@ + + + + + + Use a fixed-width font +

GNU Free Documentation License (GFDL), Version 1.1

 + + Pierre-Yves Luyten + 2011 + + + Aurimas Cernius + 2011,2013 + + + Adam Dingle + adam@yorba.org + 2013 + + + + Fixed Width Add-in +

The Fixed Width plugin allows text to use a fixed width font. To change existing text, first select the text you want to modify. Then select Fixed Width from the Text menu. You can also select Fixed Width from the menu before you start typing.

+ + diff -Nru gnote-3.14.2/help/sv/gnote-addin-html.page gnote-3.16.0/help/sv/gnote-addin-html.page --- gnote-3.14.2/help/sv/gnote-addin-html.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-addin-html.page 2015-03-29 20:07:29.000000000 +0000 @@ -0,0 +1,28 @@ + + + + + + Export notes to HTML +

GNU Free Documentation License (GFDL), Version 1.1

 + + Pierre-Yves Luyten + 2011 + + + Aurimas Cernius + 2011,2013 + + + Adam Dingle + adam@yorba.org + 2013 + + + + Exportera till HTML +

When the Export to HTML plugin is installed, the command Export to HTML is present in the Actions menu.

+

To create an HTML document from one or more notes, select this command. You will see a dialog that lets you choose where to save the HTML file. Enter the destination filename and click Save to save the file, or Cancel to abort.

+

To export any notes linked to by the current note, select the Export Linked Notes check box.

+ + diff -Nru gnote-3.14.2/help/sv/gnote-addin-notedirwatcher.page gnote-3.16.0/help/sv/gnote-addin-notedirwatcher.page --- gnote-3.14.2/help/sv/gnote-addin-notedirwatcher.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-addin-notedirwatcher.page 2015-03-29 20:07:29.000000000 +0000 @@ -0,0 +1,23 @@ + + + + + + Watch for note changes on file system +

GNU Free Documentation License (GFDL), Version 1.1

 + + Aurimas Cernius + 2012-2013 + + + Adam Dingle + adam@yorba.org + 2013 + + + + Note Directory Watcher +

This plugin lets you work with notes on the file system while Gnote is running. When enabled, this plugin monitors note files for changes and reloads them when any change is detected. This way any external change to a note file will automatically be reflected in Gnote.

+

Gnote stores notes in the ~/.local/share/gnote folder. With this plugin is enabled, you can perform actions at the file system level on this directory, such as synchronizing note files with some other location, while Gnote is running.

+ + diff -Nru gnote-3.14.2/help/sv/gnote-addin-noteoftheday.page gnote-3.16.0/help/sv/gnote-addin-noteoftheday.page --- gnote-3.14.2/help/sv/gnote-addin-noteoftheday.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-addin-noteoftheday.page 2015-03-29 20:07:29.000000000 +0000 @@ -0,0 +1,28 @@ + + + + + + A "Today" note +

GNU Free Documentation License (GFDL), Version 1.1

 + + Pierre-Yves Luyten + 2011 + + + Aurimas Cernius + 2011,2013 + + + Adam Dingle + adam@yorba.org + 2013 + + + + Dagens anteckning +

This plugin automatically creates a "Today" note for jotting daily thoughts down. As an example, a "Today" note created on February 28, 2013 would be called "Today: Thursday, February 28 2013".

+

If you leave a "Today" note unmodified, the plugin will automatically delete the note.

+

To customize the content of the default "Today" note, create a new note and change the title of the note to "Today: Template". Change the content of the template note to whatever you like. New "Today" notes will then use the content of your "Today: Template" note.

+ + diff -Nru gnote-3.14.2/help/sv/gnote-addin-print.page gnote-3.16.0/help/sv/gnote-addin-print.page --- gnote-3.14.2/help/sv/gnote-addin-print.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-addin-print.page 2015-03-29 20:07:29.000000000 +0000 @@ -0,0 +1,26 @@ + + + + + + Print notes +

GNU Free Documentation License (GFDL), Version 1.1

 + + Pierre-Yves Luyten + 2011 + + + Aurimas Cernius + 2011,2013 + + + Adam Dingle + adam@yorba.org + 2013 + + + + Skriv ut +

When the Print plugin is installed, the Print command is present in the Actions menu. This command opens a standard Print dialog which lets you print a note.

+ + diff -Nru gnote-3.14.2/help/sv/gnote-addin-readonly.page gnote-3.16.0/help/sv/gnote-addin-readonly.page --- gnote-3.14.2/help/sv/gnote-addin-readonly.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-addin-readonly.page 2015-03-29 20:07:29.000000000 +0000 @@ -0,0 +1,17 @@ + + + + + + Make notes read-only +

GNU Free Documentation License (GFDL), Version 1.1

 + + Aurimas Cernius + 2013 + + + + Read Only +

When the ReadOnly plugin is installed, the Read Only item is present in the Actions menu for open note. When this item is checked, note is marked as read-only. This does not allow to change note until the menu item is unchecked. Use this to prevent notes from accidental modification.

+ + diff -Nru gnote-3.14.2/help/sv/gnote-addin-replacetitle.page gnote-3.16.0/help/sv/gnote-addin-replacetitle.page --- gnote-3.14.2/help/sv/gnote-addin-replacetitle.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-addin-replacetitle.page 2015-03-29 20:07:29.000000000 +0000 @@ -0,0 +1,28 @@ + + + + + + Rename a note +

GNU Free Documentation License (GFDL), Version 1.1

 + + Pierre-Yves Luyten + 2011 + + + Aurimas Cernius + 2011,2013 + + + Adam Dingle + adam@yorba.org + 2013 + + + + Replace title +

When the Replace title plugin is installed, the command Replace title is present in the Actions menu.

+

The Replace title command replaces a note's title with the currently selected text (from any application).

+

Alternatively, you can use the CtrlR shortcut.

+ + diff -Nru gnote-3.14.2/help/sv/gnote-addin-specialnotes.page gnote-3.16.0/help/sv/gnote-addin-specialnotes.page --- gnote-3.14.2/help/sv/gnote-addin-specialnotes.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-addin-specialnotes.page 2015-03-29 20:07:29.000000000 +0000 @@ -0,0 +1,17 @@ + + + + + + See special notes +

GNU Free Documentation License (GFDL), Version 1.1

 + + Aurimas Cernius + 2013 + + + + Special Notes +

When the SpecialNotes plugin is installed, the new special notebook Special Notes is present in the list of notebooks. This notebook contains notes that are otherwise not visible, such as template notes. This might be convenient way to go through all your templates.

+ + diff -Nru gnote-3.14.2/help/sv/gnote-addins-preferences.page gnote-3.16.0/help/sv/gnote-addins-preferences.page --- gnote-3.14.2/help/sv/gnote-addins-preferences.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-addins-preferences.page 2015-03-29 20:07:29.000000000 +0000 @@ -0,0 +1,33 @@ + + + + + + Settings for Gnote plugins +

GNU Free Documentation License (GFDL), Version 1.1

 + + Pierre-Yves Luyten + 2011 + + + Aurimas Cernius + 2011,2013,2014 + + + Adam Dingle + adam@yorba.org + 2013 + + + + Add-in Preferences +

You can activate or deactivate plugins in this tab. To do this, select a plugin and click the Enable button. Use the Disable button to disable a plugin.

+

Some plugins have preferences, which you can access by selecting a plugin and pressing the Preferences button.

+
<app>Gnote</app> Addin Preferences + Gnote Add-ins window + +

Add-ins window.

+ +
+ + diff -Nru gnote-3.14.2/help/sv/gnote-addin-sync-local.page gnote-3.16.0/help/sv/gnote-addin-sync-local.page --- gnote-3.14.2/help/sv/gnote-addin-sync-local.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-addin-sync-local.page 2015-03-29 20:07:29.000000000 +0000 @@ -0,0 +1,29 @@ + + + + + + + Synchronize to a local folder +

GNU Free Documentation License (GFDL), Version 1.1

 + + Aurimas Cernius + 2012 + + + Adam Dingle + adam@yorba.org + 2013 + + + + Local Folder Synchronization +

This type of synchronization lets you use a local folder as synchronization storage.

+

To configure this type of synchronization, select Local Folder in the Service drop-down and then select the desired folder as the Folder Path.

+
+ Local Folder Synchronization configuration + +
+

After selecting the desired folder, click the Save button. Use the Clear button to turn synchronization off.

+ + diff -Nru gnote-3.14.2/help/sv/gnote-addin-sync-webdav.page gnote-3.16.0/help/sv/gnote-addin-sync-webdav.page --- gnote-3.14.2/help/sv/gnote-addin-sync-webdav.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-addin-sync-webdav.page 2015-03-29 20:07:29.000000000 +0000 @@ -0,0 +1,34 @@ + + + + + + + Synchronize to a WebDAV share +

GNU Free Documentation License (GFDL), Version 1.1

 + + Aurimas Cernius + 2012 + + + Adam Dingle + adam@yorba.org + 2013 + + + + WebDAV Synchronization +

This type of synchronization lets you use a WebDAV server as synchronization storage.

+

To configure this type of synchronization:

+ +

select "WebDAV" in the Service drop-down

 +

enter the URL to your share

 +

enter your username and password

 + +
+ Local Folder Synchronization configuration + +
+

After selecting the desired folder click the Save button. Use the Clear button to turn synchronization off.

+ + diff -Nru gnote-3.14.2/help/sv/gnote-addin-tableofcontents.page gnote-3.16.0/help/sv/gnote-addin-tableofcontents.page --- gnote-3.14.2/help/sv/gnote-addin-tableofcontents.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-addin-tableofcontents.page 2015-03-29 20:07:29.000000000 +0000 @@ -0,0 +1,207 @@ + + + + + + + +

+ This help topic is licensed under the + + GNU Free Documentation License, Version 1.1 (GFDL). + It means that you are free to copy, distribute and/or modify this document, under some conditions. +

+ + + + Luc Pionchonpionchon.luc@gmail.com2013 + + Adam Dingle + adam@yorba.org + 2013 + + + Aurimas Cernius + aurisc4@gmail.com + 2013,2014 + + + + + + + + Navigate long structured notes + + + +Adding a Table of Contents + +Navigate long structured notes + +

+ This is a plugin to Gnotes. + When this plugin is installed, + there is a Table of Contents entry in the actions menu. + See to learn how to activate a plugin. +

 + + +
In a nutshell + + + +

A heading is a full line of text, formatted with Bold+Huge or Bold+Large.

+ + +

Set headings with + Ctrl1 or Ctrl2. +

+ + +

Open the table of contents with CtrlAlt1, and jump to any heading.

+ + + +
+ +
Screenshot +
+ A structured note with its table of contents + + +
+
+ + + + + +
Structuring your notes with headings + +

+A heading is simply a complete line with specific text formatting: +

+ +

Level 1 headings, for sections, are lines formatted with a Bold+Huge font.

 +

Level 2 headings, for subsections, are lines formatted with a Bold+Large font.

 + + + +

To format a heading line, either:

+ + + +

Use the commands Heading 1 and Heading 2 + in the ActionsTable of Contents menu.

+ + + +

Use the keyboard shortcuts Ctrl1 + and Ctrl2 for headings of level 1 and 2.

+ + + +

+ These commands apply the formatting to the complete line. + You don't need to select it first. + It is enough if the cursor is on the line. +

+ Alternatively, with the cursor on a new line, activate the heading command and then enter the heading title. +

 + +

You can even use the normal formatting commands from the Text menu: + Bold, Large and Huge, and their respective keyboard shortcuts. + If, for example, your line is already formatted as Huge, then you just need to make it also Bold to turn it into a heading 1. + See to learn how to set text styles. +

+ +
+ + +
Showing the table of contents + +

You can access the table of contents either:

+ +

In the menu ActionsTable of Contents.

 +

In context menuTable of Contents (right-click on the note window).

 +

In a popup menu, with the keyboard shortcut CtrlAlt1.

 +

Then you can navigate up and down with the arrow keys and jump to the selected heading with enter. Or just click with your mouse on the heading to jump to.

+ + +
+ + +
Troubleshooting + + <em style="strong">One heading does not show in the table of contents</em>

+ There might be some characters in the heading line, such as whitespace characters, which are not formatted as a heading. Make sure that the whole line is formatted as a heading. See .

+ + <em style="strong">There is an empty line in the table of contents</em>

+ An empty line, possibly including whitespaces, is formatted as a heading. Jump to this line and delete the area.

+ + + <p> + </p> + </item> + +</terms> + +</section> + +</page> diff -Nru gnote-3.14.2/help/sv/gnote-addin-timestamp.page gnote-3.16.0/help/sv/gnote-addin-timestamp.page --- gnote-3.14.2/help/sv/gnote-addin-timestamp.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-addin-timestamp.page 2015-03-29 20:07:29.000000000 +0000 @@ -0,0 +1,28 @@ +<?xml version="1.0" encoding="utf-8"?> +<page xmlns="http://projectmallard.org/1.0/" type="topic" id="addin-timestamp" xml:lang="sv"> + + <info> + <link type="guide" xref="editing-notes#note-content"/> + <link type="topic" xref="addins-preferences"/> + <desc>Insert current time</desc> + <license><p>GNU Free Documentation License (GFDL), Version 1.1</p></license> + <credit type="author"> + <name>Pierre-Yves Luyten</name> + <years>2011</years> + </credit> + <credit type="editor"> + <name>Aurimas Cernius</name> + <years>2011,2013</years> + </credit> + <credit type="editor"> + <name>Adam Dingle</name> + <email>adam@yorba.org</email> + <years>2013</years> + </credit> + </info> + + <title>Insert Timestamp Add-in + +

When the Insert Timestamp plugin is installed, the Actions menu will include a Insert Timestamp command. Select this command to insert the current date and time.

+ + diff -Nru gnote-3.14.2/help/sv/gnote-addin-underline.page gnote-3.16.0/help/sv/gnote-addin-underline.page --- gnote-3.14.2/help/sv/gnote-addin-underline.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-addin-underline.page 2015-03-29 20:07:29.000000000 +0000 @@ -0,0 +1,36 @@ + + + + + + Underline text +

GNU Free Documentation License (GFDL), Version 1.1

 + + Pierre-Yves Luyten + 2011 + + + Aurimas Cernius + 2011,2013 + + + Adam Dingle + adam@yorba.org + 2013 + + + + Underline Text Add-In +

When the Underline plugin is installed, the Text menu will have a Underline option available.

+

To underline the selected text, use one of the following:

+ +

Click on Text and select Underline.

 +

Press CtrlU.

 + +

To remove underline, select the underlined text and use one of the following:

+ +

Click on Text and select Underline.

 +

Press CtrlU.

 + + + diff -Nru gnote-3.14.2/help/sv/gnote-bulleted-lists.page gnote-3.16.0/help/sv/gnote-bulleted-lists.page --- gnote-3.14.2/help/sv/gnote-bulleted-lists.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-bulleted-lists.page 2015-03-29 20:07:29.000000000 +0000 @@ -0,0 +1,67 @@ + + + + + + Using Bulleted Lists +

GNU Free Documentation License (GFDL), Version 1.1

 + + Pierre-Yves Luyten + 2011 + + + Aurimas Cernius + 2011 + + + Adam Dingle + adam@yorba.org + 2013 + + + +Punktlistor + +
Påbörja en punktlista +

You may begin a bulleted list in any of the following ways:

+ +

Select Bullets from the Text menu.

 +

Begin a line with a single dash character - followed by a space. Then type some text and press Enter.

 +

Press the key combination AltRight.

 + +
+ +
Avsluta en punktlista +

You can end a bulleted list by doing one of the following:

+ +

Select Bullets from the Text menu.

 +

Press Enter on a blank bulleted line.

 +

Select Decrease Indent from the Text menu in succession until the current line is no longer part of the bulleted list.

 +

Press ShiftTab repeatedly until the current line is no longer part of the bulleted list.

 +

Press AltLeft repeatedly until the current line is no longer part of the bulleted list.

 + + +
+
+Öka indragning +

För att öka radindragningen i en punktlista med musen:

+

Select Increase Indent from the Text menu.

 +

För att öka radindragningen i en punktlista med tangentbordet:

+ +

Press the Tab key.

 +

Press the key combination AltRight.

 + +
+ +
+Minska indragning +

För att minska radindragningen i en punktlista med musen:

+

Select Decrease Indent from the Text menu.

 +

För att minska radindragningen i en punktlista med tangentbordet:

+ +

Press the key combination ShiftTab.

 +

Press the key combination AltLeft.

 + +
+ + diff -Nru gnote-3.14.2/help/sv/gnote-common-problems.page gnote-3.16.0/help/sv/gnote-common-problems.page --- gnote-3.14.2/help/sv/gnote-common-problems.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-common-problems.page 2015-03-29 20:07:29.000000000 +0000 @@ -0,0 +1,33 @@ + + + + + +

GNU Free Documentation License (GFDL), Version 1.1

 + Frequently asked questions + + Pierre-Yves Luyten + 2011 + + + Aurimas Cernius + 2011-2014 + + + Adam Dingle + adam@yorba.org + 2013 + + + + Gnote Common Issues + + Does <app>Gnote</app> work with <app>Tomboy</app>?

You can import Tomboy Notes. A plugin has to be activated.

+ + How to automatically start <app>Gnote</app> when I log in? +

To start Gnote automatically when you log into GNOME, run gnome-session-properties.

+ + I'm not comfortable with new single-window interface

You can make Gnote behave the old way by selecting Always open notes in new window in Preferences dialog.

 + + + diff -Nru gnote-3.14.2/help/sv/gnote-creating-notes.page gnote-3.16.0/help/sv/gnote-creating-notes.page --- gnote-3.14.2/help/sv/gnote-creating-notes.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-creating-notes.page 2015-03-29 20:07:29.000000000 +0000 @@ -0,0 +1,34 @@ + + + + + +

GNU Free Documentation License (GFDL), Version 1.1

 + Creating notes + + Pierre-Yves Luyten + 2011 + + + Aurimas Cernius + 2011-2012 + + + Adam Dingle + adam@yorba.org + 2013 + + + + Skapa anteckningar + +

In Gnote, you can create new notes in any of these ways:

+ +

Select New Note in the application menu.

 +

In the Gnote window, click the toolbar item New.

 +

In the main window, right click in the note list and select New. This will create a note in the currently selected notebook.

 +

If the status icon is enabled, click on it and select New Note.

 +

Use the keyboard shortcut CtrlN.

 + + + diff -Nru gnote-3.14.2/help/sv/gnote-deleting-notes.page gnote-3.16.0/help/sv/gnote-deleting-notes.page --- gnote-3.14.2/help/sv/gnote-deleting-notes.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-deleting-notes.page 2015-03-29 20:07:30.000000000 +0000 @@ -0,0 +1,31 @@ + + + + + +

GNU Free Documentation License (GFDL), Version 1.1

 + Deleting notes + + Pierre-Yves Luyten + 2011 + + + Aurimas Cernius + 2011-2012 + + + Adam Dingle + adam@yorba.org + 2013 + + + + Deleting Notes +

You can delete a note in either of two ways:

+ +

Right click in the list of notes and select Delete. This will delete all selected notes.

 +

When a note is open, press the Delete button on the toolbar.

 + +

In both cases a dialog box will pop up asking if you want to permanently delete the note and its contents. Click the Delete button to discard the note permanently, or Cancel to abort. Links to the deleted note from other notes will still exist, but will re-create the note upon activation.

+ + diff -Nru gnote-3.14.2/help/sv/gnote-editing-notes.page gnote-3.16.0/help/sv/gnote-editing-notes.page --- gnote-3.14.2/help/sv/gnote-editing-notes.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-editing-notes.page 2015-03-29 20:07:30.000000000 +0000 @@ -0,0 +1,73 @@ + + + + + +

GNU Free Documentation License (GFDL), Version 1.1

 + Editing note contents + + Pierre-Yves Luyten + 2011 + + + Aurimas Cernius + 2011-2013 + + + Adam Dingle + adam@yorba.org + 2013 + + + + Redigera anteckningar + +

When you open a note, Gnote will replace the note overview with the note's contents.

+

Toolbar at the top of the window will now contain note specific items in it. Bellow toolbar is the note's content area.

+
+ <app>Gnote</app> window displaying note + Gnote Note + +

Gnote note editing.

+ +
+ +

To edit the note, click in the content area and type. The first line is considered the title of the note. By default this is populated with the text "New Note (number)". To change the title, click on the first line and use the keyboard to change the title.

+

Use the Text button to format text within your notes. This button displays a menu with several commands:

+ + + Ångra +

The Undo command reverts changes made to your note during the current session. To undo using the keyboard, press CtrlZ.

+ + Gör om +

The Redo command puts back changes that were removed using the Undo feature. To redo your last change using the keyboard, press ShiftCtrlZ.

+ + Fet +

To make text bold, select it and then select the Bold command from the Text menu or press CtrlB.

+ + Kursiv +

To make text italic, select it and then select the Italic command from the Text menu, or press CtrlI.

+ + Genomstruken +

The strikeout style will put a line through the selected text. To add a strikeout, select text and then select the Strikeout command from the Text menu or press CtrlS.

+ + Färgmarkera +

The highlight style will put a different background around the selected text. To add a highlight, select text and then select the Highlight command from the Text menu or press CtrlH.

+ + Typsnittsstorlek +

There are actually four options in this part of the menu: Small, Normal, Large, and Huge. Each option represents a font size to use for the selected text. To modify the font size, select text and then select Small, Normal, Large, or Huge.

+ + Punkter +

Select the Bullets command from the Text menu to begin or end a bulleted list. If the cursor is inside a bulleted list, the Increase Indent and Decrease Indent options will be enabled.

+

With the cursor on a bulleted list line, select the Increase Indent command to shift the current line to the right or the Decrease Indent command to shift to the left.

+

For more information on bullets, see .

+ + +

The toolbar at the top of note has search button. Use it to search for text within the current note. A small find bar will appear above the note. To open the find bar using the keyboard, press CtrlF. Enter the text to find and press Enter. Matches will be highlighted. Click Next to highlight the next match and place the cursor there. Click Previous to move to the previous match. +To close the find bar, click the search button again or press the Escape key.

+ +
+ Rich Note Content +
+ + diff -Nru gnote-3.14.2/help/sv/gnote-introduction.page gnote-3.16.0/help/sv/gnote-introduction.page --- gnote-3.14.2/help/sv/gnote-introduction.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-introduction.page 2015-03-29 20:07:30.000000000 +0000 @@ -0,0 +1,42 @@ + + + + + + + Introduction to Gnote +

GNU Free Documentation License (GFDL), Version 1.1

 + + Pierre-Yves Luyten + 2011 + + + Aurimas Cernius + 2011-2012 + + + Adam Dingle + adam@yorba.org + 2013 + + + + Gnote Introduction +

Gnote is a desktop note-taking application for GNOME. It is simple and easy to use, and lets you organize the ideas and information you deal with every day. Gnote has useful editing features to help you customize your notes, including

+ +

highlighting search text

 +

inline spell checking

 +

auto-linking web and email addresses

 +

undo/redo

 +

font styling and sizing

 +

bulleted lists

 + +
+ The <app>Gnote</app> main window + The Gnote main window + +

The Gnote main window.

+ +
+ + diff -Nru gnote-3.14.2/help/sv/gnote-links.page gnote-3.16.0/help/sv/gnote-links.page --- gnote-3.14.2/help/sv/gnote-links.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-links.page 2015-03-29 20:07:30.000000000 +0000 @@ -0,0 +1,32 @@ + + + + + +

GNU Free Documentation License (GFDL), Version 1.1

 + Linking to other notes + + Pierre-Yves Luyten + 2011 + + + Aurimas Cernius + 2011,2013 + + + Adam Dingle + adam@yorba.org + 2013 + + + + Links +

The Link button creates a link to a new note from within the current note. For example, if your note contains the phrase “FinalExam”, you can select this text and click the Link button to create a new note called “FinalExam”. The selected text will become a clickable link to this new note.

+ +

Changing a note's title will update links present in other notes. This prevents broken links from occurring when a note is renamed.

 + +
Backlinks Add-in +

When the Backlinks plugin is installed, the Actions menu will contain an item What links here?, which provides a sub-menu listing all notes containing a link to the current note.

+
+ + diff -Nru gnote-3.14.2/help/sv/gnote-notes-preferences.page gnote-3.16.0/help/sv/gnote-notes-preferences.page --- gnote-3.14.2/help/sv/gnote-notes-preferences.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-notes-preferences.page 2015-03-29 20:07:30.000000000 +0000 @@ -0,0 +1,67 @@ + + + + + + + Gnote settings +

GNU Free Documentation License (GFDL), Version 1.1

 + + Pierre-Yves Luyten + 2011 + + + Aurimas Cernius + 2011-2013 + + + Adam Dingle + adam@yorba.org + 2013 + + + + Gnote Preferences +
+ General preferences +

To set preferences for Gnote, select Preferences from the application menu.

+

There are three categories of preferences, General, Hotkeys and Add-Ins.

+

The General tab lets you set preferences related to application behaviour and editing notes. There are a few checkboxes on this tab:

+ + Use status icon

Enable this checkbox to show the Gnote status icon when running. In this mode Gnote will remain present even after all its windows are closed. When you click the status icon, a menu appears that gives you quick access to recently used notes and other windows.

 + Always open notes in new window

When checked, instead of replacing current window content, note is opened in the new window.

 + Spellcheck while typing

Enable this checkbox to underline misspellings in red and provide suggestions in the right click context menu.

The spellcheck option is only available if you have the GtkSpell package for your distribution installed.

 + Färgmarkera WikiOrd

Enable this checkbox to create links for phrases ThatLookLikeThis. Clicking on a link will create a new note with a title corresponding to the link text.

 + Enable auto-bulleted lists

When this preference is enabled, you can create bulleted lists by starting lines with a dash character -. Read more about .

 + Use custom font

Enable this checkbox to set a custom font to be used in your notes.

 + +
<gui>Preferences</gui> window + Editing Gnote Preferences +
+
+ +
+ Advanced Settings +
+
+ Synchronization Settings +
+ Synchronization services +
+
+ Advanced +

The Advanced button in the Synchronization tab of the Preferences dialog brings up another dialog for setting up conflict resolution.

+
+ Advanced Synchronization Settings + +
+

This dialog lets you choose what to do when a conflict occurrs. A conflict happens when a note has been modified both on the local machine and on another device. You can select one of these options:

+ +

Rename the existing note by appending "(old)" to its title and downloading the one from storage

 +

Replace the existing note by the one from storage, losing all modifications

 +

Ask about each conflicting note individually

 + +
+
+ + diff -Nru gnote-3.14.2/help/sv/gnote-searching-notes.page gnote-3.16.0/help/sv/gnote-searching-notes.page --- gnote-3.14.2/help/sv/gnote-searching-notes.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-searching-notes.page 2015-03-29 20:07:30.000000000 +0000 @@ -0,0 +1,36 @@ + + + + + +

GNU Free Documentation License (GFDL), Version 1.1

 + Searching notes + + Pierre-Yves Luyten + 2011 + + + Aurimas Cernius + 2011-2013 + + + Adam Dingle + adam@yorba.org + 2013 + + + + Exploring Notes + +

The main Gnote window shows an overview of all your notes. By default the window will display notes in the order in which they were last modified. Click the Note or Last Changed column headings to change the sort order. Click a column heading a second time to toggle between ascending and descending order.

+

You can find specific notes by clicking search button and entering text in the search field that apears. The note list will automatically update to include only the notes which have matching text. If notes list has focus, you can simply type search text there, search will be automatically activated.

+

To open a note, do any of the following:

+ +

Dubbelklicka på en anteckning.

 +

Right-click in the list of notes and select Open from the context menu. This will open all selected notes, each in its own window.

 +

Right-click in the list of notes and select Open in New Window from the context menu. This will open each selected note in a new window, leaving the original window as is.

 +

Select one or more notes in a list and press CtrlO.

 +

If the status icon is enabled, click it and select a note from the menu that appears. This menu is limited to a certain number of notes and includes pinned and recently updated notes.

 + + + diff -Nru gnote-3.14.2/help/sv/gnote-synchronization.page gnote-3.16.0/help/sv/gnote-synchronization.page --- gnote-3.14.2/help/sv/gnote-synchronization.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-synchronization.page 2015-03-29 20:07:30.000000000 +0000 @@ -0,0 +1,39 @@ + + + + + + Synchronize notes +

GNU Free Documentation License (GFDL), Version 1.1

 + + Aurimas Cernius + 2012 + + + Adam Dingle + adam@yorba.org + 2013 + + + + Synkronisering +
+ About synchronization +

Gnote lets you synchronize notes across multiple machines, so that you can use it on multiple devices and work with the same notes on all of them.

+

In order to use synchronization, you have to configure it first in the Gnote configuration dialog.

+

Notes are synchronized to one location, common to all Gnote installations. This location stores the history of your notes. When synchronizing, each Gnote instance uploads new and updated notes to this location, and downloads new and updated notes from other installations. The synchronization location also contains information on deleted notes: when synchronizing, Gnote publishes all deleted notes and deletes the ones that have been published as such. This way multiple Gnote installations can keep the same set of notes.

+
+
+ Configure synchronization +
+
+ Synchronize +

To synchronize, select Synchronize Notes from the application menu. This item is only available if synchronization has been configured.

+

After you select the Synchronize Notes menu item, a progress dialog will be displayed, which will let you know when synchronization is complete. Also, all notes will be disabled for editing while synchronization is in progress.

+
+ Synchronization progress + +
+
+ + diff -Nru gnote-3.14.2/help/sv/gnote-template-notes.page gnote-3.16.0/help/sv/gnote-template-notes.page --- gnote-3.14.2/help/sv/gnote-template-notes.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-template-notes.page 2015-03-29 20:07:30.000000000 +0000 @@ -0,0 +1,50 @@ + + + + + + + Using template notes +

GNU Free Documentation License (GFDL), Version 1.1

 + + Aurimas Cernius + 2011-2012 + + + Adam Dingle + adam@yorba.org + 2013 + + + + Template Notes +
+ Template Note Usage +

Template notes are used to define the content for newly created notes. Templates are just like regular notes with some additional features.

+

You can define a single main template note and one for each notebook you have. These templates define the content of every new note you create:

+ +

Every new note you create in Gnote, but not in any notebook, will have the content of the main template. If you have not created a main template, the default content will be used.

 +

Every new note created in a notebook will have the content of that notebook's template note, if any. If no template note for a notebook is defined, the default note content will be used.

 + +

To create or modify a template note:

+ + Main template note

Open Gnote's preferences and in the General tab press the Open Template Note button.

 + Notebook template note

Right click on a notebook in the main window and select Open Template Note.

 + +
+
+ Template Note Features +

A template note is like an ordinary note except that it is not shown in note lists and has a template bar at the top.

+
Template note + Template note window +
+

The template bar has the following features:

+ + Convert to regular note

Press this button to turn the template into a regular note, visible in the list of notes. This action is similar to deleting a template note.

 + Save Size

If you check this box, the size of a newly created note will be identical to that of the template note. When this checkbox is not checked, new notes' windows will have the default size.

 + Save Selection

If this box is checked, new notes will have not only the content of the template note, but also its selection. Use this option if you want a certain part of the content in the new note to be initially selected.

 + Save Title

This checkbox lets you base the title of new notes on a template note's title. With this box checked, a new note will have the template note's title with a unique number appended. Otherwise the default title will be used.

 + +
+ + diff -Nru gnote-3.14.2/help/sv/gnote-working-with-notebooks.page gnote-3.16.0/help/sv/gnote-working-with-notebooks.page --- gnote-3.14.2/help/sv/gnote-working-with-notebooks.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/gnote-working-with-notebooks.page 2015-03-29 20:07:30.000000000 +0000 @@ -0,0 +1,112 @@ + + + + + + + Organizing your notes +

GNU Free Documentation License (GFDL), Version 1.1

 + + Pierre-Yves Luyten + 2011 + + + Aurimas Cernius + 2011-2012 + + + Adam Dingle + adam@yorba.org + 2013 + + + + Working With Notebooks +

Notebooks let you group related notes together. You can add a note to a notebook in the main window or in the note editing view.

+ +
Skapa anteckningsböcker +

To create a new notebook:

+ + +

Click on the application menu and select New Notebook.

+ + +

Ange ett namn för det nya anteckningsblocket.

+ + +

Alternatively:

+ + +

In the note overview, right click in the left hand pane and choose New....

+ + +

Ange ett namn för det nya anteckningsblocket.

+ + +
+ New Notebook from context menu + +

New Notebook

+ +
+
+ +
Lägg till anteckningar till ett anteckningsblock +

You can add a note to a notebook from the main window or directly within a note.

+

To add a note to a notebook from the main window, do one of the following:

+ +

Drag the note(s) onto a notebook on the left using the mouse.

 +

Click on a notebook, right-click in notes list and select New from the context menu. A new note will be created and added to the notebook.

 + +

As you type a note, you can add the note directly to an existing notebook using the ActionsNotebook menu.

+
+ Lägg till anteckningar till ett anteckningsblock +

Add to Notebook.

 +
+

To remove a note from a notebook, use one of the following:

+ +

Move the note to Unfiled Notes in the main window.

 +

Select the No Notebook option from the menu which appears when you press the ActionsNotebook in an open note.

 + +
+ +
Creating a Template +

After you create a notebook, you can create a template for new notes that you create in that notebook.

+ +

In the main window, right click on a notebook and choose Open Template Note.

+ +

This will open a new template note. Any text typed in this note will appear in all notes created in this notebook.

 + +
+ Creating a Template +

Note Template.

 +
+

For more, see .

+
+ +
Ta bort ett anteckningsblock +

Deleting a notebook will not delete any of the notes which are currently inside the notebook. After you delete a notebook, its notes will not be associated with any notebook and will appear in Unfiled Notes in the main window.

+

To delete a notebook, go to the main window and do one of the following:

+ +

Right click on a notebook and choose Delete Notebook.

 +

Remove all notes from a notebook. The notebook will be automatically removed the next time Gnote restarts.

 + +
+ Deleting notes from main window + +

Delete Notebook.

+ +
+
+ +
Special Notebooks +

Gnote has several special notebooks:

+ +

Active: notes that have been opened in the current Gnote session

 +

All: all notes except templates

 +

Important: notes marked as important

 +

Unfiled: all notes that are not in a user-created notebook

 + +
+ + diff -Nru gnote-3.14.2/help/sv/index.page gnote-3.16.0/help/sv/index.page --- gnote-3.14.2/help/sv/index.page 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/index.page 2015-03-29 20:07:30.000000000 +0000 @@ -0,0 +1,44 @@ + + + + + +

GNU Free Documentation License (GFDL), Version 1.1

+ + + Pierre-Yves Luyten + 2011 + + + Aurimas Cernius + 2011 + + + + <media type="image" src="figures/logo32.png"/> Gnote Help + +
+ Introduktion +
+ +
+ Managing Notes +
+ +
+ Organizing Notes +
+ +
+ Advanced +
+ +
+ Customizing +
+ +
+ Common Problems +
+ + diff -Nru gnote-3.14.2/help/sv/sv.po gnote-3.16.0/help/sv/sv.po --- gnote-3.14.2/help/sv/sv.po 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/help/sv/sv.po 2015-03-26 20:50:43.000000000 +0000 @@ -0,0 +1,3002 @@ +# +msgid "" +msgstr "" +"Project-Id-Version: gnote manual\n" +"POT-Creation-Date: 2015-02-27 09:34+0000\n" +"PO-Revision-Date: 2009-04-20 21:45+0100\n" +"Last-Translator: Daniel Nylander \n" +"Language-Team: Swedish \n" +"Language: sv\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" + +#. Put one translator per line, in the form NAME , YEAR1, YEAR2 +#, fuzzy +#| msgid "translator-credits" +msgctxt "_" +msgid "translator-credits" +msgstr "Daniel Nylander , 2006, 2007, 2008, 2009" + +#. (itstool) path: info/desc +#: C/gnote-addin-bugzillalink.page:9 +msgid "Insert Bugzilla links" +msgstr "" + +#. (itstool) path: license/p +#: C/gnote-addin-bugzillalink.page:10 C/gnote-addin-fixedwidth.page:9 +#: C/gnote-addin-html.page:9 C/gnote-addin-notedirwatcher.page:9 +#: C/gnote-addin-noteoftheday.page:9 C/gnote-addin-print.page:9 +#: C/gnote-addins-preferences.page:9 C/gnote-addin-readonly.page:9 +#: C/gnote-addin-replacetitle.page:9 C/gnote-addin-specialnotes.page:9 +#: C/gnote-addin-sync-local.page:10 C/gnote-addin-sync-webdav.page:10 +#: C/gnote-addin-timestamp.page:10 C/gnote-addin-underline.page:9 +#: C/gnote-bulleted-lists.page:9 C/gnote-common-problems.page:8 +#: C/gnote-creating-notes.page:8 C/gnote-deleting-notes.page:8 +#: C/gnote-editing-notes.page:6 C/gnote-hotkeys.page:9 +#: C/gnote-introduction.page:10 C/gnote-links.page:8 +#: C/gnote-notes-preferences.page:10 C/gnote-searching-notes.page:8 +#: C/gnote-synchronization.page:9 C/gnote-template-notes.page:10 +#: C/gnote-working-with-notebooks.page:10 C/index.page:6 +msgid "GNU Free Documentation License (GFDL), Version 1.1" +msgstr "" + +#. (itstool) path: credit/name +#: C/gnote-addin-bugzillalink.page:12 C/gnote-addin-fixedwidth.page:11 +#: C/gnote-addin-html.page:11 C/gnote-addin-noteoftheday.page:11 +#: C/gnote-addin-print.page:11 C/gnote-addins-preferences.page:11 +#: C/gnote-addin-replacetitle.page:11 C/gnote-addin-timestamp.page:12 +#: C/gnote-addin-underline.page:11 C/gnote-bulleted-lists.page:11 +#: C/gnote-common-problems.page:11 C/gnote-creating-notes.page:11 +#: C/gnote-deleting-notes.page:11 C/gnote-editing-notes.page:9 +#: C/gnote-hotkeys.page:11 C/gnote-introduction.page:12 C/gnote-links.page:11 +#: C/gnote-notes-preferences.page:12 C/gnote-searching-notes.page:11 +#: C/gnote-working-with-notebooks.page:12 C/index.page:9 +msgid "Pierre-Yves Luyten" +msgstr "" + +#. (itstool) path: credit/years +#: C/gnote-addin-bugzillalink.page:13 C/gnote-addin-fixedwidth.page:12 +#: C/gnote-addin-html.page:12 C/gnote-addin-noteoftheday.page:12 +#: C/gnote-addin-print.page:12 C/gnote-addins-preferences.page:12 +#: C/gnote-addin-replacetitle.page:12 C/gnote-addin-timestamp.page:13 +#: C/gnote-addin-underline.page:12 C/gnote-bulleted-lists.page:12 +#: C/gnote-bulleted-lists.page:16 C/gnote-common-problems.page:12 +#: C/gnote-creating-notes.page:12 C/gnote-deleting-notes.page:12 +#: C/gnote-editing-notes.page:10 C/gnote-hotkeys.page:12 +#: C/gnote-introduction.page:13 C/gnote-links.page:12 +#: C/gnote-notes-preferences.page:13 C/gnote-searching-notes.page:12 +#: C/gnote-working-with-notebooks.page:13 C/index.page:10 C/index.page:14 +msgid "2011" +msgstr "" + +#. (itstool) path: credit/name +#: C/gnote-addin-bugzillalink.page:16 C/gnote-addin-fixedwidth.page:15 +#: C/gnote-addin-html.page:15 C/gnote-addin-notedirwatcher.page:11 +#: C/gnote-addin-noteoftheday.page:15 C/gnote-addin-print.page:15 +#: C/gnote-addins-preferences.page:15 C/gnote-addin-readonly.page:11 +#: C/gnote-addin-replacetitle.page:15 C/gnote-addin-specialnotes.page:11 +#: C/gnote-addin-sync-local.page:12 C/gnote-addin-sync-webdav.page:12 +#: C/gnote-addin-tableofcontents.page:58 C/gnote-addin-timestamp.page:16 +#: C/gnote-addin-underline.page:15 C/gnote-bulleted-lists.page:15 +#: C/gnote-common-problems.page:15 C/gnote-creating-notes.page:15 +#: C/gnote-deleting-notes.page:15 C/gnote-editing-notes.page:13 +#: C/gnote-hotkeys.page:15 C/gnote-introduction.page:16 C/gnote-links.page:15 +#: C/gnote-notes-preferences.page:16 C/gnote-searching-notes.page:15 +#: C/gnote-synchronization.page:11 C/gnote-template-notes.page:12 +#: C/gnote-working-with-notebooks.page:16 C/index.page:13 +msgid "Aurimas Cernius" +msgstr "" + +#. (itstool) path: credit/years +#: C/gnote-addin-bugzillalink.page:17 C/gnote-addin-fixedwidth.page:16 +#: C/gnote-addin-html.page:16 C/gnote-addin-noteoftheday.page:16 +#: C/gnote-addin-print.page:16 C/gnote-addin-replacetitle.page:16 +#: C/gnote-addin-timestamp.page:17 C/gnote-addin-underline.page:16 +#: C/gnote-links.page:16 +msgid "2011,2013" +msgstr "" + +#. (itstool) path: credit/name +#: C/gnote-addin-bugzillalink.page:20 C/gnote-addin-fixedwidth.page:19 +#: C/gnote-addin-html.page:19 C/gnote-addin-notedirwatcher.page:15 +#: C/gnote-addin-noteoftheday.page:19 C/gnote-addin-print.page:19 +#: C/gnote-addins-preferences.page:19 C/gnote-addin-replacetitle.page:19 +#: C/gnote-addin-sync-local.page:16 C/gnote-addin-sync-webdav.page:16 +#: C/gnote-addin-tableofcontents.page:53 C/gnote-addin-timestamp.page:20 +#: C/gnote-addin-underline.page:19 C/gnote-bulleted-lists.page:19 +#: C/gnote-common-problems.page:19 C/gnote-creating-notes.page:19 +#: C/gnote-deleting-notes.page:19 C/gnote-editing-notes.page:17 +#: C/gnote-hotkeys.page:19 C/gnote-introduction.page:20 C/gnote-links.page:19 +#: C/gnote-notes-preferences.page:20 C/gnote-searching-notes.page:19 +#: C/gnote-synchronization.page:15 C/gnote-template-notes.page:16 +#: C/gnote-working-with-notebooks.page:20 +msgid "Adam Dingle" +msgstr "" + +#. (itstool) path: credit/years +#: C/gnote-addin-bugzillalink.page:22 C/gnote-addin-fixedwidth.page:21 +#: C/gnote-addin-html.page:21 C/gnote-addin-notedirwatcher.page:17 +#: C/gnote-addin-noteoftheday.page:21 C/gnote-addin-print.page:21 +#: C/gnote-addins-preferences.page:21 C/gnote-addin-readonly.page:12 +#: C/gnote-addin-replacetitle.page:21 C/gnote-addin-specialnotes.page:12 +#: C/gnote-addin-sync-local.page:18 C/gnote-addin-sync-webdav.page:18 +#: C/gnote-addin-tableofcontents.page:51 C/gnote-addin-tableofcontents.page:55 +#: C/gnote-addin-timestamp.page:22 C/gnote-addin-underline.page:21 +#: C/gnote-bulleted-lists.page:21 C/gnote-common-problems.page:21 +#: C/gnote-creating-notes.page:21 C/gnote-deleting-notes.page:21 +#: C/gnote-editing-notes.page:19 C/gnote-hotkeys.page:21 +#: C/gnote-introduction.page:22 C/gnote-links.page:21 +#: C/gnote-notes-preferences.page:22 C/gnote-searching-notes.page:21 +#: C/gnote-synchronization.page:17 C/gnote-template-notes.page:18 +#: C/gnote-working-with-notebooks.page:22 +msgid "2013" +msgstr "" + +#. (itstool) path: page/title +#: C/gnote-addin-bugzillalink.page:26 +msgid "Bugzilla Links Add-in" +msgstr "" + +#. (itstool) path: page/p +#: C/gnote-addin-bugzillalink.page:27 +#, fuzzy +#| msgid "" +#| "Allows you to drag a Bugzilla URL from your browser directly into a Gnote " +#| "note. The bug number is inserted as a link with a small bug icon next to " +#| "it. Once the Bugzilla link has been inserted into the note, click on it " +#| "to open the URL in your web browser." +msgid "" +"This plugin lets you drag a Bugzilla URL directly into a Gnote " +"note. The bug number is inserted as a link with a little bug icon next to it." +msgstr "" +"Låter dig dra en Bugzilla-url från din webbläsare direkt till en Gnote-" +"anteckning. Felnumret infogas som en länk med en liten ikon bredvid sig. När " +"Bugzilla-länken har infogats i anteckningen kan du klicka på den för att " +"öppna url:en i din webbläsare." + +#. (itstool) path: page/p +#: C/gnote-addin-bugzillalink.page:28 +msgid "In the preferences, you can add special icons for certain hosts." +msgstr "" + +#. (itstool) path: info/desc +#: C/gnote-addin-fixedwidth.page:8 +msgid "Use a fixed-width font" +msgstr "" + +#. (itstool) path: page/title +#: C/gnote-addin-fixedwidth.page:25 +#, fuzzy +#| msgid "Fixed Width" +msgid "Fixed Width Add-in" +msgstr "Fast bredd" + +#. (itstool) path: page/p +#: C/gnote-addin-fixedwidth.page:26 +#, fuzzy +#| msgid "" +#| "The fixed width style allows text to use a fixed width font. To change " +#| "existing text, first select the text you want to modify. Then select the " +#| "Fixed Width option " +#| "from the Text menu. You can also select the " +#| "Fixed Width option " +#| "from the Text before you start typing to have the " +#| "text you type be in a fixed width style." +msgid "" +"The Fixed Width plugin allows text to use a fixed width font. To " +"change existing text, first select the text you want to modify. Then select " +"Fixed Width from the Text menu. You can also select " +"Fixed Width from the menu before you start typing." +msgstr "" +"Den fasta breddstilen tillåter att texten använder ett typsnitt med fast " +"bredd. För att ändra befintlig text, markera första texten som du vill " +"ändra. Välj sedan alternativet Fast bredd från menyn Text. Du kan " +"även välja alternativet Fast bredd från Text innan du börjar skriva in för " +"att få texten i fast breddstil." + +#. (itstool) path: info/desc +#: C/gnote-addin-html.page:8 +#, fuzzy +#| msgid "Export to HTML" +msgid "Export notes to HTML" +msgstr "Exportera till HTML" + +#. (itstool) path: page/title +#: C/gnote-addin-html.page:25 +msgid "Export to HTML" +msgstr "Exportera till HTML" + +#. (itstool) path: page/p +#: C/gnote-addin-html.page:26 +msgid "" +"When the Export to HTML plugin is installed, the command " +"Export to HTML is present in the Actions menu." +msgstr "" + +#. (itstool) path: page/p +#: C/gnote-addin-html.page:27 +#, fuzzy +#| msgid "" +#| "After selecting this option, you will be presented with a dialog that " +#| "allows you to choose where to save the HTML file. " +#| "Enter the destination filename and click OK to " +#| "save the file, or Cancel to abort the operation." +msgid "" +"To create an HTML document from one or more notes, select this command. You " +"will see a dialog that lets you choose where to save the HTML file. Enter " +"the destination filename and click Save to save the file, " +"or Cancel to abort." +msgstr "" +"Efter att detta alternativ har valts kommer en dialogruta att visas som " +"låter dig välja var HTML-filen ska sparas. Ange " +"målfilnamnet och klicka på OK för att spara filen, " +"eller Avbryt för att avbryta åtgärden." + +#. (itstool) path: page/p +#: C/gnote-addin-html.page:28 +#, fuzzy +#| msgid "" +#| "To export any notes for which a link exists in the current note, select " +#| "the Export linked notes button." +msgid "" +"To export any notes linked to by the current note, select the Export " +"Linked Notes check box." +msgstr "" +"För att exportera anteckningar till vilken en länk finns i den aktuella " +"anteckningen, välj knappen Exportera länkade anteckningar." + +#. (itstool) path: info/desc +#: C/gnote-addin-notedirwatcher.page:8 +msgid "Watch for note changes on file system" +msgstr "" + +#. (itstool) path: credit/years +#: C/gnote-addin-notedirwatcher.page:12 +msgid "2012-2013" +msgstr "" + +#. (itstool) path: page/title +#: C/gnote-addin-notedirwatcher.page:21 +msgid "Note Directory Watcher" +msgstr "" + +#. (itstool) path: page/p +#: C/gnote-addin-notedirwatcher.page:22 +msgid "" +"This plugin lets you work with notes on the file system while Gnote is running. When enabled, this plugin monitors note files for changes " +"and reloads them when any change is detected. This way any external change " +"to a note file will automatically be reflected in Gnote." +msgstr "" + +#. (itstool) path: page/p +#: C/gnote-addin-notedirwatcher.page:23 +msgid "" +"Gnote stores notes in the ~/.local/share/gnote " +"folder. With this plugin is enabled, you can perform actions at the file " +"system level on this directory, such as synchronizing note files with some " +"other location, while Gnote is running." +msgstr "" + +#. (itstool) path: info/desc +#: C/gnote-addin-noteoftheday.page:8 +msgid "A \"Today\" note" +msgstr "" + +#. (itstool) path: page/title +#: C/gnote-addin-noteoftheday.page:25 +msgid "Note of the Day" +msgstr "Dagens anteckning" + +#. (itstool) path: page/p +#: C/gnote-addin-noteoftheday.page:26 +#, fuzzy +#| msgid "" +#| "This add-in automatically creates a \"Today\" note for jotting daily " +#| "thoughts down. The current date is used as a basis for the title of the " +#| "note. As an example, the title of a \"Today\" note created on February " +#| "28, 2007, would be, \"Today: Wednesday, February 28 2007\"" +msgid "" +"This plugin automatically creates a \"Today\" note for jotting daily " +"thoughts down. As an example, a \"Today\" note created on February 28, 2013 " +"would be called \"Today: Thursday, February 28 2013\"." +msgstr "" +"Det här tillägget skapar automatiskt en \"Idag\"-anteckning för att skriva " +"ner dagliga tankar. Det aktuella datumet används som grund för anteckningens " +"titel. Till exempel skulle titeln för en \"Idag\"-anteckning den 28:e " +"februari 2007 bli \"Idag: onsdag, 28 februari 2007\"" + +#. (itstool) path: page/p +#: C/gnote-addin-noteoftheday.page:27 +#, fuzzy +#| msgid "" +#| "If you leave a \"Today\" note unmodified, the Note of the Day Add-in will " +#| "automatically delete the note." +msgid "" +"If you leave a \"Today\" note unmodified, the plugin will automatically " +"delete the note." +msgstr "" +"Om du lämnar en oförändrad \"Idag\"-anteckning kommer tillägget Dagens " +"anteckning att automatiskt ta bort anteckningen." + +#. (itstool) path: page/p +#: C/gnote-addin-noteoftheday.page:28 +#, fuzzy +#| msgid "" +#| "To customize the content of the default \"Today\" note, create a new note " +#| "and change the title of the note to be, \"Today: Template\". Change the " +#| "content of the template note to whatever you like. When new \"Today\" " +#| "notes are created, it will then use the content of your \"Today: Template" +#| "\" note." +msgid "" +"To customize the content of the default \"Today\" note, create a new note " +"and change the title of the note to \"Today: Template\". Change the content " +"of the template note to whatever you like. New \"Today\" notes will then use " +"the content of your \"Today: Template\" note." +msgstr "" +"För att anpassa innehållet för standardanteckningen \"Idag\" ska du skapa en " +"ny anteckning och ändra anteckningens titel till att vara \"Idag: Mall\". " +"Ändra innehållet för anteckningsmallen till vad du önskar. När nya \"Idag\"-" +"anteckningar skapas kommer de att använda innehållet från din \"Idag: Mall\"-" +"anteckning." + +#. (itstool) path: info/desc +#: C/gnote-addin-print.page:8 +#, fuzzy +#| msgid "Print Notes" +msgid "Print notes" +msgstr "Skriv ut anteckningar" + +#. (itstool) path: page/title +#: C/gnote-addin-print.page:25 +msgid "Print" +msgstr "Skriv ut" + +#. (itstool) path: page/p +#: C/gnote-addin-print.page:26 +msgid "" +"When the Print plugin is installed, the Print command " +"is present in the Actions menu. This command opens a " +"standard Print dialog which lets you print a note." +msgstr "" + +#. (itstool) path: media +#. This is a reference to an external file such as an image or video. When +#. the file changes, the md5 hash will change to let you know you need to +#. update your localized copy. The msgstr is not used at all. Set it to +#. whatever you like once you have updated your copy of the file. +#: C/gnote-addins-preferences.page:30 +#, fuzzy +#| msgid "" +#| "@@image: 'figures/gnote-preferences-add-ins.png'; " +#| "md5=bb3114a219b8bfdf31549fced9618245" +msgctxt "_" +msgid "" +"external ref='figures/gnote-preferences-add-ins.png' " +"md5='d4afd1e494003fdb4b656e389d803d66'" +msgstr "" +"@@image: 'figures/gnote-preferences-add-ins.png'; " +"md5=bb3114a219b8bfdf31549fced9618245" + +#. (itstool) path: info/desc +#: C/gnote-addins-preferences.page:8 +msgid "Settings for Gnote plugins" +msgstr "" + +#. (itstool) path: credit/years +#: C/gnote-addins-preferences.page:16 +msgid "2011,2013,2014" +msgstr "" + +#. (itstool) path: page/title +#: C/gnote-addins-preferences.page:25 +#, fuzzy +#| msgid "Gnote Add-in Preferences" +msgid "Add-in Preferences" +msgstr "Tilläggsinställningar för Gnote" + +#. (itstool) path: page/p +#: C/gnote-addins-preferences.page:26 +msgid "" +"You can activate or deactivate plugins in this tab. To do this, select a " +"plugin and click the Enable button. Use the Disable " +"button to disable a plugin." +msgstr "" + +#. (itstool) path: page/p +#: C/gnote-addins-preferences.page:27 +msgid "" +"Some plugins have preferences, which you can access by selecting a plugin " +"and pressing the Preferences button." +msgstr "" + +#. (itstool) path: figure/title +#: C/gnote-addins-preferences.page:28 +#, fuzzy +#| msgid "Gnote Add-in Preferences" +msgid "Gnote Addin Preferences" +msgstr "Tilläggsinställningar för Gnote" + +#. (itstool) path: figure/desc +#: C/gnote-addins-preferences.page:29 +msgid "Gnote Add-ins window" +msgstr "" + +#. (itstool) path: media/p +#: C/gnote-addins-preferences.page:31 +msgid "Add-ins window." +msgstr "" + +#. (itstool) path: info/desc +#: C/gnote-addin-readonly.page:8 +msgid "Make notes read-only" +msgstr "" + +#. (itstool) path: page/title +#: C/gnote-addin-readonly.page:16 +msgid "Read Only" +msgstr "" + +#. (itstool) path: page/p +#: C/gnote-addin-readonly.page:17 +msgid "" +"When the ReadOnly plugin is installed, the Read Only " +"item is present in the Actions menu for open note. When this item " +"is checked, note is marked as read-only. This does not allow to change note " +"until the menu item is unchecked. Use this to prevent notes from accidental " +"modification." +msgstr "" + +#. (itstool) path: info/desc +#: C/gnote-addin-replacetitle.page:8 +#, fuzzy +#| msgid "Create new note" +msgid "Rename a note" +msgstr "Skapa ny anteckning" + +#. (itstool) path: page/title +#: C/gnote-addin-replacetitle.page:25 +msgid "Replace title" +msgstr "" + +#. (itstool) path: page/p +#: C/gnote-addin-replacetitle.page:26 +msgid "" +"When the Replace title plugin is installed, the command " +"Replace title is present in the Actions menu." +msgstr "" + +#. (itstool) path: page/p +#: C/gnote-addin-replacetitle.page:27 +msgid "" +"The Replace title command replaces a note's title with the " +"currently selected text (from any application)." +msgstr "" + +#. (itstool) path: page/p +#: C/gnote-addin-replacetitle.page:28 +msgid "" +"Alternatively, you can use the CtrlR " +"shortcut." +msgstr "" + +#. (itstool) path: info/desc +#: C/gnote-addin-specialnotes.page:8 +#, fuzzy +#| msgid "Search notes" +msgid "See special notes" +msgstr "Sök anteckningar" + +#. (itstool) path: page/title +#: C/gnote-addin-specialnotes.page:16 +#, fuzzy +#| msgid "Search All Notes" +msgid "Special Notes" +msgstr "Sök i alla anteckningar" + +#. (itstool) path: page/p +#: C/gnote-addin-specialnotes.page:17 +msgid "" +"When the SpecialNotes plugin is installed, the new special " +"notebook Special Notes is present in the list of notebooks. This " +"notebook contains notes that are otherwise not visible, such as template " +"notes. This might be convenient way to go through all your templates." +msgstr "" + +#. (itstool) path: media +#. This is a reference to an external file such as an image or video. When +#. the file changes, the md5 hash will change to let you know you need to +#. update your localized copy. The msgstr is not used at all. Set it to +#. whatever you like once you have updated your copy of the file. +#: C/gnote-addin-sync-local.page:27 +msgctxt "_" +msgid "" +"external ref='figures/gnote-syncprefs-local.png' " +"md5='283b5e82b7b17fd7dd833594f33d149f'" +msgstr "" + +#. (itstool) path: info/desc +#: C/gnote-addin-sync-local.page:9 +#, fuzzy +#| msgid "Synchronize your notes" +msgid "Synchronize to a local folder" +msgstr "Synkronisera dina anteckningar" + +#. (itstool) path: credit/years +#: C/gnote-addin-sync-local.page:13 C/gnote-addin-sync-webdav.page:13 +#: C/gnote-synchronization.page:12 +msgid "2012" +msgstr "" + +#. (itstool) path: page/title +#: C/gnote-addin-sync-local.page:22 +#, fuzzy +#| msgid "Note Synchronization" +msgid "Local Folder Synchronization" +msgstr "Synkronisering av anteckningar" + +#. (itstool) path: page/p +#: C/gnote-addin-sync-local.page:23 +msgid "" +"This type of synchronization lets you use a local folder as synchronization " +"storage." +msgstr "" + +#. (itstool) path: page/p +#: C/gnote-addin-sync-local.page:24 +msgid "" +"To configure this type of synchronization, select Local Folder in " +"the Service drop-down and then select the desired folder as the " +"Folder Path." +msgstr "" + +#. (itstool) path: figure/title +#: C/gnote-addin-sync-local.page:26 C/gnote-addin-sync-webdav.page:31 +#, fuzzy +#| msgid "Handling synchronization conflicts" +msgid "Local Folder Synchronization configuration" +msgstr "Hantera synkroniseringskonflikter" + +#. (itstool) path: page/p +#: C/gnote-addin-sync-local.page:29 +msgid "" +"After selecting the desired folder, click the Save button. Use " +"the Clear button to turn synchronization off." +msgstr "" + +#. (itstool) path: media +#. This is a reference to an external file such as an image or video. When +#. the file changes, the md5 hash will change to let you know you need to +#. update your localized copy. The msgstr is not used at all. Set it to +#. whatever you like once you have updated your copy of the file. +#: C/gnote-addin-sync-webdav.page:32 +msgctxt "_" +msgid "" +"external ref='figures/gnote-syncprefs-webdav.png' " +"md5='60dfdedccd719fc1b764154ded90f781'" +msgstr "" + +#. (itstool) path: info/desc +#: C/gnote-addin-sync-webdav.page:9 +#, fuzzy +#| msgid "Synchronize Notes" +msgid "Synchronize to a WebDAV share" +msgstr "Synkronisera anteckningar" + +#. (itstool) path: page/title +#: C/gnote-addin-sync-webdav.page:22 +#, fuzzy +#| msgid "Synchronization" +msgid "WebDAV Synchronization" +msgstr "Synkronisering" + +#. (itstool) path: page/p +#: C/gnote-addin-sync-webdav.page:23 +msgid "" +"This type of synchronization lets you use a WebDAV server as synchronization " +"storage." +msgstr "" + +#. (itstool) path: page/p +#: C/gnote-addin-sync-webdav.page:24 +#, fuzzy +#| msgid "Configure note synchronization" +msgid "To configure this type of synchronization:" +msgstr "Konfigurera synkronisering av anteckningar" + +#. (itstool) path: item/p +#: C/gnote-addin-sync-webdav.page:26 +msgid "select \"WebDAV\" in the Service drop-down" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-addin-sync-webdav.page:27 +msgid "enter the URL to your share" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-addin-sync-webdav.page:28 +msgid "enter your username and password" +msgstr "" + +#. (itstool) path: page/p +#: C/gnote-addin-sync-webdav.page:34 +msgid "" +"After selecting the desired folder click the Save button. Use the " +"Clear button to turn synchronization off." +msgstr "" + +#. (itstool) path: media +#. This is a reference to an external file such as an image or video. When +#. the file changes, the md5 hash will change to let you know you need to +#. update your localized copy. The msgstr is not used at all. Set it to +#. whatever you like once you have updated your copy of the file. +#: C/gnote-addin-tableofcontents.page:116 +msgctxt "_" +msgid "" +"external ref='figures/gnote-addin-table-of-contents.png' " +"md5='15b52d64e171a3a03a13f0a2def2f3e3'" +msgstr "" + +#. (itstool) path: license/p +#: C/gnote-addin-tableofcontents.page:42 +msgid "" +"This help topic is licensed under the GNU Free Documentation License, Version 1.1 (GFDL). It means that you are free to copy, distribute and/or modify " +"this document, under some conditions." +msgstr "" + +#. (itstool) path: credit/name +#: C/gnote-addin-tableofcontents.page:51 +msgid "Luc Pionchon" +msgstr "" + +#. (itstool) path: credit/years +#: C/gnote-addin-tableofcontents.page:60 +msgid "2013,2014" +msgstr "" + +#. (itstool) path: info/desc +#: C/gnote-addin-tableofcontents.page:79 +msgid "Navigate long structured notes" +msgstr "" + +#. (itstool) path: page/title +#: C/gnote-addin-tableofcontents.page:83 +#, fuzzy +#| msgid "Table of Contents" +msgid "Adding a Table of Contents" +msgstr "Innehållsförteckning" + +#. (itstool) path: page/desc +#: C/gnote-addin-tableofcontents.page:85 +msgid "Navigate long structured notes" +msgstr "" + +#. (itstool) path: note/p +#: C/gnote-addin-tableofcontents.page:87 +msgid "" +"This is a plugin to Gnotes. When this plugin is installed, there " +"is a Table of Contents entry in the actions menu. See " +" to learn how to activate a plugin." +msgstr "" + +#. (itstool) path: section/title +#: C/gnote-addin-tableofcontents.page:95 +msgid "In a nutshell" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-addin-tableofcontents.page:99 +msgid "" +"A heading is a full line of text, formatted with Bold+Huge or " +"Bold+Large." +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-addin-tableofcontents.page:102 +msgid "" +"Set headings with Ctrl1 or " +"Ctrl2." +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-addin-tableofcontents.page:107 +msgid "" +"Open the table of contents with CtrlAlt1, and jump to any heading." +msgstr "" + +#. (itstool) path: section/title +#: C/gnote-addin-tableofcontents.page:113 +msgid "Screenshot" +msgstr "" + +#. (itstool) path: figure/title +#: C/gnote-addin-tableofcontents.page:115 +msgid "A structured note with its table of contents" +msgstr "" + +#. (itstool) path: section/title +#: C/gnote-addin-tableofcontents.page:122 +msgid "Navigating through long notes" +msgstr "" + +#. (itstool) path: section/p +#: C/gnote-addin-tableofcontents.page:124 +msgid "" +"A long note may become difficult to navigate. It is then natural to " +"structure the note by marking sections and subsections with headings." +msgstr "" + +#. (itstool) path: section/p +#: C/gnote-addin-tableofcontents.page:130 +msgid "" +"This plugin makes it easy to navigate through long structured notes. Once " +"you have set headings in your note, the table of contents of the note will " +"show in actions menu. Then you can jump directly from the menu to any " +"heading." +msgstr "" + +#. (itstool) path: section/title +#: C/gnote-addin-tableofcontents.page:140 +msgid "Structuring your notes with headings" +msgstr "" + +#. (itstool) path: section/p +#: C/gnote-addin-tableofcontents.page:142 +msgid "A heading is simply a complete line with specific text formatting:" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-addin-tableofcontents.page:146 +msgid "" +"Level 1 headings, for sections, are lines formatted with a Bold+Huge font." +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-addin-tableofcontents.page:147 +msgid "" +"Level 2 headings, for subsections, are lines formatted with a Bold" +"+Large font." +msgstr "" + +#. (itstool) path: section/p +#: C/gnote-addin-tableofcontents.page:151 +msgid "To format a heading line, either:" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-addin-tableofcontents.page:155 +msgid "" +"Use the commands Heading 1 and Heading 2 in the " +"ActionsTable of Contents menu." +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-addin-tableofcontents.page:160 +msgid "" +"Use the keyboard shortcuts Ctrl1 and " +"Ctrl2 for headings of level 1 and 2." +msgstr "" + +#. (itstool) path: note/p +#: C/gnote-addin-tableofcontents.page:165 +msgid "" +"These commands apply the formatting to the complete line. You don't need to " +"select it first. It is enough if the cursor is on the line." +msgstr "" + +#. (itstool) path: note/p +#: C/gnote-addin-tableofcontents.page:169 +msgid "" +"Alternatively, with the cursor on a new line, activate the heading command " +"and then enter the heading title." +msgstr "" + +#. (itstool) path: section/p +#: C/gnote-addin-tableofcontents.page:173 +msgid "" +"You can even use the normal formatting commands from the Text " +"menu: Bold, Large and Huge, and their " +"respective keyboard shortcuts. If, for example, your line is already " +"formatted as Huge, then you just need to make it also Bold to turn it into a heading 1. See to " +"learn how to set text styles." +msgstr "" + +#. (itstool) path: section/title +#: C/gnote-addin-tableofcontents.page:182 +#, fuzzy +#| msgid "Table of Contents" +msgid "Showing the table of contents" +msgstr "Innehållsförteckning" + +#. (itstool) path: section/p +#: C/gnote-addin-tableofcontents.page:184 +msgid "You can access the table of contents either:" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-addin-tableofcontents.page:186 +msgid "" +"In the menu ActionsTable of Contents." +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-addin-tableofcontents.page:187 +msgid "" +"In context menuTable of Contents " +"(right-click on the note window)." +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-addin-tableofcontents.page:188 +msgid "" +"In a popup menu, with the keyboard shortcut CtrlAlt1." +msgstr "" + +#. (itstool) path: list/p +#: C/gnote-addin-tableofcontents.page:189 +msgid "" +"Then you can navigate up and down with the arrow keys and jump to the " +"selected heading with enter. Or just click with your mouse on the " +"heading to jump to." +msgstr "" + +#. (itstool) path: section/title +#: C/gnote-addin-tableofcontents.page:195 +msgid "Troubleshooting" +msgstr "" + +#. (itstool) path: item/title +#: C/gnote-addin-tableofcontents.page:197 +msgid "" +"One heading does not show in the table of contents" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-addin-tableofcontents.page:197 +msgid "" +"There might be some characters in the heading line, such as whitespace " +"characters, which are not formatted as a heading. Make sure that the " +"whole line is formatted as a heading. See ." +msgstr "" + +#. (itstool) path: item/title +#: C/gnote-addin-tableofcontents.page:200 +msgid "" +"There is an empty line in the table of contents" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-addin-tableofcontents.page:200 +msgid "" +"An empty line, possibly including whitespaces, is formatted as a heading. " +"Jump to this line and delete the area." +msgstr "" + +#. (itstool) path: info/desc +#: C/gnote-addin-timestamp.page:9 +msgid "Insert current time" +msgstr "" + +#. (itstool) path: page/title +#: C/gnote-addin-timestamp.page:26 +msgid "Insert Timestamp Add-in" +msgstr "" + +#. (itstool) path: page/p +#: C/gnote-addin-timestamp.page:28 +msgid "" +"When the Insert Timestamp plugin is installed, the Actions menu will include a Insert Timestamp command. Select this " +"command to insert the current date and time." +msgstr "" + +#. (itstool) path: info/desc +#: C/gnote-addin-underline.page:8 +msgid "Underline text" +msgstr "" + +#. (itstool) path: page/title +#: C/gnote-addin-underline.page:25 +msgid "Underline Text Add-In" +msgstr "" + +#. (itstool) path: page/p +#: C/gnote-addin-underline.page:26 +#, fuzzy +#| msgid "" +#| "When this add-in is installed, the Tools " +#| "menu will have the Print option available." +msgid "" +"When the Underline plugin is installed, the Text menu " +"will have a Underline option available." +msgstr "" +"När det här tillägget är installerat kommer menyn Verktyg att ha alternativet Skriv ut " +"tillgängligt." + +#. (itstool) path: page/p +#: C/gnote-addin-underline.page:27 +#, fuzzy +#| msgid "End a bulleted list by doing one of the following:" +msgid "To underline the selected text, use one of the following:" +msgstr "Avsluta en punktlista genom att göra ett av följande alternativ:" + +#. (itstool) path: item/p +#: C/gnote-addin-underline.page:29 C/gnote-addin-underline.page:34 +msgid "Click on Text and select Underline." +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-addin-underline.page:30 C/gnote-addin-underline.page:35 +msgid "Press CtrlU." +msgstr "" + +#. (itstool) path: page/p +#: C/gnote-addin-underline.page:32 +msgid "" +"To remove underline, select the underlined text and use one of the following:" +msgstr "" + +#. (itstool) path: info/desc +#: C/gnote-bulleted-lists.page:8 +#, fuzzy +#| msgid "Bulleted Lists" +msgid "Using Bulleted Lists" +msgstr "Punktlistor" + +#. (itstool) path: page/title +#: C/gnote-bulleted-lists.page:25 +msgid "Bulleted Lists" +msgstr "Punktlistor" + +#. (itstool) path: section/title +#: C/gnote-bulleted-lists.page:27 +msgid "Begin a bulleted list" +msgstr "Påbörja en punktlista" + +#. (itstool) path: section/p +#: C/gnote-bulleted-lists.page:28 +#, fuzzy +#| msgid "You may begin a bulleted list by using one of the following methods:" +msgid "You may begin a bulleted list in any of the following ways:" +msgstr "Du kan påbörja en punktlista genom att använda en av följande metoder:" + +#. (itstool) path: item/p +#: C/gnote-bulleted-lists.page:30 C/gnote-bulleted-lists.page:39 +#, fuzzy +#| msgid "" +#| "Select Bullets from " +#| "the Text menu." +msgid "Select Bullets from the Text menu." +msgstr "" +"Välj Punkter från menyn " +"Text." + +#. (itstool) path: item/p +#: C/gnote-bulleted-lists.page:31 +#, fuzzy +#| msgid "" +#| "Begin a line with a single dash character (-), type some text immediately " +#| "following the dash, and press Enter." +msgid "" +"Begin a line with a single dash character - followed by a space. " +"Then type some text and press Enter." +msgstr "" +"Börja en rad med ett minustecken (-), skriv lite text efter minustecknet och " +"tryck på Enter." + +#. (itstool) path: item/p +#: C/gnote-bulleted-lists.page:32 C/gnote-bulleted-lists.page:54 +#, fuzzy +#| msgid "" +#| "Press the key combination ShiftTab." +msgid "" +"Press the key combination AltRight." +msgstr "" +"Tryck tangentkombinationen Alttabulator." + +#. (itstool) path: section/title +#: C/gnote-bulleted-lists.page:36 +msgid "End a bulleted list" +msgstr "Avsluta en punktlista" + +#. (itstool) path: section/p +#: C/gnote-bulleted-lists.page:37 +#, fuzzy +#| msgid "End a bulleted list by doing one of the following:" +msgid "You can end a bulleted list by doing one of the following:" +msgstr "Avsluta en punktlista genom att göra ett av följande alternativ:" + +#. (itstool) path: item/p +#: C/gnote-bulleted-lists.page:40 +#, fuzzy +#| msgid "Press Enter on a blank bulleted line." +msgid "Press Enter on a blank bulleted line." +msgstr "Tryck på Enter på en tom punktrad." + +#. (itstool) path: item/p +#: C/gnote-bulleted-lists.page:41 +#, fuzzy +#| msgid "" +#| "Select Decrease Indent from the Text menu in succession until " +#| "the current line is no longer part of the bulleted list." +msgid "" +"Select Decrease Indent from the Text menu in succession until the " +"current line is no longer part of the bulleted list." +msgstr "" +"Välj Minska indragning " +"från menyn Text i följd tills den aktuella raden inte " +"längre är en del av punktlistan." + +#. (itstool) path: item/p +#: C/gnote-bulleted-lists.page:42 +#, fuzzy +#| msgid "" +#| "Using the key combination ShiftTab in succession until the current line is no longer part " +#| "of the bulleted list." +msgid "" +"Press ShiftTab repeatedly until the " +"current line is no longer part of the bulleted list." +msgstr "" +"Använd tangentkombinationen Skifttabulator i följd tills den aktuella " +"raden inte längre är en del av punktlistan." + +#. (itstool) path: item/p +#: C/gnote-bulleted-lists.page:43 +#, fuzzy +#| msgid "" +#| "Using the key combination ShiftTab in succession until the current line is no longer part " +#| "of the bulleted list." +msgid "" +"Press AltLeft repeatedly until the " +"current line is no longer part of the bulleted list." +msgstr "" +"Använd tangentkombinationen Skifttabulator i följd tills den aktuella " +"raden inte längre är en del av punktlistan." + +#. (itstool) path: section/title +#: C/gnote-bulleted-lists.page:48 +msgid "Increase Indentation" +msgstr "Öka indragning" + +#. (itstool) path: section/p +#: C/gnote-bulleted-lists.page:49 +msgid "To increase the line indentation in a bulleted list with the mouse:" +msgstr "För att öka radindragningen i en punktlista med musen:" + +#. (itstool) path: item/p +#: C/gnote-bulleted-lists.page:50 +#, fuzzy +#| msgid "" +#| "Select Increase Indent from the Text menu." +msgid "Select Increase Indent from the Text menu." +msgstr "" +"Välj Öka indragning från " +"menyn Text." + +#. (itstool) path: section/p +#: C/gnote-bulleted-lists.page:51 +msgid "To increase the line indentation in a bulleted list with the keyboard:" +msgstr "För att öka radindragningen i en punktlista med tangentbordet:" + +#. (itstool) path: item/p +#: C/gnote-bulleted-lists.page:53 +#, fuzzy +#| msgid "Press the Tab key." +msgid "Press the Tab key." +msgstr "Tryck på tabulatortangenten." + +#. (itstool) path: section/title +#: C/gnote-bulleted-lists.page:59 +msgid "Decrease Indentation" +msgstr "Minska indragning" + +#. (itstool) path: section/p +#: C/gnote-bulleted-lists.page:60 +msgid "To decrease the line indentation in a bulleted list with the mouse:" +msgstr "För att minska radindragningen i en punktlista med musen:" + +#. (itstool) path: item/p +#: C/gnote-bulleted-lists.page:61 +#, fuzzy +#| msgid "" +#| "Select Decrease Indent from the Text menu." +msgid "Select Decrease Indent from the Text menu." +msgstr "" +"Välj Minska indragning " +"från menyn Text." + +#. (itstool) path: section/p +#: C/gnote-bulleted-lists.page:62 +msgid "To decrease the line indentation in a bulleted list with the keyboard:" +msgstr "För att minska radindragningen i en punktlista med tangentbordet:" + +#. (itstool) path: item/p +#: C/gnote-bulleted-lists.page:64 +#, fuzzy +#| msgid "" +#| "Press the key combination ShiftTab." +msgid "" +"Press the key combination ShiftTab." +msgstr "" +"Tryck tangentkombinationen Alttabulator." + +#. (itstool) path: item/p +#: C/gnote-bulleted-lists.page:65 +#, fuzzy +#| msgid "" +#| "Press the key combination ShiftTab." +msgid "" +"Press the key combination AltLeft." +msgstr "" +"Tryck tangentkombinationen Alttabulator." + +#. (itstool) path: info/desc +#: C/gnote-common-problems.page:9 +msgid "Frequently asked questions" +msgstr "" + +#. (itstool) path: credit/years +#: C/gnote-common-problems.page:16 +msgid "2011-2014" +msgstr "" + +#. (itstool) path: page/title +#: C/gnote-common-problems.page:25 +#, fuzzy +#| msgid "Gnote Notes" +msgid "Gnote Common Issues" +msgstr "Gnote-anteckningar" + +#. (itstool) path: item/title +#: C/gnote-common-problems.page:27 +msgid "Does Gnote work with Tomboy?" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-common-problems.page:27 +msgid "You can import Tomboy Notes. A plugin has to be activated." +msgstr "" + +#. (itstool) path: item/title +#: C/gnote-common-problems.page:29 +msgid "I can't find the Gnote status icon." +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-common-problems.page:30 +msgid "" +"You can activate the Gnote status icon in Gnote Preferences " +"dialog." +msgstr "" + +#. (itstool) path: item/title +#: C/gnote-common-problems.page:31 +msgid "How to automatically start Gnote when I log in?" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-common-problems.page:32 +msgid "" +"To start Gnote automatically when you log into GNOME, run gnome-session-" +"properties." +msgstr "" + +#. (itstool) path: item/title +#: C/gnote-common-problems.page:34 +msgid "I'm not comfortable with new single-window interface" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-common-problems.page:34 +msgid "" +"You can make Gnote behave the old way by selecting Always " +"open notes in new window in Preferences dialog." +msgstr "" + +#. (itstool) path: info/desc +#: C/gnote-creating-notes.page:9 +#, fuzzy +#| msgid "Creating Notes" +msgid "Creating notes" +msgstr "Skapa anteckningar" + +#. (itstool) path: credit/years +#: C/gnote-creating-notes.page:16 C/gnote-deleting-notes.page:16 +#: C/gnote-introduction.page:17 C/gnote-template-notes.page:13 +#: C/gnote-working-with-notebooks.page:17 +msgid "2011-2012" +msgstr "" + +#. (itstool) path: page/title +#: C/gnote-creating-notes.page:25 +msgid "Creating Notes" +msgstr "Skapa anteckningar" + +#. (itstool) path: page/p +#: C/gnote-creating-notes.page:27 +msgid "In Gnote, you can create new notes in any of these ways:" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-creating-notes.page:29 +msgid "Select New Note in the application menu." +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-creating-notes.page:30 +msgid "In the Gnote window, click the toolbar item New." +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-creating-notes.page:31 +msgid "" +"In the main window, right click in the note list and select New. " +"This will create a note in the currently selected notebook." +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-creating-notes.page:32 +msgid "" +"If the status icon is enabled, click on it and select New Note." +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-creating-notes.page:33 +msgid "Use the keyboard shortcut CtrlN." +msgstr "" + +#. (itstool) path: info/desc +#: C/gnote-deleting-notes.page:9 +#, fuzzy +#| msgid "Deleting a Notebook" +msgid "Deleting notes" +msgstr "Ta bort ett anteckningsblock" + +#. (itstool) path: page/title +#: C/gnote-deleting-notes.page:25 +#, fuzzy +#| msgid "Deleting a Notebook" +msgid "Deleting Notes" +msgstr "Ta bort ett anteckningsblock" + +#. (itstool) path: page/p +#: C/gnote-deleting-notes.page:26 +#, fuzzy +#| msgid "You can delete a notebook you have created by one of two methods:" +msgid "You can delete a note in either of two ways:" +msgstr "" +"Du kan ta bort ett anteckningsblock som du har skapat med en av följande " +"metoder:" + +#. (itstool) path: item/p +#: C/gnote-deleting-notes.page:28 +msgid "" +"Right click in the list of notes and select Delete. This will " +"delete all selected notes." +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-deleting-notes.page:29 +msgid "When a note is open, press the Delete button on the toolbar." +msgstr "" + +#. (itstool) path: page/p +#: C/gnote-deleting-notes.page:31 +#, fuzzy +#| msgid "" +#| "The Delete button will pop up a dialog box asking " +#| "if you want to permanently delete the note and its contents. Click the " +#| "Delete button to discard the note permanently, or " +#| "Cancel to abort the process. Links to this note " +#| "from other notes will still exist, but will re-create the note upon " +#| "activation." +msgid "" +"In both cases a dialog box will pop up asking if you want to permanently " +"delete the note and its contents. Click the Delete button to " +"discard the note permanently, or Cancel to abort. Links to the " +"deleted note from other notes will still exist, but will re-create the note " +"upon activation." +msgstr "" +"Knappen Ta bort kommer att visa en dialogruta som " +"frågar dig om du vill permanent ta bort anteckningen och dess innehåll. " +"Klicka på knappen Ta bort för att förkasta " +"anteckningen permanent, eller Avbryt för att avbryta " +"processen. Länkar till den här anteckningen från andra anteckningar kommer " +"fortfarande att finnas, men kommer att återskapa anteckningen vid aktivering." + +#. (itstool) path: media +#. This is a reference to an external file such as an image or video. When +#. the file changes, the md5 hash will change to let you know you need to +#. update your localized copy. The msgstr is not used at all. Set it to +#. whatever you like once you have updated your copy of the file. +#: C/gnote-editing-notes.page:30 +msgctxt "_" +msgid "" +"external ref='figures/gnote-new-note.png' " +"md5='722aeec3c4f00089d2b8a3884e7559dc'" +msgstr "" + +#. (itstool) path: info/desc +#: C/gnote-editing-notes.page:7 +#, fuzzy +#| msgid "Editing Notes" +msgid "Editing note contents" +msgstr "Redigera anteckningar" + +#. (itstool) path: credit/years +#: C/gnote-editing-notes.page:14 C/gnote-hotkeys.page:16 +#: C/gnote-notes-preferences.page:17 C/gnote-searching-notes.page:16 +msgid "2011-2013" +msgstr "" + +#. (itstool) path: page/title +#: C/gnote-editing-notes.page:23 +msgid "Editing Notes" +msgstr "Redigera anteckningar" + +#. (itstool) path: page/p +#: C/gnote-editing-notes.page:25 +msgid "" +"When you open a note, Gnote will replace the note overview with " +"the note's contents." +msgstr "" + +#. (itstool) path: page/p +#: C/gnote-editing-notes.page:26 +msgid "" +"Toolbar at the top of the window will now contain note specific items in it. " +"Bellow toolbar is the note's content area." +msgstr "" + +#. (itstool) path: figure/title +#: C/gnote-editing-notes.page:28 +msgid "Gnote window displaying note" +msgstr "" + +#. (itstool) path: figure/desc +#: C/gnote-editing-notes.page:29 +#, fuzzy +#| msgid "Gnote Notes" +msgid "Gnote Note" +msgstr "Gnote-anteckningar" + +#. (itstool) path: media/p +#: C/gnote-editing-notes.page:31 +msgid "Gnote note editing." +msgstr "" + +#. (itstool) path: page/p +#: C/gnote-editing-notes.page:35 +msgid "" +"To edit the note, click in the content area and type. The first line is " +"considered the title of the note. By default this is populated with the text " +"\"New Note (number)\". To change the title, click on the first line and use " +"the keyboard to change the title." +msgstr "" + +#. (itstool) path: page/p +#: C/gnote-editing-notes.page:36 +msgid "" +"Use the Text button to format text within your notes. This button " +"displays a menu with several commands:" +msgstr "" + +#. (itstool) path: item/title +#: C/gnote-editing-notes.page:39 +msgid "Undo" +msgstr "Ångra" + +#. (itstool) path: item/p +#: C/gnote-editing-notes.page:40 +#, fuzzy +#| msgid "" +#| "Support for Undo is available in Gnote through this menu " +#| "item. The Undo function allows you to revert previous changes made to " +#| "your note during the current session. To undo your last change using the " +#| "keyboard, use the standard keybinding, CtrlZ." +msgid "" +"The Undo command reverts changes made to your note during the " +"current session. To undo using the keyboard, press CtrlZ." +msgstr "" +"Stöd för Ångra är tillgängligt i Gnote genom det här " +"menyobjektet. Funktionen Ångra låter dig ångra tidigare ändringar som har " +"gjorts till din anteckning under den aktuella sessionen. För att ångra din " +"senaste ändring med tangentbordet, använd standardtangentkombinationen, " +"CtrlZ." + +#. (itstool) path: item/title +#: C/gnote-editing-notes.page:42 +msgid "Redo" +msgstr "Gör om" + +#. (itstool) path: item/p +#: C/gnote-editing-notes.page:43 +#, fuzzy +#| msgid "" +#| "The Redo function is used to put back changes that were " +#| "removed using the Undo feature. To redo your last change " +#| "using the keyboard, use the standard keybinding, ShiftCtrlZ." +msgid "" +"The Redo command puts back changes that were removed using the " +"Undo feature. To redo your last change using the keyboard, press " +"ShiftCtrlZ." +msgstr "" +"Funktionen Gör om används för att lägga tillbaka ändringar " +"som togs bort med funktionen Ångra. För att göra om din " +"senaste ändring med tangentbordet, använd standardtangentkombinationen, " +"SkiftCtrlZ." + +#. (itstool) path: item/title +#: C/gnote-editing-notes.page:45 +msgid "Bold" +msgstr "Fet" + +#. (itstool) path: item/p +#: C/gnote-editing-notes.page:46 +msgid "" +"To make text bold, select it and then select the Bold command " +"from the Text menu or press CtrlB." +msgstr "" + +#. (itstool) path: item/title +#: C/gnote-editing-notes.page:48 +msgid "Italic" +msgstr "Kursiv" + +#. (itstool) path: item/p +#: C/gnote-editing-notes.page:49 +msgid "" +"To make text italic, select it and then select the Italic " +"command from the Text menu, or press CtrlI." +msgstr "" + +#. (itstool) path: item/title +#: C/gnote-editing-notes.page:51 +msgid "Strikeout" +msgstr "Genomstruken" + +#. (itstool) path: item/p +#: C/gnote-editing-notes.page:52 +#, fuzzy +#| msgid "" +#| "The strikeout style will put a line through the selected text. To add a " +#| "strikeout, select the text and then select the " +#| "Strikeout option from " +#| "the Text menu. You may also use the keybinding " +#| "CtrlS after " +#| "selecting the text." +msgid "" +"The strikeout style will put a line through the selected text. To add a " +"strikeout, select text and then select the Strikeout command from " +"the Text menu or press CtrlS." +msgstr "" +"Stilen genomstruken kommer att lägga en linje genom den markerade texten. " +"För att lägga till en genomstrykning, markera texten och välj sedan " +"alternativet Genomstruken från menyn Text. Du kan även använda " +"tangentkombinationen CtrlS efter att texten har markerats." + +#. (itstool) path: item/title +#: C/gnote-editing-notes.page:54 +msgid "Highlight" +msgstr "Färgmarkera" + +#. (itstool) path: item/p +#: C/gnote-editing-notes.page:55 +#, fuzzy +#| msgid "" +#| "The highlight style will put a yellow background around the selected " +#| "text. To add a highlight, select the text and then select the " +#| "Highlight option from " +#| "the Text menu. You may also use the keybinding " +#| "CtrlH after " +#| "selecting the text." +msgid "" +"The highlight style will put a different background around the selected " +"text. To add a highlight, select text and then select the Highlight command from the Text menu or press CtrlH." +msgstr "" +"Stilen färgmarkera kommer att lägga en gul bakgrund runt den markerade " +"texten. För att lägga till en färgmarkering, markera texten och välj sedan " +"alternativet Färgmarkera " +"från menyn Text. Du kan även använda " +"tangentkombinationen CtrlH efter att texten har markerats." + +#. (itstool) path: item/title +#: C/gnote-editing-notes.page:57 +msgid "Font size" +msgstr "Typsnittsstorlek" + +#. (itstool) path: item/p +#: C/gnote-editing-notes.page:58 +#, fuzzy +#| msgid "" +#| "There are actually four options in this part of the menu: . Each one of these options represents a font size to use for the " +#| "selected text in the note. To modify the font size, select the text and " +#| "then select one of options from the Text menu." +msgid "" +"There are actually four options in this part of the menu: Small, Normal, " +"Large, and Huge. Each option represents a font size to use for the selected " +"text. To modify the font size, select text and then select Small, " +"Normal, Large, or Huge." +msgstr "" +"Det finns faktiskt fyra alternativ i den här delen av menyn: . Varje alternativ representerar en typsnittsstorlek som kan användas för " +"den markerade texten i anteckningen. För att ändra typsnittsstorleken, " +"markera texten och välj sedan ett av alternativen från " +"menyn Text." + +#. (itstool) path: item/title +#: C/gnote-editing-notes.page:60 +msgid "Bullets" +msgstr "Punkter" + +#. (itstool) path: item/p +#: C/gnote-editing-notes.page:61 +#, fuzzy +#| msgid "" +#| "Select the Bullets " +#| "option from the Text menu to begin or end a " +#| "bulleted list. If the cursor is inside a bulleted list, the " +#| " options will be enabled." +msgid "" +"Select the Bullets command from the Text menu to begin or end a " +"bulleted list. If the cursor is inside a bulleted list, the Increase " +"Indent and Decrease Indent options will be enabled." +msgstr "" +"Välj alternativet Punkter från menyn Text för att påbörja eller " +"avsluta en punktlista. Om markören är inne i en punktlista kommer " +"alternativet att aktiveras." + +#. (itstool) path: item/p +#: C/gnote-editing-notes.page:62 +#, fuzzy +#| msgid "" +#| "With the cursor on a bulleted list line, select the " +#| "Increase Indent " +#| "option to shift the current line to the right or the " +#| "Decrease Indent " +#| "option to shift the current line to the left." +msgid "" +"With the cursor on a bulleted list line, select the Increase Indent command to shift the current line to the right or the Decrease " +"Indent command to shift to the left." +msgstr "" +"Med markören på en rad i punktlistan, välj alternativet " +"Öka indragning för att " +"dra den aktuella raden till höger eller alternativet " +"Minska indragning för " +"att dra den aktuella raden till vänster." + +#. (itstool) path: item/p +#: C/gnote-editing-notes.page:63 +#, fuzzy +#| msgid "For more information on bullets, see ." +msgid "For more information on bullets, see ." +msgstr "För mer information om punkter, se ." + +#. (itstool) path: page/p +#: C/gnote-editing-notes.page:66 +msgid "" +"The toolbar at the top of note has search button. Use it to search for text " +"within the current note. A small find bar will appear above the note. To " +"open the find bar using the keyboard, press CtrlF. Enter the text to find and press Enter. Matches " +"will be highlighted. Click Next to highlight the next match and " +"place the cursor there. Click Previous to move to the previous " +"match. To close the find bar, click the search button again or press the " +"Escape key." +msgstr "" + +#. (itstool) path: section/title +#: C/gnote-editing-notes.page:70 +msgid "Rich Note Content" +msgstr "" + +#. (itstool) path: media +#. This is a reference to an external file such as an image or video. When +#. the file changes, the md5 hash will change to let you know you need to +#. update your localized copy. The msgstr is not used at all. Set it to +#. whatever you like once you have updated your copy of the file. +#: C/gnote-hotkeys.page:38 +#, fuzzy +#| msgid "" +#| "@@image: 'figures/gnote-preferences-hotkeys.png'; " +#| "md5=57510249057a144dbb81ae35e15c694c" +msgctxt "_" +msgid "" +"external ref='figures/gnote-preferences-hotkeys.png' " +"md5='9d159b4e82cad633bf68e8e4a3524950'" +msgstr "" +"@@image: 'figures/gnote-preferences-hotkeys.png'; " +"md5=57510249057a144dbb81ae35e15c694c" + +#. (itstool) path: info/desc +#: C/gnote-hotkeys.page:8 +#, fuzzy +#| msgid "Gnote Hotkey Preferences" +msgid "Gnote hotkey settings" +msgstr "Snabbtangentinställningar för Gnote" + +#. (itstool) path: page/title +#: C/gnote-hotkeys.page:25 +msgid "Hotkeys" +msgstr "Snabbtangenter" + +#. (itstool) path: page/p +#: C/gnote-hotkeys.page:26 +msgid "" +"This tab is only available if Gnote was buit with X11 support." +msgstr "" + +#. (itstool) path: page/p +#: C/gnote-hotkeys.page:27 +#, fuzzy +#| msgid "" +#| "The hotkeys tab allows you to set global key combinations to perform " +#| "different functions in Gnote. In order to set key combinations, you must " +#| "have the Listen for Hotkeys checkbox enabled. Use " +#| "AltH to toggle " +#| "this option." +msgid "" +"The hotkeys tab lets you set global key combinations to perform " +"different functions in Gnote. In order to set key combinations, " +"you must have the Listen for hotkeys checkbox enabled." +msgstr "" +"Snabbtangentsfliken låter dig ställa in allmänna tangentkombinationer för " +"att genomföra olika funktioner i Gnote. För att ställa in " +"tangentkombinationer måste du kryssa i rutan Lyssna efter " +"snabbtangenter. Använd AltH för att växla det här alternativet." + +#. (itstool) path: item/title +#: C/gnote-hotkeys.page:29 +msgid "Show notes menu" +msgstr "Visa anteckningsmeny" + +#. (itstool) path: item/p +#: C/gnote-hotkeys.page:29 +#, fuzzy +#| msgid "Enter the key combination to open the notes menu." +msgid "Enter a key combination for opening the notes menu." +msgstr "Ange tangentkombinationen för att öppna anteckningsmenyn." + +#. (itstool) path: item/title +#: C/gnote-hotkeys.page:30 +msgid "Open \"Start Here\"" +msgstr "Öppna \"Börja här\"" + +#. (itstool) path: item/p +#: C/gnote-hotkeys.page:30 +#, fuzzy +#| msgid "" +#| "Enter the key combination to open the Start Here note, " +#| "which is preinstalled with Gnote." +msgid "" +"Enter a key combination for opening the “Start Here” note, which is " +"preinstalled with Gnote." +msgstr "" +"Ange tangentkombinationen för att öppna anteckningen Börja här, vilken är förinstallerad med Gnote." + +#. (itstool) path: item/title +#: C/gnote-hotkeys.page:31 +#, fuzzy +#| msgid "Create new note" +msgid "Create New Note" +msgstr "Skapa ny anteckning" + +#. (itstool) path: item/p +#: C/gnote-hotkeys.page:31 +#, fuzzy +#| msgid "Enter the key combination to create a new note." +msgid "Enter a key combination for creating a new note." +msgstr "Ange tangentkombinationen för att skapa en ny anteckning." + +#. (itstool) path: item/title +#: C/gnote-hotkeys.page:32 +#, fuzzy +#| msgid "Search All Notes" +msgid "Open \"Search All Notes\"" +msgstr "Sök i alla anteckningar" + +#. (itstool) path: item/p +#: C/gnote-hotkeys.page:32 +#, fuzzy +#| msgid "Enter the key combination to open the notes menu." +msgid "Enter a key combination for opening a search." +msgstr "Ange tangentkombinationen för att öppna anteckningsmenyn." + +#. (itstool) path: figure/title +#: C/gnote-hotkeys.page:36 +msgid "Hotkeys Preferences window" +msgstr "" + +#. (itstool) path: figure/desc +#: C/gnote-hotkeys.page:37 +msgid "Gnote hotkeys" +msgstr "" + +#. (itstool) path: media/p +#: C/gnote-hotkeys.page:39 +msgid "Setting up Gnote keyboard shortcuts." +msgstr "" + +#. (itstool) path: media +#. This is a reference to an external file such as an image or video. When +#. the file changes, the md5 hash will change to let you know you need to +#. update your localized copy. The msgstr is not used at all. Set it to +#. whatever you like once you have updated your copy of the file. +#: C/gnote-introduction.page:39 +msgctxt "_" +msgid "" +"external ref='figures/gnote-search-all-notes.png' " +"md5='5832cb5b5ce3e0f70f07af37b10599b6'" +msgstr "" + +#. (itstool) path: info/desc +#: C/gnote-introduction.page:9 +msgid "Introduction to Gnote" +msgstr "" + +#. (itstool) path: page/title +#: C/gnote-introduction.page:26 +#, fuzzy +#| msgid "Introduction" +msgid "Gnote Introduction" +msgstr "Introduktion" + +#. (itstool) path: page/p +#: C/gnote-introduction.page:27 +#, fuzzy +#| msgid "" +#| "Gnote is a desktop note-taking application for GNOME. It is simple and " +#| "easy to use, and allows you to organize the ideas and information you " +#| "deal with every day. Gnote has some very useful editing features to help " +#| "you customize your notes, including:" +msgid "" +"Gnote is a desktop note-taking application for GNOME. It is " +"simple and easy to use, and lets you organize the ideas and information you " +"deal with every day. Gnote has useful editing features to help you customize " +"your notes, including" +msgstr "" +"Gnote är ett enkelt anteckningsblock för GNOME. Det är enkelt och lätt att " +"använda och låter dig organisera dina ideér och tankar som du hanterar varje " +"dag. Gnote har några mycket användbara redigeringsfunktioner för att hjälpa " +"dig att anpassa dina anteckningar, inklusive:" + +#. (itstool) path: item/p +#: C/gnote-introduction.page:29 +#, fuzzy +#| msgid "Highlighting Search Text" +msgid "highlighting search text" +msgstr "Färgmarkera söktext" + +#. (itstool) path: item/p +#: C/gnote-introduction.page:30 +#, fuzzy +#| msgid "Inline Spell Checking" +msgid "inline spell checking" +msgstr "Stavningskontroll" + +#. (itstool) path: item/p +#: C/gnote-introduction.page:31 +#, fuzzy +#| msgid "Auto-linking Web & Email Addresses" +msgid "auto-linking web and email addresses" +msgstr "Automatisk länkning av webb- och e-postadresser" + +#. (itstool) path: item/p +#: C/gnote-introduction.page:32 +msgid "undo/redo" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-introduction.page:33 +#, fuzzy +#| msgid "Font Styling & Sizing" +msgid "font styling and sizing" +msgstr "Olika stilar och storlekar för typsnitt" + +#. (itstool) path: item/p +#: C/gnote-introduction.page:34 +#, fuzzy +#| msgid "Bulleted Lists" +msgid "bulleted lists" +msgstr "Punktlistor" + +#. (itstool) path: figure/title +#. (itstool) path: figure/desc +#: C/gnote-introduction.page:37 C/gnote-introduction.page:38 +msgid "The Gnote main window" +msgstr "" + +#. (itstool) path: media/p +#: C/gnote-introduction.page:40 +msgid "The Gnote main window." +msgstr "" + +#. (itstool) path: info/desc +#: C/gnote-links.page:9 +#, fuzzy +#| msgid "Working With Notes" +msgid "Linking to other notes" +msgstr "Arbeta med anteckningar" + +#. (itstool) path: page/title +#: C/gnote-links.page:25 +#, fuzzy +#| msgid "Link" +msgid "Links" +msgstr "Länk" + +#. (itstool) path: page/p +#: C/gnote-links.page:26 +#, fuzzy +#| msgid "" +#| "The Link button allows you to create a link to a " +#| "new note from within the current note. For example, if your note contains " +#| "the phrase FinalExam, you can select this text with the " +#| "mouse and click the Link button to create a new " +#| "note with the title FinalExam. A link will also be created " +#| "in the current note that can be clicked to open the new FinalExam note." +msgid "" +"The Link button creates a link to a new note from within the " +"current note. For example, if your note contains the phrase “FinalExam”, you " +"can select this text and click the Link button to create a new " +"note called “FinalExam”. The selected text will become a clickable link to " +"this new note." +msgstr "" +"Knappen Länk låter dig skapa en länk till en ny " +"anteckning innefrån den aktuella anteckningen. Till exempel, om din " +"anteckning innehåller frasen Matematikprov, kan du markera " +"den här texten med musen och klicka på knappen Länk " +"för att skapa en ny anteckning med titeln Matematikprov. En " +"länk kommer även att skapas i den aktuella anteckningen som kan man kan " +"klicka på för att öppna den nya anteckningen Matematikprov." + +#. (itstool) path: note/p +#: C/gnote-links.page:28 +#, fuzzy +#| msgid "" +#| "Changing the title of a note will update links present in other notes. " +#| "This prevents broken links from occurring when a note is renamed." +msgid "" +"Changing a note's title will update links present in other notes. This " +"prevents broken links from occurring when a note is renamed." +msgstr "" +"Ändring av titeln för en anteckning kommer att uppdatera länkarna som finns " +"i andra anteckningar. Det här förhindrar att trasiga länkar förekommer när " +"en anteckning byter namn." + +#. (itstool) path: section/title +#: C/gnote-links.page:30 +#, fuzzy +#| msgid "Backlinks" +msgid "Backlinks Add-in" +msgstr "Bakåtlänkar" + +#. (itstool) path: section/p +#: C/gnote-links.page:31 +msgid "" +"When the Backlinks plugin is installed, the Actions " +"menu will contain an item What links here?, which provides a sub-" +"menu listing all notes containing a link to the current note." +msgstr "" + +#. (itstool) path: media +#. This is a reference to an external file such as an image or video. When +#. the file changes, the md5 hash will change to let you know you need to +#. update your localized copy. The msgstr is not used at all. Set it to +#. whatever you like once you have updated your copy of the file. +#: C/gnote-notes-preferences.page:41 +#, fuzzy +#| msgid "" +#| "@@image: 'figures/gnote-preferences-editing.png'; " +#| "md5=288184a8d9645881eaf3173892583d73" +msgctxt "_" +msgid "" +"external ref='figures/gnote-preferences-editing.png' " +"md5='e927c4921c89e274fddc0bbac7cdee25'" +msgstr "" +"@@image: 'figures/gnote-preferences-editing.png'; " +"md5=288184a8d9645881eaf3173892583d73" + +#. (itstool) path: media +#. This is a reference to an external file such as an image or video. When +#. the file changes, the md5 hash will change to let you know you need to +#. update your localized copy. The msgstr is not used at all. Set it to +#. whatever you like once you have updated your copy of the file. +#: C/gnote-notes-preferences.page:58 +msgctxt "_" +msgid "" +"external ref='figures/gnote-syncprefs-advanced.png' " +"md5='6ad4dea34c8852eb4218c4957fab3e0a'" +msgstr "" + +#. (itstool) path: info/desc +#: C/gnote-notes-preferences.page:9 +#, fuzzy +#| msgid "Gnote Notes" +msgid "Gnote settings" +msgstr "Gnote-anteckningar" + +#. (itstool) path: page/title +#: C/gnote-notes-preferences.page:26 +#, fuzzy +#| msgid "Gnote Hotkey Preferences" +msgid "Gnote Preferences" +msgstr "Snabbtangentinställningar för Gnote" + +#. (itstool) path: section/title +#: C/gnote-notes-preferences.page:28 +#, fuzzy +#| msgid "Preferences" +msgid "General preferences" +msgstr "Inställningar" + +#. (itstool) path: section/p +#: C/gnote-notes-preferences.page:29 +msgid "" +"To set preferences for Gnote, select Preferences from " +"the application menu." +msgstr "" + +#. (itstool) path: section/p +#: C/gnote-notes-preferences.page:30 +msgid "" +"There are three categories of preferences, General, Hotkeys and Add-Ins." +msgstr "" + +#. (itstool) path: section/p +#: C/gnote-notes-preferences.page:31 +#, fuzzy +#| msgid "" +#| "The editing tab will allow you to set preferences related to editing " +#| "notes. There are three checkboxes on this tab, which can either be turned " +#| "on or off." +msgid "" +"The General tab lets you set preferences related to application " +"behaviour and editing notes. There are a few checkboxes on this tab:" +msgstr "" +"Redigeringsfliken låter dig ställa in inställningar relaterade till " +"redigering av anteckningar. Det finns tre kryssrutor i den här fliken som " +"antingen kan aktiveras eller inaktiveras." + +#. (itstool) path: item/title +#: C/gnote-notes-preferences.page:33 +#, fuzzy +#| msgid "Use Custom Font" +msgid "Use status icon" +msgstr "Använd anpassat typsnitt" + +#. (itstool) path: item/p +#: C/gnote-notes-preferences.page:33 +msgid "" +"Enable this checkbox to show the Gnote status icon when running. " +"In this mode Gnote will remain present even after all its windows " +"are closed. When you click the status icon, a menu appears that gives you " +"quick access to recently used notes and other windows." +msgstr "" + +#. (itstool) path: item/title +#: C/gnote-notes-preferences.page:34 +msgid "Always open notes in new window" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-notes-preferences.page:34 +msgid "" +"When checked, instead of replacing current window content, note is opened in " +"the new window." +msgstr "" + +#. (itstool) path: item/title +#: C/gnote-notes-preferences.page:35 +#, fuzzy +#| msgid "Spellcheck While Typing" +msgid "Spellcheck while typing" +msgstr "Stavningskontroll när text skrivs in" + +#. (itstool) path: item/p +#: C/gnote-notes-preferences.page:35 +#, fuzzy +#| msgid "" +#| "Enable this checkbox to underline misspellings in red, and provide " +#| "suggestions in the right click context menu. Enable or disable the " +#| "checkbox using the mouse or the key combination AltS." +msgid "" +"Enable this checkbox to underline misspellings in red and provide " +"suggestions in the right click context menu." +msgstr "" +"Aktivera den här kryssrutan för att understryka felstavningar med röd färg, " +"och tillhandahålla förslag i sammanhangsmenyn som du visar med ett " +"högerklick. Aktivera eller inaktivera kryssrutan med musen eller " +"tangentkombinationen AltS." + +#. (itstool) path: item/p +#: C/gnote-notes-preferences.page:35 +#, fuzzy +#| msgid "" +#| "The spellcheck option is only available if you have the " +#| "GtkSpell package for your distribution " +#| "installed." +msgid "" +"The spellcheck option is only available if you have the GtkSpell package for " +"your distribution installed." +msgstr "" +"Alternativet för stavningskontroll finns endast tillgängligt om du har " +"paketet GtkSpell installerat för din distribution." + +#. (itstool) path: item/title +#: C/gnote-notes-preferences.page:36 +msgid "Highlight WikiWords" +msgstr "Färgmarkera WikiOrd" + +#. (itstool) path: item/p +#: C/gnote-notes-preferences.page:36 +#, fuzzy +#| msgid "" +#| "Enable this checkbox to create links for phrases " +#| "ThatLookLikeThis. Clicking on the link will create a " +#| "new note with the title corresponding to the link text. Enable or disable " +#| "this checkbox using the mouse or the key combination " +#| "AltW." +msgid "" +"Enable this checkbox to create links for phrases ThatLookLikeThis. Clicking " +"on a link will create a new note with a title corresponding to the link text." +msgstr "" +"Aktivera den här kryssrutan för att skapa länkar för fraser " +"SomSerUtSomDetta. Klicka på länken kommer att skapa en ny " +"anteckning med titeln som motsvarar länktexten. Aktivera eller inaktivera " +"den här kryssrutan med musen eller tangentkombinationen " +"AltW." + +#. (itstool) path: item/title +#: C/gnote-notes-preferences.page:37 +#, fuzzy +#| msgid "End a bulleted list" +msgid "Enable auto-bulleted lists" +msgstr "Avsluta en punktlista" + +#. (itstool) path: item/p +#: C/gnote-notes-preferences.page:37 +msgid "" +"When this preference is enabled, you can create bulleted lists by starting " +"lines with a dash character -. Read more about ." +msgstr "" + +#. (itstool) path: item/title +#: C/gnote-notes-preferences.page:38 +#, fuzzy +#| msgid "Use Custom Font" +msgid "Use custom font" +msgstr "Använd anpassat typsnitt" + +#. (itstool) path: item/p +#: C/gnote-notes-preferences.page:38 +msgid "Enable this checkbox to set a custom font to be used in your notes." +msgstr "" + +#. (itstool) path: figure/title +#: C/gnote-notes-preferences.page:40 +msgid "Preferences window" +msgstr "" + +#. (itstool) path: figure/desc +#: C/gnote-notes-preferences.page:41 +#, fuzzy +#| msgid "Gnote Editing Preferences" +msgid "Editing Gnote Preferences" +msgstr "Redigeringsinställningar för Gnote" + +#. (itstool) path: section/title +#: C/gnote-notes-preferences.page:46 +msgid "Advanced Settings" +msgstr "" + +#. (itstool) path: section/title +#: C/gnote-notes-preferences.page:49 +#, fuzzy +#| msgid "Synchronization" +msgid "Synchronization Settings" +msgstr "Synkronisering" + +#. (itstool) path: section/title +#: C/gnote-notes-preferences.page:51 +#, fuzzy +#| msgid "Synchronization" +msgid "Synchronization services" +msgstr "Synkronisering" + +#. (itstool) path: section/title +#: C/gnote-notes-preferences.page:54 C/index.page:33 +msgid "Advanced" +msgstr "" + +#. (itstool) path: section/p +#: C/gnote-notes-preferences.page:55 +msgid "" +"The Advanced button in the Synchronization tab of the " +"Preferences dialog brings up another dialog for setting up " +"conflict resolution." +msgstr "" + +#. (itstool) path: figure/title +#: C/gnote-notes-preferences.page:57 +#, fuzzy +#| msgid "Gnote Synchronization Preferences" +msgid "Advanced Synchronization Settings" +msgstr "Synkroniseringsinställningar för Gnote" + +#. (itstool) path: section/p +#: C/gnote-notes-preferences.page:60 +msgid "" +"This dialog lets you choose what to do when a conflict occurrs. A conflict " +"happens when a note has been modified both on the local machine and on " +"another device. You can select one of these options:" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-notes-preferences.page:62 +msgid "" +"Rename the existing note by appending \"(old)\" to its title and downloading " +"the one from storage" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-notes-preferences.page:63 +msgid "" +"Replace the existing note by the one from storage, losing all modifications" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-notes-preferences.page:64 +msgid "Ask about each conflicting note individually" +msgstr "" + +#. (itstool) path: info/desc +#: C/gnote-searching-notes.page:9 +#, fuzzy +#| msgid "Search notes" +msgid "Searching notes" +msgstr "Sök anteckningar" + +#. (itstool) path: page/title +#: C/gnote-searching-notes.page:25 +#, fuzzy +#| msgid "Editing Notes" +msgid "Exploring Notes" +msgstr "Redigera anteckningar" + +#. (itstool) path: page/p +#: C/gnote-searching-notes.page:27 +#, fuzzy +#| msgid "" +#| "To get an overview of all the notes managed by Gnote, select the " +#| "Search All Notes menu " +#| "item from the panel menu. By default, the Search All Notes dialog will display the notes in the order that they were last " +#| "modified. Click the Note or Last Changed column headings to change the sort order. Click the column " +#| "heading a second time to toggle between ascending and descending order." +msgid "" +"The main Gnote window shows an overview of all your notes. By " +"default the window will display notes in the order in which they were last " +"modified. Click the Note or Last Changed column " +"headings to change the sort order. Click a column heading a second time to " +"toggle between ascending and descending order." +msgstr "" +"För att få en översikt över alla anteckningar som hanteras av Gnote, välj " +"menyobjektet Sök i alla anteckningar från panelmenyn. Som standard visar dialogrutan Sök i " +"alla anteckningar anteckningarna i den ordning som de blev " +"ändrade. Klicka på kolumnhuvudet Anteckning eller " +"Senast ändrad för att ändra sorteringsordningen. Klicka " +"på kolumnhuvudet en andra gång för att växla mellan stigande eller fallande " +"ordning." + +#. (itstool) path: page/p +#: C/gnote-searching-notes.page:28 +#, fuzzy +#| msgid "" +#| "You can find specific notes by entering text into the search field in the " +#| "Search All Notes dialog. The list of notes will " +#| "automatically update to list only the notes which have matching text." +msgid "" +"You can find specific notes by clicking search button and entering text in " +"the search field that apears. The note list will automatically update to " +"include only the notes which have matching text. If notes list has focus, " +"you can simply type search text there, search will be automatically " +"activated." +msgstr "" +"Du kan söka efter specifika anteckningar genom att ange text i sökfältet i " +"dialogrutan Sök i alla anteckningar. Listan över " +"anteckningar kommer automatiskt att uppdateras för att lista endast de " +"anteckningar som innehåller den matchande texten." + +#. (itstool) path: page/p +#: C/gnote-searching-notes.page:29 +#, fuzzy +#| msgid "End a bulleted list by doing one of the following:" +msgid "To open a note, do any of the following:" +msgstr "Avsluta en punktlista genom att göra ett av följande alternativ:" + +#. (itstool) path: item/p +#: C/gnote-searching-notes.page:31 +msgid "Double-click on a note." +msgstr "Dubbelklicka på en anteckning." + +#. (itstool) path: item/p +#: C/gnote-searching-notes.page:32 +msgid "" +"Right-click in the list of notes and select Open from the context " +"menu. This will open all selected notes, each in its own window." +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-searching-notes.page:33 +msgid "" +"Right-click in the list of notes and select Open in New Window " +"from the context menu. This will open each selected note in a new window, " +"leaving the original window as is." +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-searching-notes.page:34 +msgid "" +"Select one or more notes in a list and press CtrlO." +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-searching-notes.page:35 +msgid "" +"If the status icon is enabled, click it and select a note from the menu that " +"appears. This menu is limited to a certain number of notes and includes " +"pinned and recently updated notes." +msgstr "" + +#. (itstool) path: media +#. This is a reference to an external file such as an image or video. When +#. the file changes, the md5 hash will change to let you know you need to +#. update your localized copy. The msgstr is not used at all. Set it to +#. whatever you like once you have updated your copy of the file. +#: C/gnote-synchronization.page:37 +msgctxt "_" +msgid "" +"external ref='figures/gnote-sync-progress.png' " +"md5='562763250ce45698f4c0cd1231b0e68f'" +msgstr "" + +#. (itstool) path: info/desc +#: C/gnote-synchronization.page:8 +#, fuzzy +#| msgid "Synchronize Notes" +msgid "Synchronize notes" +msgstr "Synkronisera anteckningar" + +#. (itstool) path: page/title +#: C/gnote-synchronization.page:21 +msgid "Synchronization" +msgstr "Synkronisering" + +#. (itstool) path: section/title +#: C/gnote-synchronization.page:23 +#, fuzzy +#| msgid "Note Synchronization" +msgid "About synchronization" +msgstr "Synkronisering av anteckningar" + +#. (itstool) path: section/p +#: C/gnote-synchronization.page:24 +msgid "" +"Gnote lets you synchronize notes across multiple machines, so " +"that you can use it on multiple devices and work with the same notes on all " +"of them." +msgstr "" + +#. (itstool) path: section/p +#: C/gnote-synchronization.page:25 +msgid "" +"In order to use synchronization, you have to configure it first in the " +"Gnote configuration dialog." +msgstr "" + +#. (itstool) path: section/p +#: C/gnote-synchronization.page:26 +msgid "" +"Notes are synchronized to one location, common to all Gnote " +"installations. This location stores the history of your notes. When " +"synchronizing, each Gnote instance uploads new and updated notes " +"to this location, and downloads new and updated notes from other " +"installations. The synchronization location also contains information on " +"deleted notes: when synchronizing, Gnote publishes all deleted " +"notes and deletes the ones that have been published as such. This way " +"multiple Gnote installations can keep the same set of notes." +msgstr "" + +#. (itstool) path: section/title +#: C/gnote-synchronization.page:29 +#, fuzzy +#| msgid "Configure note synchronization" +msgid "Configure synchronization" +msgstr "Konfigurera synkronisering av anteckningar" + +#. (itstool) path: section/title +#: C/gnote-synchronization.page:32 +#, fuzzy +#| msgid "Synchronize Notes" +msgid "Synchronize" +msgstr "Synkronisera anteckningar" + +#. (itstool) path: section/p +#: C/gnote-synchronization.page:33 +msgid "" +"To synchronize, select Synchronize Notes from the application " +"menu. This item is only available if synchronization has been configured." +msgstr "" + +#. (itstool) path: section/p +#: C/gnote-synchronization.page:34 +msgid "" +"After you select the Synchronize Notes menu item, a progress " +"dialog will be displayed, which will let you know when synchronization is " +"complete. Also, all notes will be disabled for editing while synchronization " +"is in progress." +msgstr "" + +#. (itstool) path: figure/title +#: C/gnote-synchronization.page:36 +#, fuzzy +#| msgid "Synchronization" +msgid "Synchronization progress" +msgstr "Synkronisering" + +#. (itstool) path: media +#. This is a reference to an external file such as an image or video. When +#. the file changes, the md5 hash will change to let you know you need to +#. update your localized copy. The msgstr is not used at all. Set it to +#. whatever you like once you have updated your copy of the file. +#: C/gnote-template-notes.page:41 +msgctxt "_" +msgid "" +"external ref='figures/gnote-template-note.png' " +"md5='692c75e1018398b2eec04b7cefcf3844'" +msgstr "" + +#. (itstool) path: info/desc +#: C/gnote-template-notes.page:9 +msgid "Using template notes" +msgstr "" + +#. (itstool) path: page/title +#: C/gnote-template-notes.page:22 +#, fuzzy +#| msgid "Creating Notes" +msgid "Template Notes" +msgstr "Skapa anteckningar" + +#. (itstool) path: section/title +#: C/gnote-template-notes.page:24 +msgid "Template Note Usage" +msgstr "" + +#. (itstool) path: section/p +#: C/gnote-template-notes.page:25 +msgid "" +"Template notes are used to define the content for newly created notes. " +"Templates are just like regular notes with some additional features." +msgstr "" + +#. (itstool) path: section/p +#: C/gnote-template-notes.page:26 +msgid "" +"You can define a single main template note and one for each notebook you " +"have. These templates define the content of every new note you create:" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-template-notes.page:28 +msgid "" +"Every new note you create in Gnote, but not in any notebook, will " +"have the content of the main template. If you have not created a main " +"template, the default content will be used." +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-template-notes.page:29 +msgid "" +"Every new note created in a notebook will have the content of that " +"notebook's template note, if any. If no template note for a notebook is " +"defined, the default note content will be used." +msgstr "" + +#. (itstool) path: section/p +#: C/gnote-template-notes.page:31 +msgid "To create or modify a template note:" +msgstr "" + +#. (itstool) path: item/title +#: C/gnote-template-notes.page:33 +msgid "Main template note" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-template-notes.page:33 +msgid "" +"Open Gnote's preferences and in the General tab press " +"the Open Template Note button." +msgstr "" + +#. (itstool) path: item/title +#: C/gnote-template-notes.page:34 +#, fuzzy +#| msgid "Creating Notebook Templates" +msgid "Notebook template note" +msgstr "Skapa mallar för anteckningsblock" + +#. (itstool) path: item/p +#: C/gnote-template-notes.page:34 +msgid "" +"Right click on a notebook in the main window and select Open Template " +"Note." +msgstr "" + +#. (itstool) path: section/title +#: C/gnote-template-notes.page:38 +msgid "Template Note Features" +msgstr "" + +#. (itstool) path: section/p +#: C/gnote-template-notes.page:39 +msgid "" +"A template note is like an ordinary note except that it is not shown in note " +"lists and has a template bar at the top." +msgstr "" + +#. (itstool) path: figure/title +#: C/gnote-template-notes.page:40 +#, fuzzy +#| msgid "Create new note" +msgid "Template note" +msgstr "Skapa ny anteckning" + +#. (itstool) path: figure/desc +#: C/gnote-template-notes.page:41 +msgid "Template note window" +msgstr "" + +#. (itstool) path: section/p +#: C/gnote-template-notes.page:43 +msgid "The template bar has the following features:" +msgstr "" + +#. (itstool) path: item/title +#: C/gnote-template-notes.page:45 +msgid "Convert to regular note" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-template-notes.page:45 +msgid "" +"Press this button to turn the template into a regular note, visible in the " +"list of notes. This action is similar to deleting a template note." +msgstr "" + +#. (itstool) path: item/title +#: C/gnote-template-notes.page:46 +msgid "Save Size" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-template-notes.page:46 +msgid "" +"If you check this box, the size of a newly created note will be identical to " +"that of the template note. When this checkbox is not checked, new notes' " +"windows will have the default size." +msgstr "" + +#. (itstool) path: item/title +#: C/gnote-template-notes.page:47 +msgid "Save Selection" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-template-notes.page:47 +msgid "" +"If this box is checked, new notes will have not only the content of the " +"template note, but also its selection. Use this option if you want a certain " +"part of the content in the new note to be initially selected." +msgstr "" + +#. (itstool) path: item/title +#: C/gnote-template-notes.page:48 +msgid "Save Title" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-template-notes.page:48 +msgid "" +"This checkbox lets you base the title of new notes on a template note's " +"title. With this box checked, a new note will have the template note's title " +"with a unique number appended. Otherwise the default title will be used." +msgstr "" + +#. (itstool) path: media +#. This is a reference to an external file such as an image or video. When +#. the file changes, the md5 hash will change to let you know you need to +#. update your localized copy. The msgstr is not used at all. Set it to +#. whatever you like once you have updated your copy of the file. +#: C/gnote-working-with-notebooks.page:50 +msgctxt "_" +msgid "" +"external ref='figures/add-notebook-search.png' " +"md5='d103e411de7d0f4ecf5d02c40fe2a3af'" +msgstr "" + +#. (itstool) path: media +#. This is a reference to an external file such as an image or video. When +#. the file changes, the md5 hash will change to let you know you need to +#. update your localized copy. The msgstr is not used at all. Set it to +#. whatever you like once you have updated your copy of the file. +#: C/gnote-working-with-notebooks.page:63 +msgctxt "_" +msgid "" +"external ref='figures/notebook-icon.png' " +"md5='134ed1f78ff2a35e3cbfb2cc8f6b9afa'" +msgstr "" + +#. (itstool) path: media +#. This is a reference to an external file such as an image or video. When +#. the file changes, the md5 hash will change to let you know you need to +#. update your localized copy. The msgstr is not used at all. Set it to +#. whatever you like once you have updated your copy of the file. +#: C/gnote-working-with-notebooks.page:66 +msgctxt "_" +msgid "" +"external ref='figures/add-to-notebook.png' " +"md5='7a9f4827e18e8f5d9afa0693538bbc60'" +msgstr "" + +#. (itstool) path: media +#. This is a reference to an external file such as an image or video. When +#. the file changes, the md5 hash will change to let you know you need to +#. update your localized copy. The msgstr is not used at all. Set it to +#. whatever you like once you have updated your copy of the file. +#: C/gnote-working-with-notebooks.page:84 +#, fuzzy +#| msgid "" +#| "@@image: 'figures/note-template.png'; md5=49ee364d7e060de4e7a583e49a2f7db7" +msgctxt "_" +msgid "" +"external ref='figures/note-template.png' " +"md5='4204209a61be8676b473758f5cfe42ad'" +msgstr "" +"@@image: 'figures/note-template.png'; md5=49ee364d7e060de4e7a583e49a2f7db7" + +#. (itstool) path: media +#. This is a reference to an external file such as an image or video. When +#. the file changes, the md5 hash will change to let you know you need to +#. update your localized copy. The msgstr is not used at all. Set it to +#. whatever you like once you have updated your copy of the file. +#: C/gnote-working-with-notebooks.page:98 +msgctxt "_" +msgid "" +"external ref='figures/delete-notebook.png' " +"md5='03d1f054432a2b050dcbfcfb9a02784d'" +msgstr "" + +#. (itstool) path: info/desc +#: C/gnote-working-with-notebooks.page:9 +#, fuzzy +#| msgid "Synchronize your notes" +msgid "Organizing your notes" +msgstr "Synkronisera dina anteckningar" + +#. (itstool) path: page/title +#: C/gnote-working-with-notebooks.page:26 +#, fuzzy +#| msgid "Working with Notebooks" +msgid "Working With Notebooks" +msgstr "Arbeta med anteckningsböcker" + +#. (itstool) path: page/p +#: C/gnote-working-with-notebooks.page:27 +#, fuzzy +#| msgid "" +#| "Notebooks allow you to group related notes together. You can add a note " +#| "to a notebook in the Search All Notes window or directly inside of a Note." +msgid "" +"Notebooks let you group related notes together. You can add a note to a " +"notebook in the main window or in the note editing view." +msgstr "" +"Anteckningsblock låter dig gruppera relaterade anteckningar. Du kan lägga " +"till en anteckning till ett anteckningsblock i fönstret Sök i alla " +"anteckningar eller direkt inne i en anteckning." + +#. (itstool) path: section/title +#: C/gnote-working-with-notebooks.page:29 +msgid "Creating Notebooks" +msgstr "Skapa anteckningsböcker" + +#. (itstool) path: section/p +#: C/gnote-working-with-notebooks.page:30 +#, fuzzy +#| msgid "To create a new note using the mouse:" +msgid "To create a new notebook:" +msgstr "För att skapa en ny anteckning med musen:" + +#. (itstool) path: item/p +#: C/gnote-working-with-notebooks.page:33 +msgid "Click on the application menu and select New Notebook." +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-working-with-notebooks.page:36 +#: C/gnote-working-with-notebooks.page:45 +msgid "Enter a name for the new notebook." +msgstr "Ange ett namn för det nya anteckningsblocket." + +#. (itstool) path: section/p +#: C/gnote-working-with-notebooks.page:39 +msgid "Alternatively:" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-working-with-notebooks.page:42 +#, fuzzy +#| msgid "" +#| "Using your mouse, right click in the left hand box and choose " +#| "New Notebook." +msgid "" +"In the note overview, right click in the left hand pane and choose " +"New...." +msgstr "" +"Använd musen och högerklicka i vänstra rutan och välj " +"Nytt anteckningsblock." + +#. (itstool) path: figure/title +#: C/gnote-working-with-notebooks.page:49 +msgid "New Notebook from context menu" +msgstr "" + +#. (itstool) path: media/p +#: C/gnote-working-with-notebooks.page:51 +#, fuzzy +#| msgid "Creating Notebooks" +msgid "New Notebook" +msgstr "Skapa anteckningsböcker" + +#. (itstool) path: section/title +#. (itstool) path: figure/title +#: C/gnote-working-with-notebooks.page:56 +#: C/gnote-working-with-notebooks.page:65 +msgid "Adding Notes to a Notebook" +msgstr "Lägg till anteckningar till ett anteckningsblock" + +#. (itstool) path: section/p +#: C/gnote-working-with-notebooks.page:57 +#, fuzzy +#| msgid "" +#| "To add notes to a notebook, you can add a note from the Search " +#| "All Notes dialog or directly within a note." +msgid "" +"You can add a note to a notebook from the main window or directly within a " +"note." +msgstr "" +"För att lägga till anteckningar till ett anteckningsblock kan du lägga till " +"en anteckning från dialogrutan Sök i alla anteckningar " +"eller direkt i en anteckning." + +#. (itstool) path: section/p +#: C/gnote-working-with-notebooks.page:58 +#, fuzzy +#| msgid "" +#| "To open a note in the Search All Notes dialog, do " +#| "one of the following:" +msgid "" +"To add a note to a notebook from the main window, do one of the following:" +msgstr "" +"Gör ett av följande för att öppna en anteckning i dialogrutan Sök " +"i alla anteckningar:" + +#. (itstool) path: item/p +#: C/gnote-working-with-notebooks.page:60 +#, fuzzy +#| msgid "Using your mouse, drag the note(s) onto a notebook on the left." +msgid "Drag the note(s) onto a notebook on the left using the mouse." +msgstr "" +"Använd musen och dra anteckningen (eller flera) till ett anteckningsblock på " +"vänster sida." + +#. (itstool) path: item/p +#: C/gnote-working-with-notebooks.page:61 +msgid "" +"Click on a notebook, right-click in notes list and select New " +"from the context menu. A new note will be created and added to the notebook." +msgstr "" + +#. (itstool) path: section/p +#: C/gnote-working-with-notebooks.page:63 +#, fuzzy +#| msgid "" +#| "As you type a note, you can add the note directly to an existing notebook " +#| "using the Notebook button. The Notebook button is represented by the icon." +msgid "" +"As you type a note, you can add the note directly to an existing notebook " +"using the Notebook button. The Notebook button is represented by " +"the icon." +msgstr "" +"När du skriver en anteckning kan du lägga till anteckningen direkt till ett " +"befintligt anteckningsblock med knappen Anteckningsblock. " +"Knappen Anteckningsblock representeras av ikonen " +"." + +#. (itstool) path: media/p +#: C/gnote-working-with-notebooks.page:66 +#, fuzzy +#| msgid "Adding Notes to a Notebook" +msgid "Add to Notebook." +msgstr "Lägg till anteckningar till ett anteckningsblock" + +#. (itstool) path: section/p +#: C/gnote-working-with-notebooks.page:68 +#, fuzzy +#| msgid "You can create new notebooks using one of the following methods:" +msgid "To remove a note from a notebook, use one of the following:" +msgstr "" +"Du kan skapa nya anteckningsblock genom att använda en av följande metoder:" + +#. (itstool) path: item/p +#: C/gnote-working-with-notebooks.page:70 +msgid "Move the note to Unfiled Notes in the main window." +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-working-with-notebooks.page:71 +msgid "" +"Select the No Notebook option from the menu which appears when " +"you press the Notebook button in an open note." +msgstr "" + +#. (itstool) path: section/title +#. (itstool) path: figure/title +#: C/gnote-working-with-notebooks.page:75 +#: C/gnote-working-with-notebooks.page:83 +#, fuzzy +#| msgid "Creating a Notebook Template" +msgid "Creating a Template" +msgstr "Skapa en mall för anteckningsblock" + +#. (itstool) path: section/p +#: C/gnote-working-with-notebooks.page:76 +#, fuzzy +#| msgid "" +#| "After you create a notebook, you can create a template for each new note " +#| "that you create in a specific notebook." +msgid "" +"After you create a notebook, you can create a template for new notes that " +"you create in that notebook." +msgstr "" +"Efter att du skapat ett anteckningsblock kan du skapa en mall för varje ny " +"anteckning som du skapar i ett specifikt anteckningsblock." + +#. (itstool) path: item/p +#: C/gnote-working-with-notebooks.page:78 +#, fuzzy +#| msgid "" +#| "Using your mouse, right click on a Notebook that you have created and " +#| "choose Open Template Note." +msgid "" +"In the main window, right click on a notebook and choose Open Template " +"Note." +msgstr "" +"Använd musen och högerklicka på ett anteckningsblock som du har skapat och " +"välj Öppna anteckningsmall." + +#. (itstool) path: item/p +#: C/gnote-working-with-notebooks.page:80 +msgid "" +"This will open a new template note. Any text typed in this note will appear " +"in all notes created in this notebook." +msgstr "" + +#. (itstool) path: media/p +#: C/gnote-working-with-notebooks.page:84 +#, fuzzy +#| msgid "Creating Notebook Templates" +msgid "Note Template." +msgstr "Skapa mallar för anteckningsblock" + +#. (itstool) path: section/p +#: C/gnote-working-with-notebooks.page:86 +msgid "For more, see ." +msgstr "" + +#. (itstool) path: section/title +#: C/gnote-working-with-notebooks.page:89 +msgid "Deleting a Notebook" +msgstr "Ta bort ett anteckningsblock" + +#. (itstool) path: section/p +#: C/gnote-working-with-notebooks.page:90 +#, fuzzy +#| msgid "" +#| "Deleting a notebook will not delete any of the notes which are currently " +#| "inside the notebook. After deleting a notebook, the notes will not be " +#| "associated with any notebook and can be seen by highlighting " +#| "Unfiled Notes in the " +#| "Search All Notes " +#| "window." +msgid "" +"Deleting a notebook will not delete any of the notes which are currently " +"inside the notebook. After you delete a notebook, its notes will not be " +"associated with any notebook and will appear in Unfiled Notes in " +"the main window." +msgstr "" +"Borttagning av ett anteckningsblock kommer inte att ta bort några av de " +"anteckningar som anteckningsblocket innehåller. Efter borttagning av ett " +"anteckningsblock kommer inte anteckningarna att associeras med något " +"anteckningsblock och kan ses genom att markera Ej " +"arkiverade anteckningar i fönstret " +"Sök i alla anteckningar." + +#. (itstool) path: section/p +#: C/gnote-working-with-notebooks.page:91 +msgid "" +"To delete a notebook, go to the main window and do one of the following:" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-working-with-notebooks.page:93 +msgid "Right click on a notebook and choose Delete Notebook." +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-working-with-notebooks.page:94 +msgid "" +"Remove all notes from a notebook. The notebook will be automatically removed " +"the next time Gnote restarts." +msgstr "" + +#. (itstool) path: figure/title +#: C/gnote-working-with-notebooks.page:97 +msgid "Deleting notes from main window" +msgstr "" + +#. (itstool) path: media/p +#: C/gnote-working-with-notebooks.page:99 +#, fuzzy +#| msgid "Deleting a Notebook" +msgid "Delete Notebook." +msgstr "Ta bort ett anteckningsblock" + +#. (itstool) path: section/title +#: C/gnote-working-with-notebooks.page:104 +#, fuzzy +#| msgid "Creating Notebooks" +msgid "Special Notebooks" +msgstr "Skapa anteckningsböcker" + +#. (itstool) path: section/p +#: C/gnote-working-with-notebooks.page:105 +msgid "Gnote has several special notebooks:" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-working-with-notebooks.page:107 +msgid "" +"Active: notes that have been opened in the current Gnote session" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-working-with-notebooks.page:108 +msgid "All: all notes except templates" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-working-with-notebooks.page:109 +msgid "Important: notes marked as important" +msgstr "" + +#. (itstool) path: item/p +#: C/gnote-working-with-notebooks.page:110 +msgid "Unfiled: all notes that are not in a user-created notebook" +msgstr "" + +#. (itstool) path: media +#. This is a reference to an external file such as an image or video. When +#. the file changes, the md5 hash will change to let you know you need to +#. update your localized copy. The msgstr is not used at all. Set it to +#. whatever you like once you have updated your copy of the file. +#: C/index.page:18 +msgctxt "_" +msgid "" +"external ref='figures/logo32.png' md5='a7b1fb2d2c427a0ca5043b7e836d69a7'" +msgstr "" + +#. (itstool) path: page/title +#: C/index.page:18 +msgid " Gnote Help" +msgstr "" + +#. (itstool) path: section/title +#: C/index.page:21 +msgid "Introduction" +msgstr "Introduktion" + +#. (itstool) path: section/title +#: C/index.page:25 +#, fuzzy +#| msgid "Creating Notes" +msgid "Managing Notes" +msgstr "Skapa anteckningar" + +#. (itstool) path: section/title +#: C/index.page:29 +#, fuzzy +#| msgid "Creating Notes" +msgid "Organizing Notes" +msgstr "Skapa anteckningar" + +#. (itstool) path: section/title +#: C/index.page:37 +msgid "Customizing" +msgstr "" + +#. (itstool) path: section/title +#: C/index.page:41 +msgid "Common Problems" +msgstr "" + + diff -Nru gnote-3.14.2/help/zh_CN/gnote-common-problems.page gnote-3.16.0/help/zh_CN/gnote-common-problems.page --- gnote-3.14.2/help/zh_CN/gnote-common-problems.page 2015-01-17 15:47:17.000000000 +0000 +++ gnote-3.16.0/help/zh_CN/gnote-common-problems.page 2015-03-29 20:07:31.000000000 +0000 @@ -36,8 +36,6 @@ <app>Gnote</app> 是否与 <app>Tomboy</app> 兼容？

You can import Tomboy Notes. A plugin has to be activated.

 - 我找不到 Gnote 状态图标。 -

You can activate the Gnote status icon in Gnote Preferences dialog.

 当我登录系统时如何自动启用 <app>Gnote</app> ？

当您登录到 GNOME 后运行 gnome-session-properties 即可自动启用 Gnote。

 diff -Nru gnote-3.14.2/help/zh_CN/gnote-hotkeys.page gnote-3.16.0/help/zh_CN/gnote-hotkeys.page --- gnote-3.14.2/help/zh_CN/gnote-hotkeys.page 2015-01-17 15:47:17.000000000 +0000 +++ gnote-3.16.0/help/zh_CN/gnote-hotkeys.page 1970-01-01 00:00:00.000000000 +0000 @@ -1,53 +0,0 @@ - - - - - - Gnote 热键设置 -

GNU 自由文档许可证(GFDL)，版本 1.1

 - - Pierre-Yves Luyten - 2011 - - - Aurimas Cernius - 2011-2013 - - - Adam Dingle - adam@yorba.org - 2013 - - - - YunQiang Su - wzssyqa@gmail.com - 2009-2010 - - - - tuhaihe - 1132321739qq@gmail.com - 2012 - - - - 热键 -

This tab is only available if Gnote was buit with X11 support.

-

热键 标签允许您设置全局键盘组合来帮助您实现不同的 Gnote 功能。如果要设置键盘组合，您必须启用监听热键。

- - 显示便笺菜单

输入打开便笺菜单的键盘组合。

 - 打开 “从这里开始”

输入打开“从这里开始”便笺的组合键(其已经随 Gnote 预安装)。

 - 创建新便笺

输入创建新便笺的组合键。

 - 打开 “搜索全部便笺”

Enter a key combination for opening a search.

 - - -
- <gui>热键首选项</gui>窗口 - Gnote 热键 - -

设置 Gnote 键盘快捷键。

- -
- - diff -Nru gnote-3.14.2/help/zh_CN/gnote-working-with-notebooks.page gnote-3.16.0/help/zh_CN/gnote-working-with-notebooks.page --- gnote-3.14.2/help/zh_CN/gnote-working-with-notebooks.page 2015-01-17 15:47:18.000000000 +0000 +++ gnote-3.16.0/help/zh_CN/gnote-working-with-notebooks.page 2015-03-29 20:07:31.000000000 +0000 @@ -70,7 +70,7 @@

使用鼠标将便笺拖到左侧的便笺本。

Click on a notebook, right-click in notes list and select New from the context menu. A new note will be created and added to the notebook.

 -

当您输入一个便笺时，可以使用 便笺本 按钮直接将便笺添加到已有的便笺本中。便笺本按钮将被图标代替。

+

As you type a note, you can add the note directly to an existing notebook using the ActionsNotebook menu.

将便笺添加到便笺本

添加到便笺本。

 @@ -78,7 +78,7 @@

您可以使用如下方法从便笺本中移除便笺：

在主窗口中将便笺移动到未分类便笺。

 -

Select the No Notebook option from the menu which appears when you press the Notebook button in an open note.

 +

Select the No Notebook option from the menu which appears when you press the ActionsNotebook in an open note.
diff -Nru gnote-3.14.2/m4/boost.m4 gnote-3.16.0/m4/boost.m4 --- gnote-3.14.2/m4/boost.m4 2014-03-25 21:29:19.000000000 +0000 +++ gnote-3.16.0/m4/boost.m4 2015-03-07 18:13:28.000000000 +0000 @@ -1,5 +1,5 @@ # boost.m4: Locate Boost headers and libraries for autoconf-based projects. -# Copyright (C) 2007, 2008, 2009, 2010, 2011 Benoit Sigoure +# Copyright (C) 2007-2011, 2014 Benoit Sigoure # # This program is free software: you can redistribute it and/or modify # it under the terms of the GNU General Public License as published by @@ -22,7 +22,7 @@ # along with this program. If not, see . m4_define([_BOOST_SERIAL], [m4_translit([ -# serial 18 +# serial 24 ], [# ], [])]) @@ -59,7 +59,8 @@ # It could be useful to turn this into a macro which extracts the # value of any macro. m4_define([_BOOST_SED_CPP], -[AC_LANG_PREPROC_REQUIRE()dnl +[AC_LANG_PUSH([C++])dnl +AC_LANG_PREPROC_REQUIRE()dnl AC_REQUIRE([AC_PROG_SED])dnl AC_LANG_CONFTEST([AC_LANG_SOURCE([[$2]])]) AS_IF([dnl eval is necessary to expand ac_cpp. @@ -71,13 +72,31 @@ dnl boost_cv_lib_version='1_37\r' for instance, which breaks dnl everything else. dnl Cannot use 'dnl' after [$4] because a trailing dnl may break AC_CACHE_CHECK +dnl +dnl Beware that GCC 5, when expanding macros, may embed # line directives +dnl a within single line: +dnl +dnl # 1 "conftest.cc" +dnl # 1 "" +dnl # 1 "" +dnl # 1 "conftest.cc" +dnl # 1 "/opt/local/include/boost/version.hpp" 1 3 +dnl # 2 "conftest.cc" 2 +dnl boost-lib-version = +dnl # 2 "conftest.cc" 3 +dnl "1_56" +dnl +dnl So get rid of the # lines, and glue the remaining ones together. (eval "$ac_cpp conftest.$ac_ext") 2>&AS_MESSAGE_LOG_FD | + grep -v '#' | tr -d '\r' | + tr -s '\n' ' ' | $SED -n -e "$1" >conftest.i 2>&1], [$3], [$4]) rm -rf conftest* -])# AC_EGREP_CPP +AC_LANG_POP([C++])dnl +])# _BOOST_SED_CPP @@ -206,7 +225,7 @@ AC_CACHE_CHECK([for Boost's header version], [boost_cv_lib_version], [m4_pattern_allow([^BOOST_LIB_VERSION$])dnl - _BOOST_SED_CPP([/^boost-lib-version = /{s///;s/\"//g;p;q;}], + _BOOST_SED_CPP([[/^boost-lib-version = /{s///;s/[\" ]//g;p;q;}]], [#include boost-lib-version = BOOST_LIB_VERSION], [boost_cv_lib_version=`cat conftest.i`])]) @@ -214,13 +233,14 @@ boost_major_version=`echo "$boost_cv_lib_version" | sed 's/_//;s/_.*//'` case $boost_major_version in #( '' | *[[!0-9]]*) - AC_MSG_ERROR([invalid value: boost_major_version=$boost_major_version]) + AC_MSG_ERROR([invalid value: boost_major_version='$boost_major_version']) ;; esac fi CPPFLAGS=$boost_save_CPPFLAGS ])# BOOST_REQUIRE + # BOOST_STATIC() # -------------- # Add the "--enable-static-boost" configure argument. If this argument is given @@ -232,6 +252,7 @@ [enable_static_boost=yes], [enable_static_boost=no])])# BOOST_STATIC + # BOOST_FIND_HEADER([HEADER-NAME], [ACTION-IF-NOT-FOUND], [ACTION-IF-FOUND]) # -------------------------------------------------------------------------- # Wrapper around AC_CHECK_HEADER for Boost headers. Useful to check for @@ -264,14 +285,16 @@ ])# BOOST_FIND_HEADER -# BOOST_FIND_LIB([LIB-NAME], [PREFERRED-RT-OPT], [HEADER-NAME], [CXX-TEST], -# [CXX-PROLOGUE]) -# ------------------------------------------------------------------------- -# Look for the Boost library LIB-NAME (e.g., LIB-NAME = `thread', for -# libboost_thread). Check that HEADER-NAME works and check that -# libboost_LIB-NAME can link with the code CXX-TEST. The optional argument -# CXX-PROLOGUE can be used to include some C++ code before the `main' -# function. +# BOOST_FIND_LIBS([COMPONENT-NAME], [CANDIDATE-LIB-NAMES], +# [PREFERRED-RT-OPT], [HEADER-NAME], [CXX-TEST], +# [CXX-PROLOGUE]) +# -------------------------------------------------------------- +# Look for the Boost library COMPONENT-NAME (e.g., `thread', for +# libboost_thread) under the possible CANDIDATE-LIB-NAMES (e.g., +# "thread_win32 thread"). Check that HEADER-NAME works and check that +# libboost_LIB-NAME can link with the code CXX-TEST. The optional +# argument CXX-PROLOGUE can be used to include some C++ code before +# the `main' function. # # Invokes BOOST_FIND_HEADER([HEADER-NAME]) (see above). # @@ -285,7 +308,7 @@ # builds. Some sample values for PREFERRED-RT-OPT: (nothing), mt, d, mt-d, gdp # ... If you want to make sure you have a specific version of Boost # (eg, >= 1.33) you *must* invoke BOOST_REQUIRE before this macro. -AC_DEFUN([BOOST_FIND_LIB], +AC_DEFUN([BOOST_FIND_LIBS], [AC_REQUIRE([BOOST_REQUIRE])dnl AC_REQUIRE([_BOOST_FIND_COMPILER_TAG])dnl AC_REQUIRE([BOOST_STATIC])dnl @@ -299,32 +322,69 @@ AS_VAR_PUSHDEF([Boost_lib_LDFLAGS], [boost_cv_lib_$1_LDFLAGS])dnl AS_VAR_PUSHDEF([Boost_lib_LDPATH], [boost_cv_lib_$1_LDPATH])dnl AS_VAR_PUSHDEF([Boost_lib_LIBS], [boost_cv_lib_$1_LIBS])dnl -BOOST_FIND_HEADER([$3]) +BOOST_FIND_HEADER([$4]) boost_save_CPPFLAGS=$CPPFLAGS CPPFLAGS="$CPPFLAGS $BOOST_CPPFLAGS" -# Now let's try to find the library. The algorithm is as follows: first look -# for a given library name according to the user's PREFERRED-RT-OPT. For each -# library name, we prefer to use the ones that carry the tag (toolset name). -# Each library is searched through the various standard paths were Boost is -# usually installed. If we can't find the standard variants, we try to -# enforce -mt (for instance on MacOSX, libboost_threads.dylib doesn't exist -# but there's -obviously- libboost_threads-mt.dylib). AC_CACHE_CHECK([for the Boost $1 library], [Boost_lib], - [Boost_lib=no - case "$2" in #( - mt | mt-) boost_mt=-mt; boost_rtopt=;; #( - mt* | mt-*) boost_mt=-mt; boost_rtopt=`expr "X$2" : 'Xmt-*\(.*\)'`;; #( - *) boost_mt=; boost_rtopt=$2;; + [_BOOST_FIND_LIBS($@)]) +case $Boost_lib in #( + (no) _AC_MSG_LOG_CONFTEST + AC_MSG_ERROR([cannot find the flags to link with Boost $1]) + ;; +esac +AC_SUBST(AS_TR_CPP([BOOST_$1_LDFLAGS]), [$Boost_lib_LDFLAGS])dnl +AC_SUBST(AS_TR_CPP([BOOST_$1_LDPATH]), [$Boost_lib_LDPATH])dnl +AC_SUBST([BOOST_LDPATH], [$Boost_lib_LDPATH])dnl +AC_SUBST(AS_TR_CPP([BOOST_$1_LIBS]), [$Boost_lib_LIBS])dnl +CPPFLAGS=$boost_save_CPPFLAGS +AS_VAR_POPDEF([Boost_lib])dnl +AS_VAR_POPDEF([Boost_lib_LDFLAGS])dnl +AS_VAR_POPDEF([Boost_lib_LDPATH])dnl +AS_VAR_POPDEF([Boost_lib_LIBS])dnl +AC_LANG_POP([C++])dnl +fi +]) + + +# BOOST_FIND_LIB([LIB-NAME], +# [PREFERRED-RT-OPT], [HEADER-NAME], [CXX-TEST], +# [CXX-PROLOGUE]) +# -------------------------------------------------------------- +# Backward compatibility wrapper for BOOST_FIND_LIBS. +AC_DEFUN([BOOST_FIND_LIB], +[BOOST_FIND_LIBS([$1], $@)]) + + +# _BOOST_FIND_LIBS([LIB-NAME], [CANDIDATE-LIB-NAMES], +# [PREFERRED-RT-OPT], [HEADER-NAME], [CXX-TEST], +# [CXX-PROLOGUE]) +# -------------------------------------------------------------- +# Real implementation of BOOST_FIND_LIBS: rely on these local macros: +# Boost_lib, Boost_lib_LDFLAGS, Boost_lib_LDPATH, Boost_lib_LIBS +# +# The algorithm is as follows: first look for a given library name +# according to the user's PREFERRED-RT-OPT. For each library name, we +# prefer to use the ones that carry the tag (toolset name). Each +# library is searched through the various standard paths were Boost is +# usually installed. If we can't find the standard variants, we try +# to enforce -mt (for instance on MacOSX, libboost_thread.dylib +# doesn't exist but there's -obviously- libboost_thread-mt.dylib). +AC_DEFUN([_BOOST_FIND_LIBS], +[Boost_lib=no + case "$3" in #( + (mt | mt-) boost_mt=-mt; boost_rtopt=;; #( + (mt* | mt-*) boost_mt=-mt; boost_rtopt=`expr "X$3" : 'Xmt-*\(.*\)'`;; #( + (*) boost_mt=; boost_rtopt=$3;; esac if test $enable_static_boost = yes; then boost_rtopt="s$boost_rtopt" fi # Find the proper debug variant depending on what we've been asked to find. case $boost_rtopt in #( - *d*) boost_rt_d=$boost_rtopt;; #( - *[[sgpn]]*) # Insert the `d' at the right place (in between `sg' and `pn') + (*d*) boost_rt_d=$boost_rtopt;; #( + (*[[sgpn]]*) # Insert the `d' at the right place (in between `sg' and `pn') boost_rt_d=`echo "$boost_rtopt" | sed 's/\(s*g*\)\(p*n*\)/\1\2/'`;; #( - *) boost_rt_d='-d';; + (*) boost_rt_d='-d';; esac # If the PREFERRED-RT-OPT are not empty, prepend a `-'. test -n "$boost_rtopt" && boost_rtopt="-$boost_rtopt" @@ -335,8 +395,8 @@ AC_MSG_ERROR([the libext variable is empty, did you invoke Libtool?]) boost_save_ac_objext=$ac_objext # Generate the test file. - AC_LANG_CONFTEST([AC_LANG_PROGRAM([#include <$3> -$5], [$4])]) + AC_LANG_CONFTEST([AC_LANG_PROGRAM([#include <$4> +$6], [$5])]) dnl Optimization hacks: compiling C++ is slow, especially with Boost. What dnl we're trying to do here is guess the right combination of link flags dnl (LIBS / LDFLAGS) to use a given library. This can take several @@ -358,21 +418,22 @@ [AC_MSG_ERROR([cannot compile a test that uses Boost $1])]) ac_objext=$boost_save_ac_objext boost_failed_libs= -# Don't bother to ident the 6 nested for loops, only the 2 innermost ones -# matter. +# Don't bother to ident the following nested for loops, only the 2 +# innermost ones matter. +for boost_lib_ in $2; do for boost_tag_ in -$boost_cv_lib_tag ''; do for boost_ver_ in -$boost_cv_lib_version ''; do for boost_mt_ in $boost_mt -mt ''; do for boost_rtopt_ in $boost_rtopt '' -d; do for boost_lib in \ - boost_$1$boost_tag_$boost_mt_$boost_rtopt_$boost_ver_ \ - boost_$1$boost_tag_$boost_rtopt_$boost_ver_ \ - boost_$1$boost_tag_$boost_mt_$boost_ver_ \ - boost_$1$boost_tag_$boost_ver_ + boost_$boost_lib_$boost_tag_$boost_mt_$boost_rtopt_$boost_ver_ \ + boost_$boost_lib_$boost_tag_$boost_rtopt_$boost_ver_ \ + boost_$boost_lib_$boost_tag_$boost_mt_$boost_ver_ \ + boost_$boost_lib_$boost_tag_$boost_ver_ do # Avoid testing twice the same lib case $boost_failed_libs in #( - *@$boost_lib@*) continue;; + (*@$boost_lib@*) continue;; esac # If with_boost is empty, we'll search in /lib first, which is not quite # right so instead we'll try to a location based on where the headers are. @@ -382,14 +443,17 @@ /opt/local/lib* /usr/local/lib* /opt/lib* /usr/lib* \ "$with_boost" C:/Boost/lib /lib* do - test -e "$boost_ldpath" || continue + # Don't waste time with directories that don't exist. + if test x"$boost_ldpath" != x && test ! -e "$boost_ldpath"; then + continue + fi boost_save_LDFLAGS=$LDFLAGS # Are we looking for a static library? case $boost_ldpath:$boost_rtopt_ in #( - *?*:*s*) # Yes (Non empty boost_ldpath + s in rt opt) + (*?*:*s*) # Yes (Non empty boost_ldpath + s in rt opt) Boost_lib_LIBS="$boost_ldpath/lib$boost_lib.$libext" test -e "$Boost_lib_LIBS" || continue;; #( - *) # No: use -lboost_foo to find the shared library. + (*) # No: use -lboost_foo to find the shared library. Boost_lib_LIBS="-l$boost_lib";; esac boost_save_LIBS=$LIBS @@ -403,27 +467,35 @@ LDFLAGS=$boost_save_LDFLAGS LIBS=$boost_save_LIBS if test x"$Boost_lib" = xyes; then - # Check or used cached result of whether or not using -R or -rpath makes sense. - # Some implementations of ld, such as for Mac OSX, require -rpath but - # -R is the flag known to work on other systems. - # https://github.com/tsuna/boost.m4/issues/19 + # Check or used cached result of whether or not using -R or + # -rpath makes sense. Some implementations of ld, such as for + # Mac OSX, require -rpath but -R is the flag known to work on + # other systems. https://github.com/tsuna/boost.m4/issues/19 AC_CACHE_VAL([boost_cv_rpath_link_ldflag], - [for boost_cv_rpath_link_ldflag in -Wl,-R, -Wl,-rpath,; do - LDFLAGS="$boost_save_LDFLAGS -L$boost_ldpath $boost_cv_rpath_link_ldflag$boost_ldpath" - LIBS="$boost_save_LIBS $Boost_lib_LIBS" - _BOOST_AC_LINK_IFELSE([], - [boost_rpath_link_ldflag_found=yes - break], - [boost_rpath_link_ldflag_found=no]) - done + [case $boost_ldpath in + '') # Nothing to do. + boost_cv_rpath_link_ldflag= + boost_rpath_link_ldflag_found=yes;; + *) + for boost_cv_rpath_link_ldflag in -Wl,-R, -Wl,-rpath,; do + LDFLAGS="$boost_save_LDFLAGS -L$boost_ldpath $boost_cv_rpath_link_ldflag$boost_ldpath" + LIBS="$boost_save_LIBS $Boost_lib_LIBS" + _BOOST_AC_LINK_IFELSE([], + [boost_rpath_link_ldflag_found=yes + break], + [boost_rpath_link_ldflag_found=no]) + done + ;; + esac AS_IF([test "x$boost_rpath_link_ldflag_found" != "xyes"], [AC_MSG_ERROR([Unable to determine whether to use -R or -rpath])]) LDFLAGS=$boost_save_LDFLAGS LIBS=$boost_save_LIBS ]) - Boost_lib_LDFLAGS="-L$boost_ldpath $boost_cv_rpath_link_ldflag$boost_ldpath" + test x"$boost_ldpath" != x && + Boost_lib_LDFLAGS="-L$boost_ldpath $boost_cv_rpath_link_ldflag$boost_ldpath" Boost_lib_LDPATH="$boost_ldpath" - break 6 + break 7 else boost_failed_libs="$boost_failed_libs@$boost_lib@" fi @@ -433,25 +505,10 @@ done done done +done # boost_lib_ rm -f conftest.$ac_objext ]) -case $Boost_lib in #( - no) _AC_MSG_LOG_CONFTEST - AC_MSG_ERROR([cannot find the flags to link with Boost $1]) - ;; -esac -AC_SUBST(AS_TR_CPP([BOOST_$1_LDFLAGS]), [$Boost_lib_LDFLAGS])dnl -AC_SUBST(AS_TR_CPP([BOOST_$1_LDPATH]), [$Boost_lib_LDPATH])dnl -AC_SUBST([BOOST_LDPATH], [$Boost_lib_LDPATH])dnl -AC_SUBST(AS_TR_CPP([BOOST_$1_LIBS]), [$Boost_lib_LIBS])dnl -CPPFLAGS=$boost_save_CPPFLAGS -AS_VAR_POPDEF([Boost_lib])dnl -AS_VAR_POPDEF([Boost_lib_LDFLAGS])dnl -AS_VAR_POPDEF([Boost_lib_LDPATH])dnl -AS_VAR_POPDEF([Boost_lib_LIBS])dnl -AC_LANG_POP([C++])dnl -fi -])# BOOST_FIND_LIB + # --------------------------------------- # @@ -493,20 +550,20 @@ # BOOST_BIND() # ------------ -# Look for Boost.Bind +# Look for Boost.Bind. BOOST_DEFUN([Bind], [BOOST_FIND_HEADER([boost/bind.hpp])]) # BOOST_CHRONO() -# ------------------ -# Look for Boost.Chrono +# -------------- +# Look for Boost.Chrono. BOOST_DEFUN([Chrono], [# Do we have to check for Boost.System? This link-time dependency was # added as of 1.35.0. If we have a version <1.35, we must not attempt to # find Boost.System as it didn't exist by then. if test $boost_major_version -ge 135; then -BOOST_SYSTEM([$1]) + BOOST_SYSTEM([$1]) fi # end of the Boost.System check. boost_filesystem_save_LIBS=$LIBS boost_filesystem_save_LDFLAGS=$LDFLAGS @@ -517,14 +574,40 @@ [boost/chrono.hpp], [boost::chrono::thread_clock d;]) if test $enable_static_boost = yes && test $boost_major_version -ge 135; then - AC_SUBST([BOOST_FILESYSTEM_LIBS], ["$BOOST_FILESYSTEM_LIBS $BOOST_SYSTEM_LIBS"]) + BOOST_CHRONO_LIBS="$BOOST_CHRONO_LIBS $BOOST_SYSTEM_LIBS" fi LIBS=$boost_filesystem_save_LIBS LDFLAGS=$boost_filesystem_save_LDFLAGS - ])# BOOST_CHRONO +# BOOST_CONTEXT([PREFERRED-RT-OPT]) +# ----------------------------------- +# Look for Boost.Context. For the documentation of PREFERRED-RT-OPT, see the +# documentation of BOOST_FIND_LIB above. This library was introduced in Boost +# 1.51.0 +BOOST_DEFUN([Context], +[BOOST_FIND_LIB([context], [$1], + [boost/context/all.hpp],[[ +// creates a stack +void * stack_pointer = new void*[4096]; +std::size_t const size = sizeof(void*[4096]); + +// context fc uses f() as context function +// fcontext_t is placed on top of context stack +// a pointer to fcontext_t is returned +fc = ctx::make_fcontext(stack_pointer, size, f); +return ctx::jump_fcontext(&fcm, fc, 3) == 6;]],[dnl +namespace ctx = boost::context; +// context +static ctx::fcontext_t fcm, *fc; +// context-function +static void f(intptr_t i) { + ctx::jump_fcontext(fc, &fcm, i * 2); +}]) +])# BOOST_CONTEXT + + # BOOST_CONVERSION() # ------------------ # Look for Boost.Conversion (cast / lexical_cast) @@ -534,6 +617,44 @@ ])# BOOST_CONVERSION +# BOOST_COROUTINE([PREFERRED-RT-OPT]) +# ----------------------------------- +# Look for Boost.Coroutine. For the documentation of PREFERRED-RT-OPT, see the +# documentation of BOOST_FIND_LIB above. This library was introduced in Boost +# 1.53.0 +BOOST_DEFUN([Coroutine], +[ +boost_coroutine_save_LIBS=$LIBS +boost_coroutine_save_LDFLAGS=$LDFLAGS +# Link-time dependency from coroutine to context +BOOST_CONTEXT([$1]) +# Starting from Boost 1.55 a dependency on Boost.System is added +if test $boost_major_version -ge 155; then + BOOST_SYSTEM([$1]) +fi +m4_pattern_allow([^BOOST_(CONTEXT|SYSTEM)_(LIBS|LDFLAGS)]) +LIBS="$LIBS $BOOST_CONTEXT_LIBS $BOOST_SYSTEM_LIBS" +LDFLAGS="$LDFLAGS $BOOST_CONTEXT_LDFLAGS" + +BOOST_FIND_LIB([coroutine], [$1], + [boost/coroutine/coroutine.hpp], + [boost::coroutines::coroutine< int(int) > coro; coro.empty();]) + +# Link-time dependency from coroutine to context, existed only in 1.53, in 1.54 +# coroutine doesn't use context from its headers but from its library. +if test $boost_major_version -eq 153 || test $enable_static_boost = yes && test $boost_major_version -ge 154; then + BOOST_COROUTINE_LIBS="$BOOST_COROUTINE_LIBS $BOOST_CONTEXT_LIBS" + BOOST_COROUTINE_LDFLAGS="$BOOST_COROUTINE_LDFLAGS $BOOST_CONTEXT_LDFLAGS" +fi +if test $enable_static_boost = yes && test $boost_major_version -ge 155; then + BOOST_COROUTINE_LIBS="$BOOST_COROUTINE_LIBS $BOOST_SYSTEM_LIBS" + BOOST_COROUTINE_LDFLAGS="$BOOST_COROUTINE_LDFLAGS $BOOST_SYSTEM_LDFLAGS" +fi +LIBS=$boost_coroutine_save_LIBS +LDFLAGS=$boost_coroutine_save_LDFLAGS +])# BOOST_COROUTINE + + # BOOST_CRC() # ----------- # Look for Boost.CRC @@ -564,7 +685,7 @@ # added as of 1.35.0. If we have a version <1.35, we must not attempt to # find Boost.System as it didn't exist by then. if test $boost_major_version -ge 135; then -BOOST_SYSTEM([$1]) + BOOST_SYSTEM([$1]) fi # end of the Boost.System check. boost_filesystem_save_LIBS=$LIBS boost_filesystem_save_LDFLAGS=$LDFLAGS @@ -574,23 +695,34 @@ BOOST_FIND_LIB([filesystem], [$1], [boost/filesystem/path.hpp], [boost::filesystem::path p;]) if test $enable_static_boost = yes && test $boost_major_version -ge 135; then - AC_SUBST([BOOST_FILESYSTEM_LIBS], ["$BOOST_FILESYSTEM_LIBS $BOOST_SYSTEM_LIBS"]) + BOOST_FILESYSTEM_LIBS="$BOOST_FILESYSTEM_LIBS $BOOST_SYSTEM_LIBS" fi LIBS=$boost_filesystem_save_LIBS LDFLAGS=$boost_filesystem_save_LDFLAGS ])# BOOST_FILESYSTEM +# BOOST_FLYWEIGHT() +# ----------------- +# Look for Boost.Flyweight. +BOOST_DEFUN([Flyweight], +[dnl There's a hidden dependency on pthreads. +AC_REQUIRE([_BOOST_PTHREAD_FLAG])dnl +BOOST_FIND_HEADER([boost/flyweight.hpp]) +AC_SUBST([BOOST_FLYWEIGHT_LIBS], [$boost_cv_pthread_flag]) +]) + + # BOOST_FOREACH() # --------------- -# Look for Boost.Foreach +# Look for Boost.Foreach. BOOST_DEFUN([Foreach], [BOOST_FIND_HEADER([boost/foreach.hpp])]) # BOOST_FORMAT() # -------------- -# Look for Boost.Format +# Look for Boost.Format. # Note: we can't check for boost/format/format_fwd.hpp because the header isn't # standalone. It can't be compiled because it triggers the following error: # boost/format/detail/config_macros.hpp:88: error: 'locale' in namespace 'std' @@ -649,9 +781,18 @@ [BOOST_FIND_HEADER([boost/lambda/lambda.hpp])]) +# BOOST_LOCALE() +# -------------- +# Look for Boost.Locale +BOOST_DEFUN([Locale], +[BOOST_FIND_LIB([locale], [$1], + [boost/locale.hpp], + [[boost::locale::generator gen; std::locale::global(gen(""));]]) +])# BOOST_LOCALE + # BOOST_LOG([PREFERRED-RT-OPT]) # ----------------------------- -# Look for Boost.Log For the documentation of PREFERRED-RT-OPT, see the +# Look for Boost.Log. For the documentation of PREFERRED-RT-OPT, see the # documentation of BOOST_FIND_LIB above. BOOST_DEFUN([Log], [BOOST_FIND_LIB([log], [$1], @@ -662,12 +803,12 @@ # BOOST_LOG_SETUP([PREFERRED-RT-OPT]) # ----------------------------------- -# Look for Boost.Log For the documentation of PREFERRED-RT-OPT, see the +# Look for Boost.Log. For the documentation of PREFERRED-RT-OPT, see the # documentation of BOOST_FIND_LIB above. BOOST_DEFUN([Log_Setup], [AC_REQUIRE([BOOST_LOG])dnl BOOST_FIND_LIB([log_setup], [$1], - [boost/log/utility/init/from_settings.hpp], + [boost/log/utility/setup/from_settings.hpp], [boost::log::basic_settings bs; bs.empty();]) ])# BOOST_LOG_SETUP @@ -684,6 +825,29 @@ [BOOST_FIND_HEADER([boost/math/special_functions.hpp])]) +# BOOST_MPI([PREFERRED-RT-OPT]) +# ------------------------------- +# Look for Boost MPI. For the documentation of PREFERRED-RT-OPT, see the +# documentation of BOOST_FIND_LIB above. Uses MPICXX variable if it is +# set, otherwise tries CXX +# +BOOST_DEFUN([MPI], +[boost_save_CXX=${CXX} +boost_save_CXXCPP=${CXXCPP} +if test x"${MPICXX}" != x; then + CXX=${MPICXX} + CXXCPP="${MPICXX} -E" +fi +BOOST_FIND_LIB([mpi], [$1], + [boost/mpi.hpp], + [int argc = 0; + char **argv = 0; + boost::mpi::environment env(argc,argv);]) +CXX=${boost_save_CXX} +CXXCPP=${boost_save_CXXCPP} +])# BOOST_MPI + + # BOOST_MULTIARRAY() # ------------------ # Look for Boost.MultiArray @@ -691,6 +855,14 @@ [BOOST_FIND_HEADER([boost/multi_array.hpp])]) +# BOOST_NUMERIC_UBLAS() +# -------------------------- +# Look for Boost.NumericUblas (Basic Linear Algebra) +BOOST_DEFUN([Numeric_Ublas], +[BOOST_FIND_HEADER([boost/numeric/ublas/vector.hpp]) +])# BOOST_NUMERIC_UBLAS + + # BOOST_NUMERIC_CONVERSION() # -------------------------- # Look for Boost.NumericConversion (policy-based numeric conversion) @@ -713,6 +885,12 @@ [BOOST_FIND_HEADER([boost/preprocessor/repeat.hpp])]) +# BOOST_RANGE() +# -------------------- +# Look for Boost.Range +BOOST_DEFUN([Range], +[BOOST_FIND_HEADER([boost/range/adaptors.hpp])]) + # BOOST_UNORDERED() # ----------------- # Look for Boost.Unordered @@ -759,9 +937,9 @@ _BOOST_PYTHON_CONFIG([LDFLAGS], [ldflags]) _BOOST_PYTHON_CONFIG([LIBS], [libs]) m4_pattern_allow([^BOOST_PYTHON_MODULE$])dnl -BOOST_FIND_LIB([python], [$1], - [boost/python.hpp], - [], [BOOST_PYTHON_MODULE(empty) {}]) +BOOST_FIND_LIBS([python], [python python3], [$1], + [boost/python.hpp], + [], [BOOST_PYTHON_MODULE(empty) {}]) CPPFLAGS=$boost_python_save_CPPFLAGS LDFLAGS=$boost_python_save_LDFLAGS LIBS=$boost_python_save_LIBS @@ -867,19 +1045,18 @@ ])# BOOST_TEST -# BOOST_THREADS([PREFERRED-RT-OPT]) +# BOOST_THREAD([PREFERRED-RT-OPT]) # --------------------------------- # Look for Boost.Thread. For the documentation of PREFERRED-RT-OPT, see the # documentation of BOOST_FIND_LIB above. -# FIXME: Provide an alias "BOOST_THREAD". -BOOST_DEFUN([Threads], +BOOST_DEFUN([Thread], [dnl Having the pthread flag is required at least on GCC3 where dnl boost/thread.hpp would complain if we try to compile without dnl -pthread on GNU/Linux. AC_REQUIRE([_BOOST_PTHREAD_FLAG])dnl -boost_threads_save_LIBS=$LIBS -boost_threads_save_LDFLAGS=$LDFLAGS -boost_threads_save_CPPFLAGS=$CPPFLAGS +boost_thread_save_LIBS=$LIBS +boost_thread_save_LDFLAGS=$LDFLAGS +boost_thread_save_CPPFLAGS=$CPPFLAGS # Link-time dependency from thread to system was added as of 1.49.0. if test $boost_major_version -ge 149; then BOOST_SYSTEM([$1]) @@ -887,36 +1064,26 @@ m4_pattern_allow([^BOOST_SYSTEM_(LIBS|LDFLAGS)$])dnl LIBS="$LIBS $BOOST_SYSTEM_LIBS $boost_cv_pthread_flag" LDFLAGS="$LDFLAGS $BOOST_SYSTEM_LDFLAGS" -# Yes, we *need* to put the -pthread thing in CPPFLAGS because with GCC3, -# boost/thread.hpp will trigger a #error if -pthread isn't used: -# boost/config/requires_threads.hpp:47:5: #error "Compiler threading support -# is not turned on. Please set the correct command line options for -# threading: -pthread (Linux), -pthreads (Solaris) or -mthreads (Mingw32)" CPPFLAGS="$CPPFLAGS $boost_cv_pthread_flag" # When compiling for the Windows platform, the threads library is named # differently. case $host_os in - (*mingw*) - BOOST_FIND_LIB([thread_win32], [$1], - [boost/thread.hpp], [boost::thread t; boost::mutex m;]) - BOOST_THREAD_LDFLAGS=$BOOST_THREAD_WIN32_LDFLAGS - BOOST_THREAD_LDPATH=$BOOST_THREAD_WIN32_LDPATH - BOOST_THREAD_LIBS=$BOOST_THREAD_WIN32_LIBS - ;; - (*) - BOOST_FIND_LIB([thread], [$1], - [boost/thread.hpp], [boost::thread t; boost::mutex m;]) - ;; + (*mingw*) boost_thread_lib_ext=_win32;; esac +BOOST_FIND_LIBS([thread], [thread$boost_thread_lib_ext], + [$1], + [boost/thread.hpp], [boost::thread t; boost::mutex m;]) BOOST_THREAD_LIBS="$BOOST_THREAD_LIBS $BOOST_SYSTEM_LIBS $boost_cv_pthread_flag" BOOST_THREAD_LDFLAGS="$BOOST_SYSTEM_LDFLAGS" BOOST_CPPFLAGS="$BOOST_CPPFLAGS $boost_cv_pthread_flag" -LIBS=$boost_threads_save_LIBS -LDFLAGS=$boost_threads_save_LDFLAGS -CPPFLAGS=$boost_threads_save_CPPFLAGS -])# BOOST_THREADS +LIBS=$boost_thread_save_LIBS +LDFLAGS=$boost_thread_save_LDFLAGS +CPPFLAGS=$boost_thread_save_CPPFLAGS +])# BOOST_THREAD + +AU_ALIAS([BOOST_THREADS], [BOOST_THREAD]) # BOOST_TOKENIZER() @@ -964,7 +1131,8 @@ [BOOST_FIND_HEADER([boost/variant/variant_fwd.hpp]) BOOST_FIND_HEADER([boost/variant.hpp])]) -# BOOST_POINTERCONTAINER() + +# BOOST_POINTER_CONTAINER() # ------------------------ # Look for Boost.PointerContainer BOOST_DEFUN([Pointer_Container], @@ -974,12 +1142,13 @@ BOOST_FIND_HEADER([boost/ptr_container/ptr_array.hpp]) BOOST_FIND_HEADER([boost/ptr_container/ptr_set.hpp]) BOOST_FIND_HEADER([boost/ptr_container/ptr_map.hpp]) -])# BOOST_POINTERCONTAINER +])# BOOST_POINTER_CONTAINER + # BOOST_WAVE([PREFERRED-RT-OPT]) # ------------------------------ # NOTE: If you intend to use Wave/Spirit with thread support, make sure you -# call BOOST_THREADS first. +# call BOOST_THREAD first. # Look for Boost.Wave. For the documentation of PREFERRED-RT-OPT, see the # documentation of BOOST_FIND_LIB above. BOOST_DEFUN([Wave], @@ -1014,8 +1183,16 @@ # _BOOST_PTHREAD_FLAG() # --------------------- -# Internal helper for BOOST_THREADS. Based on ACX_PTHREAD: -# http://autoconf-archive.cryp.to/acx_pthread.html +# Internal helper for BOOST_THREAD. Computes boost_cv_pthread_flag +# which must be used in CPPFLAGS and LIBS. +# +# Yes, we *need* to put the -pthread thing in CPPFLAGS because with GCC3, +# boost/thread.hpp will trigger a #error if -pthread isn't used: +# boost/config/requires_threads.hpp:47:5: #error "Compiler threading support +# is not turned on. Please set the correct command line options for +# threading: -pthread (Linux), -pthreads (Solaris) or -mthreads (Mingw32)" +# +# Based on ACX_PTHREAD: http://autoconf-archive.cryp.to/acx_pthread.html AC_DEFUN([_BOOST_PTHREAD_FLAG], [AC_REQUIRE([AC_PROG_CXX])dnl AC_REQUIRE([AC_CANONICAL_HOST])dnl @@ -1083,6 +1260,14 @@ m4_define([_BOOST_gcc_test], ["defined __GNUC__ && __GNUC__ == $1 && __GNUC_MINOR__ == $2 && !defined __ICC @ gcc$1$2"])dnl +# _BOOST_mingw_test(MAJOR, MINOR) +# ----------------------------- +# Internal helper for _BOOST_FIND_COMPILER_TAG. +m4_define([_BOOST_mingw_test], +["defined __GNUC__ && __GNUC__ == $1 && __GNUC_MINOR__ == $2 && !defined __ICC && \ + (defined WIN32 || defined WINNT || defined _WIN32 || defined __WIN32 \ + || defined __WIN32__ || defined __WINNT || defined __WINNT__) @ mgw$1$2"])dnl + # _BOOST_FIND_COMPILER_TAG() # -------------------------- @@ -1092,7 +1277,8 @@ AC_DEFUN([_BOOST_FIND_COMPILER_TAG], [AC_REQUIRE([AC_PROG_CXX])dnl AC_REQUIRE([AC_CANONICAL_HOST])dnl -AC_CACHE_CHECK([for the toolset name used by Boost for $CXX], [boost_cv_lib_tag], +AC_CACHE_CHECK([for the toolset name used by Boost for $CXX], + [boost_cv_lib_tag], [boost_cv_lib_tag=unknown if test x$boost_cv_inc_path != xno; then AC_LANG_PUSH([C++])dnl @@ -1110,14 +1296,29 @@ # I'm not sure about my test for `il' (be careful: Intel's ICC pre-defines # the same defines as GCC's). for i in \ + _BOOST_mingw_test(5, 0) \ + _BOOST_gcc_test(5, 0) \ + _BOOST_mingw_test(4, 10) \ + _BOOST_gcc_test(4, 10) \ + _BOOST_mingw_test(4, 9) \ + _BOOST_gcc_test(4, 9) \ + _BOOST_mingw_test(4, 8) \ _BOOST_gcc_test(4, 8) \ + _BOOST_mingw_test(4, 7) \ _BOOST_gcc_test(4, 7) \ + _BOOST_mingw_test(4, 6) \ _BOOST_gcc_test(4, 6) \ + _BOOST_mingw_test(4, 5) \ _BOOST_gcc_test(4, 5) \ + _BOOST_mingw_test(4, 4) \ _BOOST_gcc_test(4, 4) \ + _BOOST_mingw_test(4, 3) \ _BOOST_gcc_test(4, 3) \ + _BOOST_mingw_test(4, 2) \ _BOOST_gcc_test(4, 2) \ + _BOOST_mingw_test(4, 1) \ _BOOST_gcc_test(4, 1) \ + _BOOST_mingw_test(4, 0) \ _BOOST_gcc_test(4, 0) \ "defined __GNUC__ && __GNUC__ == 3 && !defined __ICC \ && (defined WIN32 || defined WINNT || defined _WIN32 || defined __WIN32 \ @@ -1183,6 +1384,7 @@ # Thread) flavors of Boost. Sets boost_guess_use_mt accordingly. AC_DEFUN([_BOOST_GUESS_WHETHER_TO_USE_MT], [# Check whether we do better use `mt' even though we weren't ask to. +AC_LANG_PUSH([C++])dnl AC_COMPILE_IFELSE([AC_LANG_PROGRAM([[ #if defined _REENTRANT || defined _MT || defined __MT__ /* use -mt */ @@ -1190,6 +1392,7 @@ # error MT not needed #endif ]])], [boost_guess_use_mt=:], [boost_guess_use_mt=false]) +AC_LANG_POP([C++])dnl ]) # _BOOST_AC_LINK_IFELSE(PROGRAM, [ACTION-IF-TRUE], [ACTION-IF-FALSE]) @@ -1213,11 +1416,11 @@ test -f conftest.$ac_objext && ac_ext=$ac_objext && boost_use_source=false && _AS_ECHO_LOG([re-using the existing conftest.$ac_objext]) AS_IF([_AC_DO_STDERR($ac_link) && { - test -z "$ac_[]_AC_LANG_ABBREV[]_werror_flag" || - test ! -s conftest.err + test -z "$ac_[]_AC_LANG_ABBREV[]_werror_flag" || + test ! -s conftest.err } && test -s conftest$ac_exeext && { - test "$cross_compiling" = yes || - $as_executable_p conftest$ac_exeext + test "$cross_compiling" = yes || + $as_executable_p conftest$ac_exeext dnl FIXME: use AS_TEST_X instead when 2.61 is widespread enough. }], [$2], diff -Nru gnote-3.14.2/NEWS gnote-3.16.0/NEWS --- gnote-3.14.2/NEWS 2015-01-17 15:07:58.000000000 +0000 +++ gnote-3.16.0/NEWS 2015-03-29 20:09:35.000000000 +0000 @@ -1,35 +1,59 @@ -3.14.2 - "Successful and fortunate crime is called virtue" - 2015/01/17 +3.16.0 - "If you continually give you will continually have" - 2015/03/29 -Fixes: - * Fix crash when disabling note actions (#742657) +New Features: + * Updated manual Translations: + * New translations: + - Bosnian (bs) + - Slovak (sk) * Updated translations: - - Brazilian Portuguese (pt_BR) + - Swedish (sv) + * Updated manuals: - Czech (cs) - - German (de) - - Hungarian (hu) - - Indonesian (id) - - Kannada (kn) - Lithuanian (lt) - - Polish (pl) - - Serbian (sr) + - Spanish (es) + - Swedish (sv) -3.14.1 - "The clash of ideas is the sound of freedom" - 2014/12/06 +3.15.1 - 2015/03/07 New Features: + * Manual updates + Fixes: - * Manual spelling fixes (#700422) - * TOC licence notice fixes (#737918) + * Updated boost.m4 (#745160) Translations: * Updated translations: - - Brazilian Portuguese (pr_BR) + - Brazilian Portuguese (pt_BR) + +3.15.0 - 2015/02/16 + +New Features: + * Remove status icon + * Remove builtin key binding + * Move notebook selection from toolbar to action menu + +Fixes: + * Manual fixes (#700422) + * TOC copyright notice fixes (#737918) + * Fix some typos + * Fix crash when disabling note actions (#742657) + * Fix toolbar in note view + +Translations: + * Updated translations: + - Basque (eu) + - Brazilian Portuguese (pt_BR) - Czech (cs) - - German (de) - - Gujarati (gu) - - Serbian (sr) + - Hungarian (hu) + - Kannada (kn) + - Lithuanian (lt) + - Polish (pl) + - Serbian (sr, sr@latin) + - Turkish (tr) * Updated Czech manual (cs) + * Updated Spanish manual (es) 3.14.0 - "System is only as robust as its least reliable component" - 2014/09/26 diff -Nru gnote-3.14.2/po/bs.po gnote-3.16.0/po/bs.po --- gnote-3.14.2/po/bs.po 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/po/bs.po 2015-03-26 20:50:43.000000000 +0000 @@ -0,0 +1,2651 @@ +# Bosnian translation for bosnianuniversetranslation +# Copyright (c) 2014 Rosetta Contributors and Canonical Ltd 2014 +# This file is distributed under the same license as the bosnianuniversetranslation package. +# FIRST AUTHOR , 2014. +# +msgid "" +msgstr "" +"Project-Id-Version: bosnianuniversetranslation\n" +"Report-Msgid-Bugs-To: http://bugzilla.gnome.org/enter_bug.cgi?" +"product=gnote&keywords=I18N+L10N&component=general\n" +"POT-Creation-Date: 2015-02-26 21:33+0000\n" +"PO-Revision-Date: 2015-02-27 10:28+0100\n" +"Last-Translator: Samir Ribic \n" +"Language-Team: Bosnian \n" +"Language: bs\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Plural-Forms: nplurals=3; plural=n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%" +"10<=4 && (n%100<10 || n%100>=20) ? 1 : 2;\n" +"X-Generator: Launchpad (build 17341)\n" +"X-Launchpad-Export-Date: 2015-02-15 06:11+0000\n" + +#: ../data/appdata/gnote.appdata.xml.in.h:1 +msgid "" +"Gnote is a simple note-taking application for GNOME desktop environment. It " +"allows you to capture your ideas, link them together using WikiWiki-style " +"links, group together in notebooks and some extra features for everyday use." +msgstr "" +"Gnote je jednostavna aplikacija za smještanje bilježaka za GNOME radno " +"okruženje. Omogućuje vam da sačuvate vaše ideje, spojite ih koristeći " +"WikiWiki-stil linkove, grupišete ih zajedno u sveske i jos dodatnih " +"mogućnosti za svakodnevnu upotrebu." + +#: ../data/appdata/gnote.appdata.xml.in.h:2 +msgid "" +"Gnote also supports synchronization to make it possible to use on multiple " +"devices." +msgstr "" +"Gnote takođe podržava sinhronizaciju kako bi bilo moguće korištenje na više " +"uređaja." + +#: ../data/gnote.desktop.in.in.h:1 ../src/recentchanges.cpp:45 +#: ../src/recentchanges.cpp:479 +msgid "Gnote" +msgstr "Gnote" + +#: ../data/gnote.desktop.in.in.h:2 +msgid "Take notes, link ideas, and stay organized" +msgstr "Hvatajte bilješke, povezujte ideje i ostanite organizovani" + +#: ../data/gnote.desktop.in.in.h:3 +msgid "Note-taker" +msgstr "Pisanje napomena" + +#: ../data/gnote.desktop.in.in.h:4 +msgid "notes;idea;link;organize;" +msgstr "bilješke;ideja;link;organizer;" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:1 +msgid "Enable spellchecking" +msgstr "Omogući provjeru pravopisa" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:2 +msgid "" +"If true, misspellings will be underlined in red, and correct spelling " +"suggestions shown in the right-click menu." +msgstr "" +"Ako je uključeno, neispravno napisane riječi će biti crveno podvučene, sa " +"prijedlozima koji se pojavljuju u meniju po desnom kliku na riječ." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:3 +msgid "Automatically create links when typing" +msgstr "Automatski kreirati link prilikom unosa" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:4 +msgid "" +"Enable this option to automatically create a link, when text matches note " +"title." +msgstr "" +"Omogućiti ovu opciju za automatsko kreiranje linka, kada tekst odgovara " +"naslovu bilješke." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:5 +msgid "Create links for URLs in notes" +msgstr "Kreirati URL linkove u bilješkama" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:6 +msgid "Enable this option to create links for URLs in notes." +msgstr "Omogućiti ovu opciju za kreiranje URL linkova u bilješkama." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:7 +msgid "Enable WikiWord highlighting" +msgstr "Omogući obilježavanje Wiki riječi" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:8 +msgid "" +"Enable this option to highlight words ThatLookLikeThis. Clicking the word " +"will create a note with that name." +msgstr "" +"Omogućite ovu opciju za obilježavanje riječi KojeIzgledajuOvako. Klik iznad " +"riječi će tada napraviti novu bilješku sa tim imenom." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:9 +msgid "Enable Auto bulleted lists" +msgstr "Omogući automatski nabrojene liste" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:10 +msgid "" +"Enable this option if you want bulleted lists to be automatic when you place " +"- or * at the beginning of a line." +msgstr "" +"Uključite opciju da bi omogućili automatsko pravljenje listi kada se ukuca " +"„-“ ili „*“ na početku reda." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:11 +msgid "Enable Middle-Click Paste On Icon" +msgstr "Omogući lijepljenje srednjim klikom na ikonu" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:12 +msgid "" +"Enable this option if you want to be able to middle-click the Gnote icon to " +"paste timestamped content into the Start Here note." +msgstr "" +"Omogući ovu opciju ako želis da srednjim klikom na ikonu Gnote nalijepis " +"zapamćeni sadržaj u bilješku Počni ovdje." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:13 +msgid "Enable custom font" +msgstr "Omogući poseban slovni lik" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:14 +msgid "" +"If true, the font name set in custom-font-face will be used as the font when " +"displaying notes. Otherwise the desktop default font will be used." +msgstr "" +"Ako je tačno, ime fonta postavljeno u prilagođeni-font će biti korišteno kao " +"font kada se prikazuju bilješke. U suprotnom, standardni font radnog " +"okruženja će biti korišten." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:15 +msgid "Custom Font Face" +msgstr "Poseban slovni lik" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:16 +msgid "" +"If enable-custom-font is true, the font name set here will be used as the " +"font when displaying notes." +msgstr "" +"Ako je omogući-prilagođeni-font tačno, ime fonta postavljeno ovdje će biti " +"korišteno kao font kada se prikazuju bilješke." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:17 +msgid "Enable global keybindings" +msgstr "Omogući prečice sa tastature" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:18 +msgid "" +"If true, the desktop-global keybindings set in /org/gnome/gnote/global-" +"keybindings will be enabled, allowing for useful Gnote actions to be " +"available from any application." +msgstr "" +"Ako je tačno, globalni tasteri radnog okruženja postavljeni u /org/gnome/" +"gnote/global-keybindings će biti omogućeni, omogućujući korisnim Gnote " +"radnjama da budu dostupne iz bilo koje aplikacije." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:19 +msgid "Start Here Note" +msgstr "Bilješka za početnu stanicu" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:20 +msgid "" +"The note URI of the note that should be considered the \"Start Here\" note, " +"which is always placed at the bottom of the Gnote note menu and also " +"accessible by hotkey." +msgstr "" +"URI bilješke od bilješke koja se smatra početnom bilješkom, koja je uvijek " +"postavljena na dno Gnote menija i takođje dostupna preko tastera prečice." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:21 +msgid "Minimum number of notes to show in menu" +msgstr "Minimalan broj bilješki za prikaz u meniju" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:22 +msgid "" +"Integer determining the minimum number of notes to show in the Gnote note " +"menu." +msgstr "" +"Broj koji određuje minimalan broj bilješki koje trebaju da se pokažu u Gnote " +"meniju." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:23 +msgid "List of pinned notes" +msgstr "Lista pinovanih bilješki" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:24 +msgid "" +"Whitespace-separated list of note URIs for notes that should always appear " +"in the Gnote note menu." +msgstr "" +"Lista URI bilješki odvojena razmacima za bilješke koje trebaju uvijek biti " +"prikazane u Gnote meniju." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:25 +msgid "Is main window maximized" +msgstr "Da li je glavni prozor uvećan" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:26 +msgid "If true, Gnote window will be maximized." +msgstr "Ako je tačno, Gnote prozor će biti uvećan." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:27 +msgid "Saved height of Search window" +msgstr "Sačuvana visina prozora za pretragu" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:28 +msgid "Determines pixel height of Search window; stored on Gnote exit." +msgstr "" +"Određuje dužinu piksela prozora Pretraga; snimljeno na izlazu iz Gnote." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:29 +msgid "Saved width of Search window" +msgstr "Sačuvana širina prozora za pretragu" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:30 +msgid "Determines pixel width of Search window; stored on Gnote exit." +msgstr "" +"Određuje širinu piksela prozora Pretraga; snimljeno na izlazu iz Gnote." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:31 +msgid "Saved splitter position of Search window splitter." +msgstr "Snimljena pozicija splitera od prozora Pretraga." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:32 +msgid "" +"Determines Search window splitter position in pixels; stored on Gnote exit." +msgstr "" +"Određuje poziciju splitera od prozora Pretraga u pikselima; snimljeno na " +"izlazu iz Gnote." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:33 +msgid "Saved sorting of the Search window." +msgstr "Snimljeno sortiranje prozora Pretraga." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:34 +msgid "Determines Search window initial sorting." +msgstr "Određuje početno sortiranje prozora Pretraga." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:35 +msgid "FUSE Mounting Timeout (ms)" +msgstr "Vrijeme isteka FUSE montiranja (ms)" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:36 +msgid "" +"Time (in milliseconds) Gnote should wait for a response when using FUSE to " +"mount a sync share." +msgstr "" +"Vrijeme ( u milisekundama) koliko Gnote treba da sačeka na odgovor kada " +"koristi FUSE da montira sinhronizovano dijeljenje." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:37 +msgid "SSHFS Remote Synchronization Folder" +msgstr "SSHFS udaljeni direktorij za usklađivanje" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:38 +msgid "Path on SSH server to Gnote synchronization directory (optional)." +msgstr "" +"Putanja na SSH serveru do Gnote direktorija za sinhronizaciju (opcionalno)." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:39 +msgid "SSHFS Synchronization Server URL" +msgstr "SSHFS adresa za udaljeno usklađivanje" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:40 +msgid "URL of SSH server containing Gnote synchronization directory." +msgstr "URL od SSH servera koji sadrži Gnote direktorij za sinhronizaciju." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:41 +msgid "SSHFS Remote Synchronization User Name" +msgstr "SSHFS korisničko ime za udaljeno usklađivanje" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:42 +msgid "User name to use when connecting to the synchronization server via SSH." +msgstr "" +"Korisničko ime za korišćenje prilikom povezivanja na server za usklađivanje " +"preko SSH protokola." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:43 +msgid "SSHFS Synchronization Server Port" +msgstr "SSHFS port za udaljeno usklađivanje" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:44 +msgid "The port to use when connecting to the synchronization server via SSH." +msgstr "" +"Port koji se koristi kada se konektuje na server za sinhronizaciju putem SSH." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:45 +msgid "Link Updating Behavior on Note Rename" +msgstr "Ponašanje za ažuriranje veza pri preimenovanju bilješke" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:46 +msgid "" +"Integer value indicating if there is a preference to always perform a " +"specific link updating behavior when a note is renamed, instead of prompting " +"the user. The values map to an internal enumeration. 0 indicates that the " +"user wishes to be prompted when renaming a note may impact links that exist " +"in other notes. 1 indicates that links should automatically be removed. 2 " +"indicates that link text should be updated to the new note name so that it " +"will continue linking to the renamed note." +msgstr "" +"Cio broj koji određuje da li je poželjno da se uvijek primjenjuje neko " +"određeno ažuriranje veza kada se bilješka preimenuje, umjesto da se pita " +"korisnik. Brojevi imaju svoju internu predstavu. 0 znači da korisnik želi da " +"bude pitan kada se preimenuje bilješka koja ima druge bilješke koje imaju " +"veze ka njoj. 1 znači da se sve veze automatski uklanjaju. 2 znači da tekst " +"veze treba ažurirati na novo ime bilješke tako da veza ka preimenovanoj " +"belešci nastavi da postoji." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:47 +msgid "Enable closing notes with escape" +msgstr "Omogući zatvaranje bilješki sa tasterom escape." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:48 +msgid "If enabled, an opened note can be closed by hitting the escape key." +msgstr "" +"Ako je uključeno otvorena bilješka može biti zatvorena pritiskom na tipku " +"Esc." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:49 +msgid "Use status icon, when started as an application" +msgstr "Koristi statusnu ikonu, kada je pokrenuto kao aplikacija" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:50 +msgid "Deprecated, has no effect." +msgstr "Zastarjelo, nema efekta" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:51 +msgid "Open notes in new window" +msgstr "Otvori bilješke u novom prozoru" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:52 +msgid "" +"Open notes in new window instead of replacing active content of the same " +"window" +msgstr "" +"Otvori bilješke u novom prozoru umjesto premještanja aktivnog sadržaja u " +"istom prozoru" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:53 +msgid "Save note window size and autosize note window to it" +msgstr "" +"Spremi veličinu prozora bilješke i automatski prilagodi zabilješku prozoru" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:54 +msgid "" +"Saves note window size and automatically resizes main window to this size, " +"when note is opened." +msgstr "" +"Spremi veličinu prozora bilješke i automatski prilagodi zabilješku prozoru, " +"kada je bilješka otvorena." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:55 +msgid "Show applet menu" +msgstr "Prikaži meni programčeta" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:56 +msgid "Open Start Here" +msgstr "Otvori početnu stanicu" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:57 +msgid "Create a new Note" +msgstr "Napravi novu bilješku" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:58 +msgid "Open Search Dialog" +msgstr "Otvori prozorčić za pretragu" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:59 +msgid "Open Recent Changes" +msgstr "Otvori skorašnje izmjene" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:60 +msgid "HTML Export Last Directory" +msgstr "Posljednji direktorijum za HTML izvoz" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:61 +msgid "" +"The last directory a note was exported to using the Export To HTML plugin." +msgstr "" +"Posljednji direktorijum u koji je bilješka izvezena kroz dodatak za izvoz u " +"HTML." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:62 +msgid "HTML Export Linked Notes" +msgstr "Povezane bilješke u HTML izvozu" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:63 +msgid "" +"The last setting for the 'Export linked notes' checkbox in the Export to " +"HTML plugin." +msgstr "" +"Posljednje podešavanje za 'Izvezi povezane bilješke' u dodatku za izvoz u " +"HTML." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:64 +msgid "HTML Export All Linked Notes" +msgstr "HTML izvozi povezane bilješke" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:65 +msgid "" +"The last setting for the 'Include all other linked notes' checkbox in the " +"Export to HTML plugin. This setting is used in conjunction with the 'HTML " +"Export Linked Notes' setting and is used to specify whether all notes (found " +"recursively) should be included during an export to HTML." +msgstr "" +"Posljednje podešavanje za 'Izvezi sve druge povezane bilješke' u dodatku za " +"izvoz u HTML. Ovo podešavanje se koristi skupa sa 'HML izvozi povezane " +"bilješke' podešavanjem, a određuje da li sve bilješke (rekurzivno otkrivene) " +"trebaju biti uključene pri izvozu u HTML." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:66 +msgid "Synchronization Client ID" +msgstr "ID klijenta za servis usklađivanja" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:67 +msgid "" +"Unique identifier for this Gnote client, used when communicating with a " +"synchronization server." +msgstr "" +"Jedinstveni indentifikator za ovaj Gnote klijent, korišten pri komunikaciji " +"sa sinhronizacijskim serverom." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:68 +msgid "Synchronization Local Server Path" +msgstr "Lokalna putanja do servera za usklađivanje" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:69 +msgid "" +"Path to the synchronization server when using the filesystem synchronization " +"service addin." +msgstr "" +"Putanja do servera za usklađivanje kada se koristi dodatkak za usklađivanje " +"preko sistema datoteka." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:70 +msgid "Selected Synchronization Service Addin" +msgstr "Odabrani dodatak za servis usklađivanja" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:71 +msgid "" +"Unique identifier for the currently configured note synchronization service " +"addin." +msgstr "Jedinstvena oznaka za odabrani dodatak za usklađivanje bilješki." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:72 +msgid "Note Synchronization Conflict Saved Behavior" +msgstr "Ponašanje u slučaju sukoba pri usklađivanju bilješki" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:73 +msgid "" +"Integer value indicating if there is a preference to always perform a " +"specific behavior when a conflict is detected, instead of prompting the " +"user. The values map to an internal enumeration. 0 indicates that the user " +"wishes to be prompted when a conflict occurs, so that they may handle each " +"conflict situation on a case-by-case basis." +msgstr "" +"Cio broj koji određuje ponašanje pri detektovanom sukobu umjesto da se o " +"tome pita korisnik. Vrijednosti se preslikavaju na internu numeraciju " +"ponašanja. Vrijednost „0“ određuje da treba pitati korisnika tako da se " +"problemi rješavaju od slučaja do slučaja." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:74 +msgid "Automatic Background Synchronization Timeout" +msgstr "Vremensko ograničenje automatske pozadinske sinhronizacije" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:75 +msgid "" +"Integer value indicating how frequently to perform a background sync of your " +"notes (when sync is configured). Any value less than 1 indicates that " +"autosync is disabled. The lowest acceptable positive value is 5. Value is in " +"minutes." +msgstr "" +"Cio broj koji određuje koliko često da se izvršava sinhronizacija vaših " +"beleški u pozadini (ako se ona koristi). Svaka vrijednost manja od 1 znači " +"da je sinhronizacija isključena. Najmanja prihvatljiva vrijednost je 5. " +"Vrijednost je u minutima." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:76 +msgid "Accept SSL Certificates" +msgstr "Prihvatanje SSL sertifikata" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:77 +msgid "" +"Use wdfs option \"-ac\" to accept SSL certificates without prompting the " +"user." +msgstr "" +"Korišćenje „-ac“opcije wdfs-a za prihvatanje SSL sertifikata bez pitanja " +"korisnika." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:78 +msgid "Share URL" +msgstr "URL djeljenja" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:79 +msgid "WebDAV share URL where notes are synchronized to." +msgstr "WebDAV dijeljeni URL kada je sinhronizovan sa bilješkama." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:80 +msgid "Share username" +msgstr "Dijeli korisničko ime" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:81 +msgid "Username to access WebDAV share." +msgstr "Korisničko ime za pristup WebDAV dijeljenju." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:82 +msgid "Timestamp format" +msgstr "Zapis datuma i vremena" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:83 +msgid "" +"The date format that is used for the timestamp. It follows the format of " +"strftime(3)." +msgstr "" +"Format datuma koji je korištem za prikaz datuma. Prati format strftime(3)." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:84 +msgid "Time between checks" +msgstr "Vrijeme između provjera" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:85 +msgid "" +"Time interval between note directory checks (in seconds). Min value is 5." +msgstr "" +"Vremenski interval podsjetnika provjere bilješke (u sekundama). Minimalna " +"vrijednost je 5." + +#: ../src/actionmanager.cpp:84 ../src/actionmanager.cpp:171 +msgid "_Quit" +msgstr "_Odustani" + +#: ../src/actionmanager.cpp:84 +msgid "Quit Gnote" +msgstr "Izađi iz Gnote" + +#: ../src/actionmanager.cpp:89 ../src/actionmanager.cpp:168 +msgid "_Preferences" +msgstr "_Karakteristike" + +#: ../src/actionmanager.cpp:89 ../src/preferencesdialog.cpp:103 +msgid "Gnote Preferences" +msgstr "Gnote Karakteristike" + +#: ../src/actionmanager.cpp:93 +msgid "_Contents" +msgstr "_Sadržaj" + +#: ../src/actionmanager.cpp:93 +msgid "Gnote Help" +msgstr "Gnote Pomoć" + +#: ../src/actionmanager.cpp:98 ../src/actionmanager.cpp:170 +msgid "_About" +msgstr "_O programu" + +#: ../src/actionmanager.cpp:98 +msgid "About Gnote" +msgstr "O Gnote" + +#: ../src/actionmanager.cpp:102 +msgid "TrayIcon" +msgstr "Ikonica u panelu" + +#: ../src/actionmanager.cpp:107 +msgid "Create _New Note" +msgstr "Napravi _novu bilješku" + +#: ../src/actionmanager.cpp:107 +msgid "Create a new note" +msgstr "Napravi novu bilješku" + +#: ../src/actionmanager.cpp:112 +msgid "_Search All Notes" +msgstr "_Traži kroz sve bilješke" + +#: ../src/actionmanager.cpp:112 +msgid "Open the Search All Notes window" +msgstr "Otvori prozor za pretragu kroz sve bilješke" + +#: ../src/actionmanager.cpp:166 +msgid "_New Note" +msgstr "_Nova bilješka" + +#: ../src/actionmanager.cpp:167 +msgid "New _Window" +msgstr "Novi _prozor" + +#: ../src/actionmanager.cpp:169 +msgid "_Help" +msgstr "_Pomoc" + +#: ../src/addininfo.cpp:74 +msgid "Failed to load plugin information!" +msgstr "Neuspješno učitavanje informacija o pluginu!" + +#: ../src/addininfo.cpp:124 +#, c-format +msgid "Incompatible plug-in %s: expected %s, got %s" +msgstr "Nekompaktibilan dodatak %s: očekuje %s, dobije %s" + +#: ../src/addinmanager.cpp:133 +#, c-format +msgid "Note plugin info %s already present" +msgstr "Info plugin za bilješke %s već prisutan." + +#: ../src/addinmanager.cpp:141 +#, c-format +msgid "%s does not implement %s" +msgstr "%s ne implementira %s" + +#: ../src/addinmanager.cpp:156 +#, c-format +msgid "Note plugin %s already present" +msgstr "Plugin za bilješke %s već prisutan." + +#: ../src/addinmanager.cpp:174 +#, c-format +msgid "Note plugin info %s is absent" +msgstr "Info plugin za bilješke %s je odsutan." + +#: ../src/addinmanager.cpp:187 +#, c-format +msgid "Note plugin %s is absent" +msgstr "Info plugin za bilješke %s je odsutan" + +#: ../src/addinmanager.cpp:224 +#, c-format +msgid "Failed to find module %s for addin %s" +msgstr "Modul %s za dodatak %s nije pronađen" + +#: ../src/addinmanager.cpp:228 +#, c-format +msgid "Failed to load addin info for %s: %s" +msgstr "Informacije u dodatku za %s : %s neuspješno učitane" + +#: ../src/addinmanager.cpp:352 +msgid "Trying to load addins when they are already loaded" +msgstr "Pokušavam da učitam dodatke kada su oni već učitani" + +#: ../src/addins/backlinks/backlinkmenuitem.cpp:41 +msgid "What links here?" +msgstr "Šta vodi ovamo?" + +#: ../src/addins/backlinks/backlinkmenuitem.cpp:42 +msgid "Which notes have links to here?" +msgstr "Koje bilješke imaju linkove do ovdje?" + +#: ../src/addins/backlinks/backlinks.desktop.in.in.h:1 +msgid "Backlinks" +msgstr "Povratni linkovi" + +#: ../src/addins/backlinks/backlinks.desktop.in.in.h:2 +msgid "See which notes link to the one you're currently viewing." +msgstr "Vidi koje bilješke vode do one koju trenutno gledate." + +#: ../src/addins/backlinks/backlinks.desktop.in.in.h:3 +#: ../src/addins/inserttimestamp/inserttimestamp.desktop.in.in.h:3 +msgid "Hubert Figuiere and Tomboy Project" +msgstr "Hubert Figuiere i Tomboy Projekat." + +#: ../src/addins/backlinks/backlinksnoteaddin.cpp:86 +msgid "(none)" +msgstr "(nijedan)" + +#: ../src/addins/bugzilla/bugzilla.desktop.in.in.h:1 +msgid "Bugzilla Links" +msgstr "Bugzilla Linkovi" + +#: ../src/addins/bugzilla/bugzilla.desktop.in.in.h:2 +msgid "" +"Allows you to drag a Bugzilla URL from your browser directly into a Gnote " +"note. The bug number is inserted as a link with a little bug icon next to " +"it." +msgstr "" +"Omogućuje da prevučete bubaždaja URL iz vašeg pretraživača direktno na Gnote " +"bilješku. Buba broj je umetnut kao link sa malom ikonom bube pored." + +#: ../src/addins/bugzilla/bugzilla.desktop.in.in.h:3 +#: ../src/addins/exporttohtml/exporttohtml.desktop.in.in.h:3 +#: ../src/addins/fixedwidth/fixedwidth.desktop.in.in.h:3 +#: ../src/addins/printnotes/printnotes.desktop.in.in.h:3 +#: ../src/addins/stickynoteimport/stickynoteimport.desktop.in.in.h:3 +msgid "Hubert Figuiere and the Tomboy Project" +msgstr "Hubert Figuiere i the Tomboy Projekat." + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:64 +msgid "" +"You can use any bugzilla just by dragging links into notes. If you want a " +"special icon for certain hosts, add them here." +msgstr "" +"Možeš koristiti bilo koju bubaždaju prevlačenjem veze ka stranici u " +"bilješku. Ako želiš posebnu ikonicu za određene adrese, dodaj ih ovdje." + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:81 +msgid "Host Name" +msgstr "Ime domaćinskog uređaja" + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:94 +msgid "Icon" +msgstr "Ikona" + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:229 +msgid "Select an icon..." +msgstr "Odaberi ikonicu..." + +#. Extra Widget +#: ../src/addins/bugzilla/bugzillapreferences.cpp:244 +msgid "_Host name:" +msgstr "_Ime računara:" + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:278 +msgid "Host name invalid" +msgstr "Ime računara neispravno" + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:279 +msgid "You must specify a valid Bugzilla host name to use with this icon." +msgstr "" +"Morate odrediti ispravno bubaždaja ime domaćina za korištenje sa ovom ikonom." + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:298 +msgid "Error saving icon" +msgstr "Greška pri čuvanju ikonice" + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:299 +msgid "Could not save the icon file." +msgstr "Ne mogu da sačuvam datoteku sa ikonicom." + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:371 +msgid "Really remove this icon?" +msgstr "Zaista želiš da obrišeš ovu ikonicu?" + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:372 +msgid "If you remove an icon it is permanently lost." +msgstr "Ako je obrišeš ona će zauvijek biti izgubljena." + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:394 +#, c-format +msgid "Error removing icon %s: %s" +msgstr "Greška pri brisanju ikone %s: %s" + +#: ../src/addins/exporttogtg/exporttogtg.desktop.in.in.h:1 +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:71 +msgid "Export to Getting Things GNOME" +msgstr "Izvoz prema Getting Things GNOME" + +#: ../src/addins/exporttogtg/exporttogtg.desktop.in.in.h:2 +msgid "Exports individual notes as Getting Things GNOME tasks" +msgstr "Izvoz pojedinačnih bilješki kao Getting Things GNOME zadatci" + +#: ../src/addins/exporttogtg/exporttogtg.desktop.in.in.h:3 +#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:3 +#: ../src/addins/statistics/statistics.desktop.in.in.h:3 +msgid "Aurimas Černius" +msgstr "Aurimas Černius" + +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:72 +msgid "Export note as Getting Things GNOME task" +msgstr "Izvoz bilješke kao Getting Things GNOME zadatak" + +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:86 +msgid "GTG XML loaded, but interface not found" +msgstr "GTG XML učitan, ali sučelje nije nađeno" + +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:92 +#, c-format +msgid "Failed to create GTG interface from XML: %s" +msgstr "Nije uspjelo kreiranje GTG sučelja iz XML: %s" + +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:100 +msgid "Failed to create D-Bus proxy for GTG" +msgstr "Nije uspjelo kreiranje D-Bus proxy za GTG" + +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:116 +#, c-format +msgid "Failed to call GTG: %s" +msgstr "Nije uspio poziv GTG: %s" + +#: ../src/addins/exporttohtml/exporttohtml.desktop.in.in.h:1 +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:76 +msgid "Export to HTML" +msgstr "Izvezi u HTML" + +#: ../src/addins/exporttohtml/exporttohtml.desktop.in.in.h:2 +msgid "Exports individual notes to HTML." +msgstr "Izvezi pojedinačne bilješke u HTML." + +#: ../src/addins/exporttohtml/exporttohtmldialog.cpp:41 +msgid "Destination for HTML Export" +msgstr "Odredište izvoza u HTML" + +#: ../src/addins/exporttohtml/exporttohtmldialog.cpp:43 +msgid "Export linked notes" +msgstr "Izvezi povezane bilješke" + +#: ../src/addins/exporttohtml/exporttohtmldialog.cpp:44 +msgid "Include all other linked notes" +msgstr "Uključi sve druge povezane bilješke" + +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:77 +msgid "Export note to HTML" +msgstr "Izvezi biljesku u HTML" + +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:117 +#, c-format +msgid "Could not open exported note in a web browser: %s" +msgstr "Otvaranje izvezene bilješke u pretraživaču: %s nije uspjelo" + +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:121 +msgid "Your note was exported to \"%1%\"." +msgstr "Vaša bilješka je izvezena u \"%1%\"." + +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:130 +msgid "Note exported successfully" +msgstr "Bilješka je uspješno izvezena" + +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:144 +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:152 +#, c-format +msgid "Could not export: %s" +msgstr "Ne mogu da izvezem : %s" + +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:155 +#, c-format +msgid "Could not save the file \"%s\"" +msgstr "Ne mogu da sačuvam datoteku \"%s\"" + +#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:102 +msgid "_Folder Path:" +msgstr "_Putanja fascikle:" + +#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:109 +msgid "Select Synchronization Folder..." +msgstr "Odaberi direktorij za usklađivanje..." + +#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:134 +msgid "Folder path field is empty." +msgstr "Polje za putanju direktorija je prazno." + +#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:141 +msgid "" +"Specified folder path does not exist, and Gnote was unable to create it." +msgstr "" +"Odabrana putanja direktorija ne postoji, i Gnote nije mogao da je napravi." + +#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:217 +msgid "Local Folder" +msgstr "Lokalni direktorij" + +#: ../src/addins/filesystemsyncservice/filesystemsyncservice.desktop.in.in.h:1 +msgid "Local Directory Sync Service Plugin" +msgstr "Servisni plugin lokalnog direktorija za usklađivanje" + +#: ../src/addins/filesystemsyncservice/filesystemsyncservice.desktop.in.in.h:2 +msgid "Synchronize Gnote Notes to a local file system path" +msgstr "Uskladi Gnote bilješke sa putanjom lokalne sitemske datoteke" + +#: ../src/addins/filesystemsyncservice/filesystemsyncservice.desktop.in.in.h:3 +#: ../src/addins/webdavsyncservice/webdavsyncservice.desktop.in.in.h:3 +msgid "Aurimas Černius and the Tomboy Project" +msgstr "Aurimas Černius i the Tomboy Projekat" + +#: ../src/addins/fixedwidth/fixedwidth.desktop.in.in.h:1 +msgid "Fixed Width" +msgstr "Stalna širina" + +#: ../src/addins/fixedwidth/fixedwidth.desktop.in.in.h:2 +msgid "Adds fixed-width font style." +msgstr "Dodaje stalna-širina stil fonta." + +#: ../src/addins/fixedwidth/fixedwidthmenuitem.cpp:35 +msgid "Fixed Wid_th" +msgstr "_Fiksna širina" + +#: ../src/addins/inserttimestamp/inserttimestamp.desktop.in.in.h:1 +#: ../src/addins/inserttimestamp/inserttimestampnoteaddin.cpp:45 +msgid "Insert Timestamp" +msgstr "Umetni datum i vrijeme" + +#: ../src/addins/inserttimestamp/inserttimestamp.desktop.in.in.h:2 +msgid "Inserts current date and time at the cursor position." +msgstr "Umeće trenutni datum i vrijeme na poziciju kursora." + +#: ../src/addins/inserttimestamp/inserttimestampnoteaddin.cpp:46 +msgid "Insert Timestamp into note" +msgstr "Umetni datum i vrijeme u bilješku" + +#. Label +#: ../src/addins/inserttimestamp/inserttimestamppreferences.cpp:70 +msgid "Choose one of the predefined formats or use your own." +msgstr "Odaberite neki od ponuđenih zapisa ili unesite novi." + +#: ../src/addins/inserttimestamp/inserttimestamppreferences.cpp:78 +msgid "Use _Selected Format" +msgstr "Koristi _odabrani zapis" + +#: ../src/addins/inserttimestamp/inserttimestamppreferences.cpp:110 +msgid "_Use Custom Format" +msgstr "Koristi poseban _zapis" + +#. TRANSLATORS: first %s is file nami, second is error +#: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:236 +#, c-format +msgid "NoteDirectoryWatcher: Update aborted, error reading %s: %s" +msgstr "" +"NadzornikDirektorijaBilješke: Ažuriranje prekinuto, greška pri čitanju %s: %s" + +#. TRANSLATORS: %s is file +#: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:263 +#, c-format +msgid "NoteDirectoryWatcher: Error reading note title from %s" +msgstr "" +"NadzornikDirektorijaBilješke: Greška pri čitanju naslova bilješke iz %s" + +#. TRANSLATORS: %s is file +#: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:271 +#, c-format +msgid "NoteDirectoryWatcher: Unknown error creating note from %s" +msgstr "" +"NadzornikDirektorijaBilješke: Nepoznata greška pri stvaranju bilješke iz %s" + +#. TRANSLATORS: first %s is file, second is error +#: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:277 +#, c-format +msgid "NoteDirectoryWatcher: Error creating note from %s: %s" +msgstr "NadzornikDirektorijaBilješke: Greška pri stvaranju bilješke iz %s: %s" + +#. TRANSLATORS: first %s is file, second is error +#: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:290 +#, c-format +msgid "NoteDirectoryWatcher: Update aborted, error parsing %s: %s" +msgstr "" +"NadzornikDirektorijaBilješke: Ažuriranje prekinuto, greška pri parsiranju %" +"s: %s" + +#: ../src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in.in.h:1 +msgid "Note Directory Watcher" +msgstr "Nadzornik Direktorija Bilješke" + +#: ../src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in.in.h:2 +msgid "Watch your Gnote note directory for changes to your notes." +msgstr "Pazite na vaš Gnote direktorij bilješke za promjene vaših bilješki." + +#: ../src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in.in.h:3 +msgid "Aurimas Černius and Tomboy original authors" +msgstr "Aurimas Černius i Tomboy originalni autori" + +#: ../src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp:35 +msgid "_Directory check interval:" +msgstr "_Interval provjere imenika:" + +#: ../src/addins/noteoftheday/noteoftheday.cpp:33 +msgid "Today: Template" +msgstr "Danas: Šablon" + +#: ../src/addins/noteoftheday/noteoftheday.cpp:35 +msgid "Today: " +msgstr "Danas: " + +#. TRANSLATORS: first %s is note title, second is error +#. TRANSLATORS: first %s is template note title, second is error +#: ../src/addins/noteoftheday/noteoftheday.cpp:49 +#: ../src/addins/noteoftheday/noteofthedaypreferences.cpp:72 +#, c-format +msgid "NoteOfTheDay could not create %s: %s" +msgstr "BilješkaDana nije mogla da napravi %s: %s" + +#: ../src/addins/noteoftheday/noteoftheday.cpp:155 +msgid "Tasks" +msgstr "Zadaci" + +#: ../src/addins/noteoftheday/noteoftheday.cpp:156 +msgid "Appointments" +msgstr "Zakazivanja" + +#. Format: "Today: Friday, July 01 2005" +#: ../src/addins/noteoftheday/noteoftheday.cpp:162 +msgid "%A, %B %d %Y" +msgstr "%A, %B %d %Y" + +#: ../src/addins/noteoftheday/noteoftheday.desktop.in.in.h:1 +msgid "Note of the Day" +msgstr "Bilješka dana" + +#: ../src/addins/noteoftheday/noteoftheday.desktop.in.in.h:2 +msgid "" +"Automatically creates a \"Today\" note for easily jotting down daily thoughts" +msgstr "" +"Automatski kreira bilješku \"Danas\" za jednostavno zapisivanje dnevnih " +"misli." + +#: ../src/addins/noteoftheday/noteoftheday.desktop.in.in.h:3 +msgid "Debarshi Ray and the Tomboy Project" +msgstr "Debarshi Ray i Tomboy Projekat" + +#: ../src/addins/noteoftheday/noteofthedaypreferences.cpp:34 +msgid "_Open Today: Template" +msgstr "_Otvori „Danas: Šablon“" + +#: ../src/addins/noteoftheday/noteofthedaypreferences.cpp:35 +msgid "" +"Change the Today: Template note to customize " +"the text that new Today notes have." +msgstr "" +"Promjeni bilješku „Danas: šablon“ da prilagodiš " +"tekst koji imaju nove bilješke dana." + +#: ../src/addins/printnotes/printnotes.desktop.in.in.h:1 +msgid "Printing Support" +msgstr "Podrška za štampu" + +#: ../src/addins/printnotes/printnotes.desktop.in.in.h:2 +msgid "Allows you to print a note." +msgstr "Omogućuje štampanje bilješke." + +#: ../src/addins/printnotes/printnotesnoteaddin.cpp:61 +msgid "Print" +msgstr "Štampaj" + +#: ../src/addins/printnotes/printnotesnoteaddin.cpp:61 +msgid "Print note" +msgstr "Štampaj bilješku" + +#: ../src/addins/printnotes/printnotesnoteaddin.cpp:136 +msgid "Error printing note" +msgstr "Greška pri štampanju bilješke" + +#. %1% is the page number, %2% is the total number of pages +#: ../src/addins/printnotes/printnotesnoteaddin.cpp:303 +msgid "Page %1% of %2%" +msgstr "Stranica %1% of %2%" + +#: ../src/addins/readonly/readonly.desktop.in.in.h:1 +#: ../src/addins/readonly/readonlynoteaddin.cpp:53 +msgid "Read Only" +msgstr "Samo za čitanje" + +#: ../src/addins/readonly/readonly.desktop.in.in.h:2 +msgid "Mark certain notes as read only" +msgstr "Označi određene bilješke samo za čitanje" + +#: ../src/addins/readonly/readonly.desktop.in.in.h:3 +msgid "Aurimas Černius, Debarshi Ray and Arief Bayu Purwanto" +msgstr "Aurimas Černius, Debarshi Ray i Arief Bayu Purwanto" + +#: ../src/addins/readonly/readonlynoteaddin.cpp:54 +msgid "Make this note read-only" +msgstr "Napravi ovu bilješku samo za čitanje" + +#: ../src/addins/replacetitle/replacetitle.desktop.in.in.h:1 +#: ../src/addins/replacetitle/replacetitlenoteaddin.cpp:51 +msgid "Replace title" +msgstr "Zamijeni naslov" + +#: ../src/addins/replacetitle/replacetitle.desktop.in.in.h:2 +msgid "Replace title with selection." +msgstr "Zamijeni naslov sa selektovanjem." + +#: ../src/addins/replacetitle/replacetitle.desktop.in.in.h:3 +msgid "Pierre-Yves Luyten" +msgstr "Pierre-Yves Luyten" + +#: ../src/addins/specialnotes/specialnotesapplicationaddin.cpp:38 +#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:1 +msgid "Special Notes" +msgstr "Specijalne bilješke" + +#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:2 +msgid "Show special notes, that are otherwise hidden" +msgstr "Prikaži specijalne bilješke, koje su inače sakrivene" + +#: ../src/addins/statistics/statisticsapplicationaddin.cpp:50 +msgid "Show Statistics" +msgstr "Prikaži statistiku" + +#: ../src/addins/statistics/statistics.desktop.in.in.h:1 +#: ../src/addins/statistics/statisticswidget.cpp:171 +msgid "Statistics" +msgstr "Statistika" + +#: ../src/addins/statistics/statistics.desktop.in.in.h:2 +msgid "Show various statistics about notes." +msgstr "Prikaži različite statistike o bilješkama." + +#: ../src/addins/statistics/statisticswidget.cpp:91 +msgid "Total Notes:" +msgstr "Ukupno bilješki:" + +#: ../src/addins/statistics/statisticswidget.cpp:97 +msgid "Total Notebooks:" +msgstr "Ukupno svezaka:" + +# translations. +#: ../src/addins/statistics/statisticswidget.cpp:127 +msgid "%1% note" +msgid_plural "%1% notes" +msgstr[0] "%1% bilješka" +msgstr[1] "%1% bilješke" +msgstr[2] "%1% bilješki" + +#: ../src/addins/stickynoteimport/stickynoteimport.desktop.in.in.h:1 +msgid "Sticky Notes Importer" +msgstr "Uvoznik gnomovih bilješki" + +#: ../src/addins/stickynoteimport/stickynoteimport.desktop.in.in.h:2 +msgid "Import your notes from the Sticky Notes applet." +msgstr "Uvezi svoje bilješke iz appleta gnomovih bilješki." + +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:87 +msgid "Import from Sticky Notes" +msgstr "Uvezi iz gnomovih bilješki" + +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:214 +msgid "No Sticky Notes found" +msgstr "Nisu pronađene gnomove bilješke" + +#. %1% is a the file nami +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:216 +msgid "No suitable Sticky Notes file was found at \"%1%\"." +msgstr "Nisu pronađene odgovarajuće gnomove bilješke u \"%1%\"." + +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:224 +msgid "Sticky Notes import completed" +msgstr "Uvoz gnomovih bilješki je završen" + +#. here %1% is the number of notes imported, %2% the total number of notes. +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:226 +msgid "%1% of %2% Sticky Notes were successfully imported." +msgstr "%1% of %2% Gnomove bilješke su uspješno uvezene." + +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:245 +msgid "Untitled" +msgstr "Bez naslova" + +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:283 +msgid "Sticky Note: " +msgstr "Gnomova bilješka: " + +#. namespace +#: ../src/addins/tableofcontents/tableofcontentsaction.cpp:37 +#: ../src/addins/tableofcontents/tableofcontentsaction.cpp:38 +#: ../src/addins/tableofcontents/tableofcontents.desktop.in.in.h:1 +#: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:66 +msgid "Table of Contents" +msgstr "Tabela Sadržaja" + +#: ../src/addins/tableofcontents/tableofcontents.desktop.in.in.h:2 +msgid "" +"Navigate long structured notes. Set section and subsection headings in your " +"note, and the Table of Contents will show in a menu." +msgstr "" +"Upravljaj dugačkim bilješkama. Postavite sekciju i podsekciju zaglavlja u " +"vašoj bilješci, i prikazaće se tabela sadržaja u meniju." + +#: ../src/addins/tableofcontents/tableofcontents.desktop.in.in.h:3 +msgid "Luc Pionchon" +msgstr "Luc Pionchon" + +#: ../src/addins/tableofcontents/tableofcontents.desktop.in.in.h:4 +msgid "© 2013 Luc Pionchon" +msgstr "© 2013 Luc Pionchon" + +#. no toc items, and no action entries = empty mijenu +#: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:140 +msgid "(empty table of contents)" +msgstr "(prazna tabela sadržaja)" + +#: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:155 +msgid "Heading 1" +msgstr "Zaglavlje 1" + +#: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:161 +msgid "Heading 2" +msgstr "Zaglavlje 2" + +#: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:167 +msgid "Table of Contents Help" +msgstr "Pomoć za Tabelu sadržaja" + +#. namespace +#: ../src/addins/todo/todo.desktop.in.in.h:1 +msgid "TODO" +msgstr "TODO" + +#: ../src/addins/todo/todo.desktop.in.in.h:2 +msgid "Highlight FIXME, TODO and XXX patterns in notes." +msgstr "Istaknuti FIXME, TODO i XXX obrazce u bilješkama." + +#: ../src/addins/todo/todo.desktop.in.in.h:3 +msgid "Aurimas Černius, Romain Tartière" +msgstr "Aurimas Černius, Romain Tartière" + +#: ../src/addins/tomboyimport/tomboyimport.desktop.in.in.h:1 +msgid "Tomboy Importer" +msgstr "Tomboy Uvoznik" + +#: ../src/addins/tomboyimport/tomboyimport.desktop.in.in.h:2 +msgid "Import your notes from Tomboy." +msgstr "Uvezite vaše bilješke iz Tomboy-a." + +#: ../src/addins/tomboyimport/tomboyimport.desktop.in.in.h:3 +msgid "Hubert Figuiere" +msgstr "Hubert Figuiere" + +#: ../src/addins/underline/underline.desktop.in.in.h:1 +msgid "Underline" +msgstr "Podvučeno" + +#: ../src/addins/underline/underline.desktop.in.in.h:2 +msgid "Adds ability to underline text." +msgstr "Dodaje opciju za podvlačenje teksta." + +#: ../src/addins/underline/underline.desktop.in.in.h:3 +msgid "Hubert Figuière and the Tomboy Project" +msgstr "Hubert Figuière i Tomboy Projekat" + +#: ../src/addins/underline/underlinemenuitem.cpp:35 +msgid "_Underline" +msgstr "_Podvučeno" + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:70 +msgid "_URL:" +msgstr "_URL:" + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:75 +msgid "User_name:" +msgstr "_Korisničko ime:" + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:81 +msgid "_Password:" +msgstr "_Lozinka:" + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:105 +msgid "WebDAV" +msgstr "WebDAV" + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:117 +msgid "" +"There was an error connecting to the server. This may be caused by using an " +"incorrect user name and/or password." +msgstr "" +"Greška pri povezivanju sa serverom. Uzrok može biti neispravno korisničko " +"ime i/ili lozinka." + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:173 +msgid "URL, username, or password field is empty." +msgstr "URL, korisničko ime ili lozinka su prazni." + +#. TODO: If the above fails (no keyring daemon), savije all but password +#. to GConf, and notify user. +#. Savije configuration into GConf +#. Preferences.Set ("/apps/tomboy/sync_wdfs_url", url ?? string.Empty); +#. Preferences.Set ("/apps/tomboy/sync_wdfs_username", username ?? string.Empty); +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:262 +msgid "" +"Saving configuration to the GNOME keyring failed with the following " +"message:\n" +"\n" +"%1%" +msgstr "" +"Snimanje konfiguracije u GNOME ključeve nije uspjelo sa sljedećom porukom:\n" +"\n" +"%1%" + +#: ../src/addins/webdavsyncservice/webdavsyncservice.desktop.in.in.h:1 +msgid "WebDAV Sync Service Plugin" +msgstr "WebDAV Servisni Plugin za usklađivanje" + +#: ../src/addins/webdavsyncservice/webdavsyncservice.desktop.in.in.h:2 +msgid "Synchronize Gnote Notes to a WebDAV URL." +msgstr "Uskladi Gnote bilješke sa WebDAV URL-om." + +#: ../src/dbus/remotecontrol-client-glue.cpp:138 +#, c-format +msgid "Remote call to %s failed" +msgstr "Daljinski poziv %s nije uspio" + +#: ../src/dbus/remotecontrol.cpp:82 +#, c-format +msgid "Exception thrown when creating note: %s" +msgstr "Izuzetak bačen pri stvaranju bilješke: %s" + +#: ../src/gnote.cpp:185 +msgid "Gnote is already running. Exiting..." +msgstr "Gnote je već uključen. Izlazim..." + +#: ../src/gnote.cpp:289 +msgid "and Tomboy original authors." +msgstr "i Tomboy originalni autori." + +#: ../src/gnote.cpp:295 +msgid "translator-credits" +msgstr "" +" Kenan Mahmutovic https://launchpad.net/~kmahmutovi1\n" +" Samir Ribić https://launchpad.net/~megaribi\n" +" Selma Glavić https://launchpad.net/~sglavic1" + +#: ../src/gnote.cpp:304 +msgid "" +"Copyright © 2010-2015 Aurimas Cernius\n" +"Copyright © 2009-2011 Debarshi Ray\n" +"Copyright © 2009 Hubert Figuiere\n" +"Copyright © 2004-2009 the Tomboy original authors." +msgstr "" +"Autorska prava © 2010-2015 Aurimas Cernius\n" +"Autorska prava © 2009-2011 Debarshi Ray\n" +"Autorksa prava © 2009 Hubert Figuiere\n" +"Autorska prava © 2004-2009 the Tomboy izvorni autori." + +#: ../src/gnote.cpp:308 +msgid "A simple and easy to use desktop note-taking application." +msgstr "Jednostavan i zgodan programčić za hvatanje bilješki." + +#: ../src/gnote.cpp:319 +msgid "Homepage" +msgstr "Početna stranica" + +#: ../src/gnote.cpp:494 +msgid "Run Gnote in background." +msgstr "Pokreni Gnote u pozadini." + +#: ../src/gnote.cpp:495 +msgid "Run Gnote as GNOME Shell search provider." +msgstr "Pokreni Gnote kao GNOME Shell davatelja usluga pretraživanja." + +#: ../src/gnote.cpp:496 +msgid "Specify the path of the directory containing the notes." +msgstr "Odredi putanju direktorija koji sadrži bilješke." + +#: ../src/gnote.cpp:496 +msgid "path" +msgstr "putanja" + +#: ../src/gnote.cpp:497 +msgid "Open the search all notes window with the search text." +msgstr "Otvori prozor Pretraži sve bilješke sa tekstom za pretraživanje." + +#: ../src/gnote.cpp:497 ../src/gnote.cpp:502 +msgid "text" +msgstr "tekst" + +#: ../src/gnote.cpp:498 +msgid "Print version information." +msgstr "Štampaj informacije o verziji." + +#: ../src/gnote.cpp:499 +msgid "Create and display a new note, with a optional title." +msgstr "Napravi i prikaži novu bilješku, sa opcionalnim naslovom." + +#: ../src/gnote.cpp:499 +msgid "title" +msgstr "naslov" + +#: ../src/gnote.cpp:500 +msgid "Display the existing note matching title." +msgstr "Prikaži postojeću bilješku koja odgovara naslovu." + +#: ../src/gnote.cpp:500 +msgid "title/url" +msgstr "naslov/url" + +#: ../src/gnote.cpp:501 +msgid "Display the 'Start Here' note." +msgstr "Prikaži \"Počni ovdje\" bilješku." + +#: ../src/gnote.cpp:502 +msgid "Search and highlight text in the opened note." +msgstr "Pretraži i označi tekst u otvorenoj bilješci." + +#: ../src/gnote.cpp:506 +msgid "A note taking application" +msgstr "Program za pravljenje bilješki." + +#: ../src/gnote.cpp:506 +msgid "Gnote options at launch" +msgstr "Opcije Gnote-a pri paljenju." + +#: ../src/gnote.cpp:583 +msgid "Could not connect to remote instance." +msgstr "Nemoguće povezivanje sa udaljenim primjerkom." + +#: ../src/gnote.cpp:699 +msgid "Version %1%" +msgstr "Verzija %1%" + +#. TRANSLATORS: the first %s is icon nami, %d is for size, last %s is error description +#: ../src/iconmanager.cpp:66 +#, c-format +msgid "Failed to load icon (%s, %d): %s" +msgstr "Neuspješno učitavanje ikone (%s, %d): %s" + +#: ../src/noteaddin.cpp:108 ../src/noteaddin.cpp:122 ../src/noteaddin.cpp:135 +msgid "Plugin is disposing already" +msgstr "Plugin je već na raspolaganju" + +#: ../src/noteaddin.cpp:139 +msgid "Window is not embedded" +msgstr "Prozor nije ugrađen" + +#. Probably IOException or UnauthorizedAccessException? +#: ../src/notebase.cpp:200 ../src/note.cpp:382 +#, c-format +msgid "Exception while saving note: %s" +msgstr "Izuzetak pri snimanju bilješke :%s" + +#. write failure, but not critical +#: ../src/notebase.cpp:444 +#, c-format +msgid "Failed to update note format: %s" +msgstr "Neuspješno ažuriranje formata bilješke : %s" + +#: ../src/notebase.cpp:568 +#, c-format +msgid "Filesystem error: %s" +msgstr "Greška sistemske datoteke : %s" + +#: ../src/notebooks/createnotebookdialog.cpp:41 +msgid "Create Notebook" +msgstr "Napravi svesku" + +#: ../src/notebooks/createnotebookdialog.cpp:45 +msgid "N_otebook name:" +msgstr "_Ime sveske:" + +#: ../src/notebooks/createnotebookdialog.cpp:58 +msgid "Name already taken" +msgstr "Ime je već zauzeto" + +#. Translation note: This is the Create button in the Create +#. New Note Dialog. +#: ../src/notebooks/createnotebookdialog.cpp:71 +msgid "C_reate" +msgstr "Nap_ravi" + +#: ../src/notebooks/notebookapplicationaddin.cpp:66 +#: ../src/searchnoteswidget.cpp:229 +msgid "Notebooks" +msgstr "Sveske" + +#: ../src/notebooks/notebookapplicationaddin.cpp:67 +msgid "Create a new note in a notebook" +msgstr "Napravi novu belešku u svesci" + +#: ../src/notebooks/notebookapplicationaddin.cpp:96 +#: ../src/notebooks/notebookapplicationaddin.cpp:146 +msgid "New Note_book..." +msgstr "Nova _sveska..." + +#. The templateNoteTite should show the nami of the +#. notebook. For example, if the nami of the notebooks +#. "Meetings", the templateNoteTitle should bje "Meetings +#. Notebook Template". Translators should place the +#. nami of the notebook accordingly using "%1%". +#: ../src/notebooks/notebook.cpp:109 +msgid "%1% Notebook Template" +msgstr "%1% Šablon sveske" + +#: ../src/notebooks/notebook.cpp:185 ../src/notemanagerbase.cpp:301 +msgid "New Note" +msgstr "Nova bilješka" + +#: ../src/notebooks/notebookmanager.cpp:364 +msgid "Really delete this notebook?" +msgstr "Zaista želiš da obrišeš ovu svesku?" + +#: ../src/notebooks/notebookmanager.cpp:365 +msgid "" +"The notes that belong to this notebook will not be deleted, but they will no " +"longer be associated with this notebook. This action cannot be undone." +msgstr "" +"Bilješke iz sveske neće biti obrisane, ali više neće biti pridružene svesci. " +"Ovu radnju nije moguće poništiti." + +#: ../src/notebooks/notebookmenuitem.cpp:34 +msgid "No notebook" +msgstr "Nema sveske" + +#: ../src/notebooks/notebooknewnotemenuitem.cpp:40 +msgid "New \"%1%\" Note" +msgstr "Nova \"%1%\" bilješka" + +#: ../src/notebooks/notebooknoteaddin.cpp:72 +msgid "Notebook" +msgstr "Sveska" + +#: ../src/notebooks/notebooknoteaddin.cpp:73 +msgid "Place this note into a notebook" +msgstr "Spremi bilješku u svesku" + +#. Add new notebook item +#: ../src/notebooks/notebooknoteaddin.cpp:153 +msgid "_New notebook..." +msgstr "_Nova sveska..." + +#: ../src/notebooks/specialnotebooks.cpp:46 +msgid "All" +msgstr "Sve" + +#: ../src/notebooks/specialnotebooks.cpp:75 +msgid "Unfiled" +msgstr "Nezavedeno" + +#: ../src/notebooks/specialnotebooks.cpp:106 +msgid "Important" +msgstr "Važno" + +#: ../src/notebooks/specialnotebooks.cpp:133 +msgid "Active" +msgstr "Aktivan" + +#: ../src/notebuffer.cpp:1505 +msgid " tag mismatch" +msgstr " nepodudaranje tagova" + +#: ../src/notebuffer.cpp:1584 +#, c-format +msgid "Exception: %s" +msgstr "Izuzetak: %s" + +#. TRANSLATORS: %1% will bje replaced by note title +#: ../src/note.cpp:59 +msgid "Really delete \"%1%\"?" +msgstr "Zaista želite da obrišete \"%1%\"?" + +# translations. +#. TRANSLATORS: %1% is number of notes +#: ../src/note.cpp:63 +msgid "Really delete %1% note?" +msgid_plural "Really delete %1% notes?" +msgstr[0] "Zaista želite obrisati \"%1%\" bilješku?" +msgstr[1] "Zaista želite obrisati \"%1%\" bilješke?" +msgstr[2] "Zaista želite obrisati \"%1%\" bilješki?" + +#: ../src/note.cpp:70 +msgid "If you delete a note it is permanently lost." +msgstr "Ako obrišete bilješku biće zauvijek izgubljena." + +#: ../src/note.cpp:106 +msgid "Error saving note data." +msgstr "Greška pri čuvanju podataka bilješke." + +#: ../src/note.cpp:107 +msgid "" +"An error occurred while saving your notes. Please check that you have " +"sufficient disk space, and that you have appropriate rights on ~/.local/" +"share/gnote. Error details can be found in ~/.gnote.log." +msgstr "" +"Greška pri snimanju vaših bilješki. Molim vas provjerite da li imate " +"dovoljno prostora na disku, i da imate odgovarajuća prava na ~/.local/share/" +"gnote. Detalji o greški mogu biti pronađeni u ~/.gnote.log." + +#: ../src/note.cpp:474 +#, c-format +msgid "Error while saving: %s" +msgstr "Greška pri snimanju : %s" + +#: ../src/note.cpp:699 +msgid "Setting text content for closed notes not supported" +msgstr "Postavljanje tekstualnog sadržaja za zatvorene bilješke nije podržano" + +#: ../src/notemanagerbase.cpp:105 ../src/preferencesdialog.cpp:320 +msgid "New Note Template" +msgstr "Šablon nove bilješke" + +#: ../src/notemanagerbase.cpp:359 +msgid "Describe your new note here." +msgstr "Ovdje opišite vašu novu bilješku." + +#: ../src/notemanager.cpp:133 +msgid "" +"Start " +"Here\n" +"\n" +"Welcome to Gnote!\n" +"\n" +"Use this \"Start Here\" note to begin organizing your ideas and thoughts.\n" +"\n" +"You can create new notes to hold your ideas by selecting the \"Create New " +"Note\" item from the Gnote menu in your GNOME Panel. Your note will be saved " +"automatically.\n" +"\n" +"Then organize the notes you create by linking related notes and ideas " +"together!\n" +"\n" +"We've created a note called Using Links in Gnote. Notice how each time we type Using Links in " +"Gnote it automatically gets underlined? Click on the link " +"to open the note." +msgstr "" +"Počni " +"ovdje\n" +"\n" +"Dobrodošli u Gnote!\n" +"\n" +"Koristite ovu \"Počni ovdje\" bilješku da započnete organizovanje vaših " +"ideja i misli.\n" +"\n" +"Možete napraviti nove bilješke za čuvanje vaših ideja tako što ćete " +"selektovati \"Napravi novu bilješku\" iz Gnote menija u vašem GNOME panelu. " +"Vaša bilješka će biti automatski snimljena.\n" +" \n" +"Zatim organizujte bilješke koje napravite tako što ćete spojiti povezane " +"bilješke i ideje zajedno.\n" +"\n" +"Napravili smo bilješku nazvanu Koristeći linkove u Gnote. Primjetite kako svaki put kada unesemo Koristeći linkove u Gnote automatski biva " +"podvučeno? Kliknite na link da otvorite bilješku. " + +#: ../src/notemanager.cpp:152 +msgid "" +"Using Links in Gnote\n" +"\n" +"Notes in Gnote can be linked together by highlighting text in the current " +"note and clicking the Link button above in the toolbar. Doing " +"so will create a new note and also underline the note's title in the current " +"note.\n" +"\n" +"Changing the title of a note will update links present in other notes. This " +"prevents broken links from occurring when a note is renamed.\n" +"\n" +"Also, if you type the name of another note in your current note, it will " +"automatically be linked for you." +msgstr "" +"Koristeći linkove u Gnote\n" +"\n" +"Bilješke u Gnote mogu biti spojene tako što ćete označiti tekst u trenutnoj " +"bilješci i kliknuti na Link dugme iznad na alatnoj traci. Ako " +"to uradite napravićete novu bilješku i također podvući naslov od bilješke u " +"trenutnoj bilješci.\n" +"\n" +"Mijenjanje naslova bilješke će ažurirati linkove prisutne u drugim " +"bilješkama. Ovo spriječava stvaranje puknutih linkova kada je bilješka " +"preimenovana.\n" +"\n" +"Također, ako ukucate ime druge bilješke u vašu trenutnu bilješku,automatski " +"će biti povezane za vas." + +#. Attempt to find an existing Start Here note +#: ../src/notemanager.cpp:167 ../src/notemanager.cpp:208 +msgid "Start Here" +msgstr "Početna stanica" + +#: ../src/notemanager.cpp:173 +msgid "Using Links in Gnote" +msgstr "Koristeći linkove u Gnote" + +#: ../src/notemanager.cpp:178 +#, c-format +msgid "Error creating start notes: %s" +msgstr "Greška pri stvaranju početnih bilješki : %s" + +#. TRANSLATORS: first %s is file, second is error +#: ../src/notemanager.cpp:196 +#, c-format +msgid "Error parsing note XML, skipping \"%s\": %s" +msgstr "Greška pri parsiranju bilješke XML, preskačem \"%s\": %s" + +#: ../src/noterenamedialog.cpp:123 +msgid "Rename Note Links?" +msgstr "Da preimenujem veze u bilješkama?" + +#: ../src/noterenamedialog.cpp:127 +msgid "_Don't Rename Links" +msgstr "_Ne preimenuj veze" + +#: ../src/noterenamedialog.cpp:128 +msgid "_Rename Links" +msgstr "P_reimenuj veze" + +#: ../src/noterenamedialog.cpp:129 +msgid "Select All" +msgstr "Odaberi sve" + +#: ../src/noterenamedialog.cpp:130 +msgid "Select None" +msgstr "Nemoj izabrati ništa" + +#: ../src/noterenamedialog.cpp:131 +msgid "Always show this _window" +msgstr "Uvijek prikazuj ovaj _prozor" + +#: ../src/noterenamedialog.cpp:132 +msgid "Alwa_ys rename links" +msgstr "_Uvijek preimenuj veze" + +#: ../src/noterenamedialog.cpp:134 +msgid "Never rename _links" +msgstr "_Nikad ne preimenuj veze" + +#: ../src/noterenamedialog.cpp:152 +msgid "" +"Rename links in other notes from \"%1\" to " +"\"%2\"?\n" +"\n" +"If you do not rename the links, they will no longer link to anything." +msgstr "" +"Preimenuj veze u drugoj bilješci iz \"%1\" " +"u \"%2\"?\n" +"\n" +"Ako ne preimenujete veze, neće više biti povezane ni sa čim." + +#: ../src/noterenamedialog.cpp:185 +msgid "Rename Links" +msgstr "Preimenuj veze" + +#: ../src/noterenamedialog.cpp:200 ../src/synchronization/syncdialog.cpp:331 +msgid "Note Title" +msgstr "Naslov bilješke" + +#: ../src/noterenamedialog.cpp:237 +msgid "Ad_vanced" +msgstr "_Napredno" + +#: ../src/notewindow.cpp:372 +msgid "_Link to New Note" +msgstr "_Veza na novu bilješku" + +#: ../src/notewindow.cpp:380 +msgid "Te_xt" +msgstr "Te_kst" + +#: ../src/notewindow.cpp:417 +msgid "Set properties of text" +msgstr "Postavi osobine teksta" + +#: ../src/notewindow.cpp:421 +msgid "Is Important" +msgstr "Važno je" + +#: ../src/notewindow.cpp:422 +msgid "Toggle notes presence in Important Notes notebook" +msgstr "Prebaci prisutnost bilješke u važne napomene bilježnice" + +#: ../src/notewindow.cpp:430 ../src/searchnoteswidget.cpp:144 +#: ../src/searchnoteswidget.cpp:147 +msgid "_Delete" +msgstr "_Obriši" + +#: ../src/notewindow.cpp:430 +msgid "Delete this note" +msgstr "Obriši ovu bilješku" + +#: ../src/notewindow.cpp:446 +msgid "" +"This note is a template note. It determines the default content of regular " +"notes, and will not show up in the note menu or search window." +msgstr "" +"Ova bilješka je šablon bilješka. On određuje podrazumijevani sadržaj običnih " +"bilješki, i neće se pojaviti u meniju bilješki ili prozoru za pretragu." + +#: ../src/notewindow.cpp:449 +msgid "Convert to regular note" +msgstr "Pretvori u običnu bilješku" + +#: ../src/notewindow.cpp:452 +msgid "Save Si_ze" +msgstr "Veli_čina snimanja" + +#: ../src/notewindow.cpp:456 +msgid "Save Se_lection" +msgstr "Snimi _izbor" + +#: ../src/notewindow.cpp:460 +msgid "Save _Title" +msgstr "Snimi _naslov" + +#: ../src/notewindow.cpp:562 ../src/notewindow.cpp:1085 +msgid "Cannot create note" +msgstr "Ne mogu da napravim bilješku" + +#: ../src/notewindow.cpp:828 +msgid "_Link" +msgstr "_Poveži" + +#: ../src/notewindow.cpp:829 +msgid "_Bold" +msgstr "_Podebljano" + +#: ../src/notewindow.cpp:830 +msgid "_Italic" +msgstr "_Iskošeno" + +#: ../src/notewindow.cpp:831 +msgid "_Strikeout" +msgstr "_Precrtano " + +#: ../src/notewindow.cpp:833 +msgid "_Highlight" +msgstr "_Označeno" + +#: ../src/notewindow.cpp:835 +msgid "_Normal" +msgstr "_Normalno" + +#: ../src/notewindow.cpp:837 +msgid "Hu_ge" +msgstr "O_gromna" + +#: ../src/notewindow.cpp:839 +msgid "_Large" +msgstr "_Velika" + +#: ../src/notewindow.cpp:841 +msgid "S_mall" +msgstr "_Mala" + +#: ../src/notewindow.cpp:843 +msgid "Bullets" +msgstr "Tačke" + +#: ../src/preferencesdialog.cpp:121 +msgid "General" +msgstr "Opće" + +#: ../src/preferencesdialog.cpp:122 +msgid "Links" +msgstr "Linkovi" + +#. TRANSLATORS: Addin category. +#: ../src/preferencesdialog.cpp:125 ../src/sharp/addinstreemodel.cpp:164 +msgid "Synchronization" +msgstr "Usklađivanje" + +#: ../src/preferencesdialog.cpp:127 +msgid "Plugins" +msgstr "Plugini" + +#: ../src/preferencesdialog.cpp:204 +#, c-format +msgid "Plugin %s is absent" +msgstr "Plugin %s nije prisutan" + +#. Opijen in new window +#: ../src/preferencesdialog.cpp:243 +msgid "Always _open notes in new window" +msgstr "Uvijek _otvaraj bilješke u novom prozoru" + +#: ../src/preferencesdialog.cpp:256 +msgid "_Spell check while typing" +msgstr "Provjeri pravopi_s tokom kucanja" + +#: ../src/preferencesdialog.cpp:257 +msgid "" +"Misspellings will be underlined in red, with correct spelling suggestions " +"shown in the context menu." +msgstr "" +"Neispravno napisane riječi će biti crveno podvučene, sa ispravnim " +"prijedlozima koji se pojavljuju u sadržaju." + +#. Auto bulleted list +#: ../src/preferencesdialog.cpp:267 +msgid "Enable auto-_bulleted lists" +msgstr "Omogući automatske _liste" + +#: ../src/preferencesdialog.cpp:268 +msgid "Start new bulleted list by starting new line with character \"-\"." +msgstr "" +"Započnite novu automatsku listu tako što ćete započeti novu liniju znakom \"-" +"\"." + +#: ../src/preferencesdialog.cpp:277 +msgid "Use custom _font" +msgstr "Koristi poseban _slovni lik" + +#: ../src/preferencesdialog.cpp:295 +msgid "When renaming a linked note: " +msgstr "Kada se preimenuje bilješka na koju druge bilješke imaju vezu: " + +#: ../src/preferencesdialog.cpp:299 +msgid "Ask me what to do" +msgstr "Pitaj me šta da radim" + +#: ../src/preferencesdialog.cpp:300 +msgid "Never rename links" +msgstr "Nikad ne preimenuj veze" + +#: ../src/preferencesdialog.cpp:301 +msgid "Always rename links" +msgstr "Uvijek preimenuj veze" + +#: ../src/preferencesdialog.cpp:321 +msgid "" +"Use the new note template to specify the text that should be used when " +"creating a new note." +msgstr "" +"Koristi šablon nove bilješke za određivanje početnog teksta u novim " +"bilješkama." + +#: ../src/preferencesdialog.cpp:326 +msgid "Open New Note Template" +msgstr "Otvori šablon nove bilješke" + +#. internal links +#: ../src/preferencesdialog.cpp:383 +msgid "_Automatically link to notes" +msgstr "_Autotomatski link za bilješke" + +#: ../src/preferencesdialog.cpp:384 +msgid "Enable this option to create a link when text matches note title." +msgstr "" +"Omogući ovu opciju za kreiranje linka kada tekst odgovara naslovu bilješke." + +#. URLs +#: ../src/preferencesdialog.cpp:390 +msgid "Create links for _URLs" +msgstr "Kreiraj linkove za _URL" + +#: ../src/preferencesdialog.cpp:391 +msgid "" +"Enable this option to create links for URLs. Clicking will open URL with " +"appropriate program." +msgstr "" +"Omogući ovu opciju za kreiranje URL linkova. Klikom će se otvoriti URL sa " +"odgovarajućim programom." + +#. WikiWords... +#: ../src/preferencesdialog.cpp:398 +msgid "Highlight _WikiWords" +msgstr "Označi _Wiki riječi" + +#: ../src/preferencesdialog.cpp:399 +msgid "" +"Enable this option to highlight words ThatLookLikeThis. Clicking the " +"word will create a note with that name." +msgstr "" +"Omogući opciju za obilježavanje riječi KojeIzgledajuOvako. Klik iznad " +"riječi će tada napraviti novu bilješku sa tim imenom." + +#: ../src/preferencesdialog.cpp:431 +msgid "Ser_vice:" +msgstr "Ser_vis:" + +#: ../src/preferencesdialog.cpp:487 ../src/preferencesdialog.cpp:1117 +msgid "Not configurable" +msgstr "Nije podesivo" + +#: ../src/preferencesdialog.cpp:514 +msgid "Automatical background s_ync interval (minutes)" +msgstr "Interval automatskog pozadinskog usk_lađivanja (minuti)" + +#. "Advanced..." button to bring up extra sync config dialog +#: ../src/preferencesdialog.cpp:538 +msgid "_Advanced..." +msgstr "_Napredno..." + +#: ../src/preferencesdialog.cpp:585 +msgid "The following plugins are installed:" +msgstr "Sljedeći plugini su instalirani:" + +#. TODO: In a future version, add in an "Install Add-ins..." button +#. TODO: In a future version, add in a "Repositories..." button +#: ../src/preferencesdialog.cpp:620 +msgid "_Enable" +msgstr "_Omogući" + +#: ../src/preferencesdialog.cpp:626 +msgid "_Disable" +msgstr "_Onemogući" + +#: ../src/preferencesdialog.cpp:784 +msgid "Not Implemented" +msgstr "Nije implementirano" + +#: ../src/preferencesdialog.cpp:800 +msgid "%1% Preferences" +msgstr "%1% Postavke" + +#: ../src/preferencesdialog.cpp:935 +msgid "Choose Note Font" +msgstr "Odaberi slovni lik za bilješke" + +#. Create dialog +#: ../src/preferencesdialog.cpp:1033 +msgid "Other Synchronization Options" +msgstr "Ostale opcije usklađivanja" + +#: ../src/preferencesdialog.cpp:1036 +msgid "" +"When a conflict is detected between a local note and a note on the " +"configured synchronization server:" +msgstr "" +"Kada se dogodi sukob između lokalni bilješke i bilješke na odabranom serveru " +"za usklađivanje:" + +#. label.Xalign = 0; +#: ../src/preferencesdialog.cpp:1040 +msgid "Always ask me what to do" +msgstr "Pitaj me šta da radim" + +#: ../src/preferencesdialog.cpp:1044 +msgid "Rename my local note" +msgstr "Preimenuj moju lokalnu bilješku" + +#: ../src/preferencesdialog.cpp:1048 +msgid "Replace my local note with the server's update" +msgstr "Zamijeni moju lokalnu bilješku sa ažuriranom verzijom sa servera" + +#: ../src/preferencesdialog.cpp:1150 +msgid "Are you sure?" +msgstr "Jeste li sigurni?" + +#: ../src/preferencesdialog.cpp:1151 +msgid "" +"Clearing your synchronization settings is not recommended. You may be " +"forced to synchronize all of your notes again when you save new settings." +msgstr "" +"Uklanjanje postavki za usklađivanje nije preporučeno. Može se dogoditi da " +"morate ponovo da uslkadite sve svoje bilješke kada sačuvate nove postavke." + +#: ../src/preferencesdialog.cpp:1161 +msgid "Resetting Synchronization Settings" +msgstr "Ponovno postavljanje postavki za usklađivanje" + +#: ../src/preferencesdialog.cpp:1162 +msgid "" +"You have disabled the configured synchronization service. Your " +"synchronization settings will now be cleared. You may be forced to " +"synchronize all of your notes again when you save new settings." +msgstr "" +"Onemogućili ste konfigurisane usluge za zsklađivanje. Vaše postavke za " +"usklađivanje će sada biti obrisane. Može se dogoditi da ćete morati ponovo " +"da uskladite sve vaše bilješke kada sačuvate nove postavke." + +#: ../src/preferencesdialog.cpp:1228 +msgid "Connection successful" +msgstr "Veza je uspostavljena" + +#: ../src/preferencesdialog.cpp:1229 +msgid "" +"Gnote is ready to synchronize your notes. Would you like to synchronize them " +"now?" +msgstr "" +"Gnote je spreman da uskladi vaše bilješke. Želite li da ih uskladite sada?" + +#: ../src/preferencesdialog.cpp:1253 +msgid "" +"Please check your information and try again. The log file %1% may contain " +"more information about the error." +msgstr "" +"Molim vas provjerite vaše informacije i pokušajte ponovo. Datoteka %1% može " +"da sadrži više informacija o greški." + +#: ../src/preferencesdialog.cpp:1258 +msgid "Error connecting" +msgstr "Greška pri povezivanju" + +#: ../src/preferencesdialog.cpp:1321 +msgid "Version:" +msgstr "Verzija:" + +#: ../src/preferencesdialog.cpp:1324 +msgid "Author:" +msgstr "Autor:" + +#: ../src/preferencesdialog.cpp:1329 +msgid "Copyright:" +msgstr "Autorska prava:" + +#: ../src/recentchanges.cpp:129 +msgid "All Notes" +msgstr "Sve bilješke" + +#: ../src/recentchanges.cpp:135 +msgid "New" +msgstr "Nova" + +#: ../src/recentchanges.cpp:156 +msgid "Search" +msgstr "Pretraga" + +#: ../src/recentchanges.cpp:197 +msgid "Find _Next" +msgstr "Pronađi _sljedeće" + +#: ../src/recentchanges.cpp:205 +msgid "Find _Previous" +msgstr "Pronađi _prethodno" + +#: ../src/recentchanges.cpp:673 +msgid "_Close" +msgstr "_Zatvori" + +#: ../src/remotecontrolproxy.cpp:57 +#, c-format +msgid "Failed to load D-Bus interface %s: %s" +msgstr "Neuspješno učitavanje D-Bus interfejsa %s: %s" + +#: ../src/searchnoteswidget.cpp:137 +msgid "_Open" +msgstr "_Otvori" + +#: ../src/searchnoteswidget.cpp:140 +msgid "Open In New _Window" +msgstr "Otvori u novom _prozoru" + +#: ../src/searchnoteswidget.cpp:150 +msgid "Re_name..." +msgstr "_Preimenuj..." + +#: ../src/searchnoteswidget.cpp:659 +msgid "Note" +msgstr "Bilješka" + +#: ../src/searchnoteswidget.cpp:681 +msgid "Modified" +msgstr "Promijenjeno" + +#: ../src/searchnoteswidget.cpp:1000 +msgid "Notes" +msgstr "Bilješke" + +#: ../src/searchnoteswidget.cpp:1019 +msgid "" +"No results found in the selected notebook.\n" +"Click here to search across all notes." +msgstr "" +"Nisam pronašao nijedan rezultat u izabranoj svesci.\n" +"Kliknite ovdje da potražite u svim bilješkama." + +#: ../src/searchnoteswidget.cpp:1023 +msgid "Click here to search across all notebooks" +msgstr "Kliknite ovdje da potražite u svim sveskama" + +#: ../src/searchnoteswidget.cpp:1044 +msgid "Matches" +msgstr "Poklapanja" + +#. TRANSLATORS: search found a match in note title +#: ../src/searchnoteswidget.cpp:1096 +msgid "Title match" +msgstr "Naslov se poklapa" + +# translations. +#: ../src/searchnoteswidget.cpp:1100 +msgid "%1% match" +msgid_plural "%1% matches" +msgstr[0] "%1% se poklapa" +msgstr[1] "%1% se poklapa" +msgstr[2] "%1% se poklapa" + +#: ../src/searchnoteswidget.cpp:1311 +msgid "_New" +msgstr "_Novi" + +#: ../src/searchnoteswidget.cpp:1340 +msgid "_Open Template Note" +msgstr "_Otvori šablon bilješke" + +#: ../src/searchnoteswidget.cpp:1351 +msgid "_New..." +msgstr "_Nova..." + +#: ../src/searchnoteswidget.cpp:1487 ../src/searchnoteswidget.cpp:1500 +#: ../src/searchnoteswidget.cpp:1511 +#, c-format +msgid "Failed to parse setting %s (Value: %s):" +msgstr "Neuspješno parsiranje postavke %s (Vrijednost: %s):" + +#: ../src/searchnoteswidget.cpp:1488 +msgid "Expected format 'column:order'" +msgstr "Očekivan format 'kolona:red'" + +#: ../src/searchnoteswidget.cpp:1501 +#, c-format +msgid "Unrecognized column %s" +msgstr "Neprepoznatljiva kolona %s" + +#: ../src/searchnoteswidget.cpp:1512 +#, c-format +msgid "Unrecognized order %s" +msgstr "Neprepoznatljivi red %s" + +#: ../src/sharp/addinstreemodel.cpp:109 +msgid "Name" +msgstr "Ime:" + +#: ../src/sharp/addinstreemodel.cpp:121 +msgid "Version" +msgstr "Verzija" + +#. TRANSLATORS: Addin category. +#: ../src/sharp/addinstreemodel.cpp:155 +msgid "Formatting" +msgstr "Formatiranje" + +#. TRANSLATORS: Addin category. +#: ../src/sharp/addinstreemodel.cpp:158 +msgid "Desktop integration" +msgstr "Integracija sa radnom površinom" + +#. TRANSLATORS: Addin category. +#: ../src/sharp/addinstreemodel.cpp:161 +msgid "Tools" +msgstr "Alatke" + +#. TRANSLATORS: Addin category is unknown. +#: ../src/sharp/addinstreemodel.cpp:168 +msgid "Unknown" +msgstr "Nepoznato" + +#: ../src/sharp/modulemanager.cpp:62 +#, c-format +msgid "Error loading %s" +msgstr "Greška pri učitavanju %s" + +#: ../src/sharp/modulemanager.cpp:69 +#, c-format +msgid "Error getting symbol dynamic_module_instanciate: %s" +msgstr "Greška pri dobavljanju simbola dynamic_module_instanciate: %s" + +#: ../src/sharp/xmlreader.cpp:195 +#, c-format +msgid "XML error: %s" +msgstr "XML greška: %s" + +#: ../src/sharp/xmlreader.cpp:195 +msgid "unknown parse error" +msgstr "nepoznata greška parsiranja" + +#: ../src/sharp/xmlwriter.cpp:40 +msgid "%1% failed" +msgstr "%1% nije uspjelo" + +#: ../src/sharp/xsltransform.cpp:67 +msgid "NULL stylesheet, please fill a bug" +msgstr "NULL stil stranice, molim vas ispunite bug" + +#: ../src/synchronization/filesystemsyncserver.cpp:369 +#, c-format +msgid "" +"Exception during server cleanup while committing. Server integrity is OK, " +"but there may be some excess files floating around. Here's the error: %s\n" +msgstr "" +"Izuzetak prilikom čišćenja servera u toku izvršavanja. Integritet servera je " +"u redu, ali mogu postojati neke datoteke viška koje se vrte okolo. Evo " +"greške: %s\n" + +#: ../src/synchronization/filesystemsyncserver.cpp:609 +#, c-format +msgid "Error deleting the old synchronization lock \"%s\": %s" +msgstr "Greška pri brisanju stare brave za usklađivanje \"%s\": %s" + +#: ../src/synchronization/fusesyncserviceaddin.cpp:115 +msgid "" +"This synchronization addin is not supported on your computer. Please make " +"sure you have FUSE and %1% correctly installed and configured" +msgstr "" +"Ovaj dodatak za usklađivanje nije podržan na vašem kompjuteru. Molim vas " +"budite sigurni da imate FUSE i %1% pravilno istaliran i podešen." + +#: ../src/synchronization/fusesyncserviceaddin.cpp:158 +msgid "Could not read testfile." +msgstr "Ne mogu da čitam datoteku testa." + +#: ../src/synchronization/fusesyncserviceaddin.cpp:167 +msgid "Write test failed." +msgstr "Test pisanja nije uspeo." + +#: ../src/synchronization/fusesyncserviceaddin.cpp:196 +msgid "Timeout connecting to server." +msgstr "Vrijeme čekanja za povezivanje sa serverom." + +#: ../src/synchronization/fusesyncserviceaddin.cpp:202 +msgid "Error connecting to server." +msgstr "Greška pri povezivanju sa serverom." + +#: ../src/synchronization/fusesyncserviceaddin.cpp:215 +msgid "FUSE could not be enabled." +msgstr "FUSE ne može biti omogućen." + +#: ../src/synchronization/fusesyncserviceaddin.cpp:246 +msgid "An error occurred while connecting to the specified server" +msgstr "Greška pri povezivanju sa odabranim serverom." + +#. TRANSLATORS: %s is file +#: ../src/synchronization/gnotesyncclient.cpp:165 +#, c-format +msgid "Unparsable last-sync-date element in %s" +msgstr "Neparsibilan element datum-posljednjeg-usklađivanja u %s" + +#. TRANSLATORS: %s is file +#: ../src/synchronization/gnotesyncclient.cpp:175 +#, c-format +msgid "Unparsable last-sync-rev element in %s" +msgstr "Neparsibilan element datum-posljednje-revizije u %s" + +#: ../src/synchronization/syncdialog.cpp:64 +msgid "Note Conflict" +msgstr "Sukob bilješki" + +#. Suggest renaming note by appending " (old)" to the existing title +#: ../src/synchronization/syncdialog.cpp:69 +msgid " (old)" +msgstr " (stara)" + +#: ../src/synchronization/syncdialog.cpp:114 +msgid "Rename local note:" +msgstr "Preimenuj lokalnu bilješku:" + +#: ../src/synchronization/syncdialog.cpp:121 +msgid "Update links in referencing notes" +msgstr "Ažuriraj veze u bilješkama koje je pozivaju" + +#: ../src/synchronization/syncdialog.cpp:127 +msgid "Overwrite local note" +msgstr "Prepiši preko lokalne bilješke" + +#: ../src/synchronization/syncdialog.cpp:131 +msgid "Always perform this action" +msgstr "Uvijek primjeni ovaj postupak" + +#. Set initial dialog text +#: ../src/synchronization/syncdialog.cpp:137 +msgid "Note conflict detected" +msgstr "Primećen je sukob bilješki" + +#: ../src/synchronization/syncdialog.cpp:139 +msgid "" +"The server version of \"%1%\" conflicts with your local note. What do you " +"want to do with your local note?" +msgstr "" +"Verzija servera \"%1%\" je u sukobu sa vašon lokalnom bilješkom. Šta želite " +"da uradite sa vašom lokalnom bilješkom?" + +#. Expander containing TreeView +#: ../src/synchronization/syncdialog.cpp:296 +msgid "Details" +msgstr "Detalji" + +#: ../src/synchronization/syncdialog.cpp:338 +msgid "Status" +msgstr "Status" + +#: ../src/synchronization/syncdialog.cpp:483 +msgid "Acquiring sync lock..." +msgstr "Zaključavam pred usklađivanje..." + +#: ../src/synchronization/syncdialog.cpp:486 +msgid "Committing changes..." +msgstr "Izvršavanje promjena..." + +#: ../src/synchronization/syncdialog.cpp:489 +msgid "Synchronizing Notes" +msgstr "Usklađivanje bilješki" + +#: ../src/synchronization/syncdialog.cpp:490 +msgid "Synchronizing your notes..." +msgstr "Uskađujem tvoje bilješke..." + +#: ../src/synchronization/syncdialog.cpp:491 +msgid "This may take a while, kick back and enjoy!" +msgstr "Ovo može potrajati, zavalite se i uživajte!" + +#: ../src/synchronization/syncdialog.cpp:493 +msgid "Connecting to the server..." +msgstr "Povezujem se sa serverom..." + +#: ../src/synchronization/syncdialog.cpp:499 +msgid "Deleting notes off of the server..." +msgstr "Brišem bilješke sa servera..." + +#: ../src/synchronization/syncdialog.cpp:503 +msgid "Downloading new/updated notes..." +msgstr "Preuzimam nove/ažurirane bilješke..." + +#: ../src/synchronization/syncdialog.cpp:515 +msgid "Server Locked" +msgstr "Server je zaključan" + +#: ../src/synchronization/syncdialog.cpp:516 +msgid "Server is locked" +msgstr "Server je zaključan" + +#: ../src/synchronization/syncdialog.cpp:517 +msgid "" +"One of your other computers is currently synchronizing. Please wait 2 " +"minutes and try again." +msgstr "" +"Neki drugi računar trenutno usklađuje bilješke. Sačekaj 2 minuta i pokušaj " +"ponovo." + +#: ../src/synchronization/syncdialog.cpp:521 +msgid "Preparing to download updates from server..." +msgstr "Spremam se da preuzmem promjene od servera..." + +#: ../src/synchronization/syncdialog.cpp:524 +msgid "Preparing to upload updates to server..." +msgstr "Spremam se da pošaljem promjene serveru..." + +#: ../src/synchronization/syncdialog.cpp:527 +msgid "Uploading notes to server..." +msgstr "Šaljem bilješke serveru..." + +#: ../src/synchronization/syncdialog.cpp:530 +msgid "Synchronization Failed" +msgstr "Neuspjelo usklađivanje" + +#: ../src/synchronization/syncdialog.cpp:531 +msgid "Failed to synchronize" +msgstr "Nisam uspio da uskladim bilješke" + +#: ../src/synchronization/syncdialog.cpp:532 +msgid "Could not synchronize notes. Check the details below and try again." +msgstr "" +"Nisam mogao da uskladim bilješke. Provjeri detalje prikazane ispod i pokušaj " +"ponovo." + +#: ../src/synchronization/syncdialog.cpp:538 +msgid "Synchronization Complete" +msgstr "Završeno usklađivanje" + +#: ../src/synchronization/syncdialog.cpp:539 +msgid "Synchronization is complete" +msgstr "Usklađivanje je završeno" + +# translations. +#: ../src/synchronization/syncdialog.cpp:540 +msgid "%1% note updated." +msgid_plural "%1% notes updated." +msgstr[0] "%1% bilješka ažurirana." +msgstr[1] "%1% bilješke ažurirane." +msgstr[2] "%1% bilješki ažurirano." + +#: ../src/synchronization/syncdialog.cpp:541 +msgid "Your notes are now up to date." +msgstr "Vaše bilješke su sada usklađene." + +#: ../src/synchronization/syncdialog.cpp:546 +msgid "Synchronization Canceled" +msgstr "Prekinuto usklađivanje." + +#: ../src/synchronization/syncdialog.cpp:547 +msgid "Synchronization was canceled" +msgstr "Usklađivanje je prekinuto." + +#: ../src/synchronization/syncdialog.cpp:548 +msgid "You canceled the synchronization. You may close the window now." +msgstr "Usklađivanje je prekinuto. Sada možete zatvoriti prozorčić." + +#: ../src/synchronization/syncdialog.cpp:552 +msgid "Synchronization Not Configured" +msgstr "Usklađivanje nije podešeno" + +#: ../src/synchronization/syncdialog.cpp:553 +msgid "Synchronization is not configured" +msgstr "Usklađivanje nije podešeno" + +#: ../src/synchronization/syncdialog.cpp:554 +msgid "Please configure synchronization in the preferences dialog." +msgstr "Podesi postavke usklađivanja u prozoru sa postavkama." + +#: ../src/synchronization/syncdialog.cpp:558 +msgid "Synchronization Service Error" +msgstr "Greška u servisu za usklađivanje" + +#: ../src/synchronization/syncdialog.cpp:559 +msgid "Service error" +msgstr "Greška usluge" + +#: ../src/synchronization/syncdialog.cpp:560 +msgid "Error connecting to the synchronization service. Please try again." +msgstr "Greška pri povezivanju sa servisom za usklađivanje. Pokušate ponovo." + +#: ../src/synchronization/syncdialog.cpp:574 +msgid "Deleted locally" +msgstr "Lokalno obrisana" + +#: ../src/synchronization/syncdialog.cpp:577 +msgid "Deleted from server" +msgstr "Obrisana sa servera" + +#: ../src/synchronization/syncdialog.cpp:580 +msgid "Updated" +msgstr "Ažurirano" + +#: ../src/synchronization/syncdialog.cpp:583 +msgid "Added" +msgstr "Dodato" + +#: ../src/synchronization/syncdialog.cpp:586 +msgid "Uploaded changes to server" +msgstr "Izmjene su poslate serveru" + +#: ../src/synchronization/syncdialog.cpp:589 +msgid "Uploaded new note to server" +msgstr "Nova bilješka je poslata serveru" + +#: ../src/synchronization/syncmanager.cpp:66 +msgid "Synchronize Notes" +msgstr "Uskladi bilješke" + +#: ../src/synchronization/syncmanager.cpp:85 +#: ../src/synchronization/syncmanager.cpp:102 +#: ../src/synchronization/syncmanager.cpp:575 +#, c-format +msgid "Report a bug. Cast failed: %s" +msgstr "Prijavi kvar. Odbacivanje nije uspjelo: %s" + +#: ../src/synchronization/syncmanager.cpp:148 +#, c-format +msgid "Error cleaning up addin after synchronization: %s" +msgstr "Greška pri čišćenju dodatka nakon usklađivanja : %s" + +#: ../src/synchronization/syncmanager.cpp:173 +#, c-format +msgid "Exception while creating SyncServer: %s" +msgstr "Greška pri stvaranju UsklađivanjeServer: %s" + +#. top-level try +#: ../src/synchronization/syncmanager.cpp:377 +#, c-format +msgid "Synchronization failed with the following exception: %s" +msgstr "Usklađivanje nije uspjelo sa sljedećim izuzecima: %s" + +#: ../src/synchronization/syncutils.cpp:148 +#: ../src/synchronization/syncutils.cpp:180 +msgid "Could not enable FUSE" +msgstr "Ne mogu da omogućim FUSE" + +#: ../src/synchronization/syncutils.cpp:149 +#: ../src/synchronization/syncutils.cpp:181 +msgid "" +"The FUSE module could not be loaded. Please check that it is installed " +"properly and try again." +msgstr "" +"FUSE modul ne može biti učitan. Uvjeri se da je ispravno instaliran i " +"pokušaj ponovo." + +#: ../src/synchronization/syncutils.cpp:157 +msgid "Enable FUSE?" +msgstr "Omogući FUSE?" + +#. TODO: This message isn't entirely accurate. +#. We should fix it. +#: ../src/synchronization/syncutils.cpp:160 +msgid "" +"The synchronization you've chosen requires the FUSE module to be loaded.\n" +"\n" +"To avoid getting this prompt in the future, you should load FUSE at " +"startup. Add \"modprobe fuse\" to /etc/init.d/boot.local or \"fuse\" to /" +"etc/modules." +msgstr "" +"Odabrani postupak usklađivanja zahtjeva da FUSE modul bude učitan.\n" +"\n" +"Za izbjegavanje ovog prozorčeta u budućnosti, trebaš učitati FUSE pri " +"pokretanju. Dodaj „modprobe fuse“ u /etc/init.d/boot.local ili „fuse“ u /etc/" +"modules." + +#: ../src/utils.cpp:144 +msgid "" +"The \"Gnote Manual\" could not be found. Please verify that your " +"installation has been completed successfully." +msgstr "" +"\"Gnote Uputstvo\" nije pronađeno. Molim vas verifikujte da je vaša " +"instalacija uspješno obavljena." + +#: ../src/utils.cpp:152 +msgid "Help not found" +msgstr "Pomoć nije pronađena" + +#: ../src/utils.cpp:185 +msgid "Cannot open location" +msgstr "Ne mogu da otvorim lokaciju" + +#. TRANSLATORS: argument is time. +#: ../src/utils.cpp:215 +msgid "Today, %1%" +msgstr "Danas, %1%" + +#: ../src/utils.cpp:216 +msgid "Today" +msgstr "Danas" + +#. TRANSLATORS: argument is time. +#: ../src/utils.cpp:222 +msgid "Yesterday, %1%" +msgstr "Jučer, %1%" + +#: ../src/utils.cpp:223 +msgid "Yesterday" +msgstr "Juče" + +#. TRANSLATORS: argument is time. +#: ../src/utils.cpp:229 +msgid "Tomorrow, %1%" +msgstr "Sutra, %1%" + +#: ../src/utils.cpp:230 +msgid "Tomorrow" +msgstr "Sutra" + +#. TRANSLATORS: date in current year. +#: ../src/utils.cpp:234 +msgid "%b %d" +msgstr "%b %d" + +#. TRANSLATORS: first argument is date, second is time. +#: ../src/utils.cpp:237 ../src/utils.cpp:249 +msgid "%1%, %2%" +msgstr "%1%, %2%" + +#: ../src/utils.cpp:242 +msgid "No Date" +msgstr "Nema Datuma" + +#. TRANSLATORS: date in other than current year. +#: ../src/utils.cpp:246 +msgid "%b %d %Y" +msgstr "%b %d %Y" + +#: ../src/watchers.cpp:200 +msgid "(Untitled %1%)" +msgstr "(Bez naslova %1%)" + +#: ../src/watchers.cpp:231 +msgid "" +"A note with the title %1% already exists. Please choose another name " +"for this note before continuing." +msgstr "" +"Bilješka sa naslovom %1% već postoji. Molim vas odaberite novo ime " +"za ovu bilješku prije nego što nastavite dalje." + +#: ../src/watchers.cpp:246 +msgid "Note title taken" +msgstr "Naslov bilješke je zauzet" + +#: ../src/watchers.cpp:309 +msgid "Check spelling" +msgstr "Provjeri ispravno pisanje" + +#: ../src/watchers.cpp:310 +msgid "Check spelling in this note" +msgstr "Provjeri ispravno pisanje u bilješki" + +#: ../src/watchers.cpp:674 +msgid "_Copy Link Address" +msgstr "_Kopiraj adresu veze" + +#: ../src/watchers.cpp:680 +msgid "_Open Link" +msgstr "_Otvori vezu" diff -Nru gnote-3.14.2/po/cs.po gnote-3.16.0/po/cs.po --- gnote-3.14.2/po/cs.po 2015-01-17 12:53:24.000000000 +0000 +++ gnote-3.16.0/po/cs.po 2015-03-07 18:13:28.000000000 +0000 @@ -9,15 +9,15 @@ # Pavel Šefránek , 2008, 2009. # Petr Kovar , 2008, 2009. # Lucas Lommer , 2008, 2009. -# Marek Černocký , 2009, 2010, 2011, 2012, 2013, 2014. +# Marek Černocký , 2009, 2010, 2011, 2012, 2013, 2014, 2015. # msgid "" msgstr "" -"Project-Id-Version: gnote gnome-3.14\n" +"Project-Id-Version: gnote\n" "Report-Msgid-Bugs-To: http://bugzilla.gnome.org/enter_bug.cgi?" "product=gnote&keywords=I18N+L10N&component=general\n" -"POT-Creation-Date: 2014-12-26 09:16+0000\n" -"PO-Revision-Date: 2014-12-26 12:03+0100\n" +"POT-Creation-Date: 2015-01-18 22:13+0000\n" +"PO-Revision-Date: 2015-01-18 23:14+0100\n" "Last-Translator: Marek Černocký \n" "Language-Team: Czech \n" "Language: cs\n" @@ -338,15 +338,8 @@ msgstr "Použít stavovou ikonu, když je spuštěno jako aplikace" #: ../data/org.gnome.gnote.gschema.xml.in.h:50 -msgid "" -"Has affect only when started as an application. When set to TRUE, shows a " -"status icon. If set to FALSE, Search All Notes window is used as main " -"application window, closing which makes application to exit." -msgstr "" -"Má význam, jen když je spouštěno jako aplikace. Pokud nastavíte na ZAPNUTO, " -"zobrazí se stavová ikona. Pokud na VYPNUTO, je okno Hledat ve všech " -"poznámkách použito jako hlavní okno aplikace a jeho zavřením se zavře celá " -"aplikace." +msgid "Deprecated, has no effect." +msgstr "Zavrženo, nijak se neprojeví." #: ../data/org.gnome.gnote.gschema.xml.in.h:51 msgid "Open notes in new window" @@ -377,112 +370,37 @@ msgstr "Zobrazit menu appletu" #: ../data/org.gnome.gnote.gschema.xml.in.h:56 -msgid "" -"The global keybinding for showing the Gnote applet's menu. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such " -"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " -"special string \"disabled\", then there will be no keybinding for this " -"action." -msgstr "" -"Globální klávesová zkratka pro zobrazení menu appletu Gnote. Formát vypadá " -"jako „<Control>a“ nebo „<Shift><Alt>F1“. Analyzátor je " -"poměrně velkorysý a povoluje velká i malá písmena a zkratky, např. „<" -"Ctl>“ a „<Ctrl>“. Pokud možnost nastavíte na speciální řetězec " -"„disabled“, nebude pro tuto akci žádná klávesová zkratka." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:57 msgid "Open Start Here" msgstr "Otevřít Začněte zde" -#: ../data/org.gnome.gnote.gschema.xml.in.h:58 -msgid "" -"The global keybinding for opening the \"Start Here\" note. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such " -"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " -"special string \"disabled\", then there will be no keybinding for this " -"action." -msgstr "" -"Globální klávesová zkratka pro otevření poznámky „Začněte zde“. Formát " -"vypadá jako „<Control>a“ nebo „<Shift><Alt>F1“. Analyzátor " -"je poměrně velkorysý a povoluje velká i malá písmena a zkratky, např. „<" -"Ctl>“ a „<Ctrl>“. Pokud možnost nastavíte na speciální řetězec " -"„disabled“, nebude pro tuto akci žádná klávesová zkratka." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:59 +#: ../data/org.gnome.gnote.gschema.xml.in.h:57 msgid "Create a new Note" msgstr "Vytvořit novou poznámku" -#: ../data/org.gnome.gnote.gschema.xml.in.h:60 -msgid "" -"The global keybinding for creating and displaying a new Note. The format " -"looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " -"parser is fairly liberal and allows lower or upper case, and also " -"abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the " -"option to the special string \"disabled\", then there will be no keybinding " -"for this action." -msgstr "" -"Globální klávesová zkratka pro vytvoření a zobrazení nové poznámky. Formát " -"vypadá jako „<Control>a“ nebo „<Shift><Alt>F1“. Analyzátor " -"je poměrně velkorysý a povoluje velká i malá písmena a zkratky, např. „<" -"Ctl>“ a „<Ctrl>“. Pokud možnost nastavíte na speciální řetězec " -"„disabled“, nebude pro tuto akci žádná klávesová zkratka." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:61 +#: ../data/org.gnome.gnote.gschema.xml.in.h:58 msgid "Open Search Dialog" msgstr "Otevřít dialog hledání" -#: ../data/org.gnome.gnote.gschema.xml.in.h:62 -msgid "" -"The global keybinding for opening the Note Search dialog. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such " -"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " -"special string \"disabled\", then there will be no keybinding for this " -"action." -msgstr "" -"Globální klávesová zkratka pro otevření dialogu s hledáním poznámky. Formát " -"vypadá jako „<Control>a“ nebo „<Shift><Alt>F1“. Analyzátor " -"je poměrně velkorysý a povoluje velká i malá písmena a zkratky, např. „<" -"Ctl>“ a „<Ctrl>“. Pokud možnost nastavíte na speciální řetězec " -"„disabled“, nebude pro tuto akci žádná klávesová zkratka." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:63 +#: ../data/org.gnome.gnote.gschema.xml.in.h:59 msgid "Open Recent Changes" msgstr "Otevřít nedávné změny" -#: ../data/org.gnome.gnote.gschema.xml.in.h:64 -msgid "" -"The global keybinding for opening the Recent Changes dialog. The format " -"looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " -"parser is fairly liberal and allows lower or upper case, and also " -"abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the " -"option to the special string \"disabled\", then there will be no keybinding " -"for this action." -msgstr "" -"Globální klávesová zkratka pro otevření dialogu Nedávné změny. Formát vypadá " -"jako „<Control>a“ nebo „<Shift><Alt>F1“. Analyzátor je " -"poměrně velkorysý a povoluje velká i malá písmena a zkratky, např. „<" -"Ctl>“ a „<Ctrl>“. Pokud možnost nastavíte na speciální řetězec " -"„disabled“, nebude pro tuto akci žádná klávesová zkratka." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:65 +#: ../data/org.gnome.gnote.gschema.xml.in.h:60 msgid "HTML Export Last Directory" msgstr "Poslední složka exportu do HTML" -#: ../data/org.gnome.gnote.gschema.xml.in.h:66 +#: ../data/org.gnome.gnote.gschema.xml.in.h:61 msgid "" "The last directory a note was exported to using the Export To HTML plugin." msgstr "" "Poslední složka, do které byla exportována poznámka pomocí zásuvného modulu " "Exportovat do HTML." -#: ../data/org.gnome.gnote.gschema.xml.in.h:67 +#: ../data/org.gnome.gnote.gschema.xml.in.h:62 msgid "HTML Export Linked Notes" msgstr "Exportovat související poznámky do HTML" -#: ../data/org.gnome.gnote.gschema.xml.in.h:68 +#: ../data/org.gnome.gnote.gschema.xml.in.h:63 msgid "" "The last setting for the 'Export linked notes' checkbox in the Export to " "HTML plugin." @@ -490,11 +408,11 @@ "Poslední nastavení zaškrtávacího pole „Exportovat související poznámky“ v " "zásuvném modulu Exportovat do HTML." -#: ../data/org.gnome.gnote.gschema.xml.in.h:69 +#: ../data/org.gnome.gnote.gschema.xml.in.h:64 msgid "HTML Export All Linked Notes" msgstr "Exportovat všechny související poznámky do HTML" -#: ../data/org.gnome.gnote.gschema.xml.in.h:70 +#: ../data/org.gnome.gnote.gschema.xml.in.h:65 msgid "" "The last setting for the 'Include all other linked notes' checkbox in the " "Export to HTML plugin. This setting is used in conjunction with the 'HTML " @@ -506,11 +424,11 @@ "ve spolupráci s nastavením „Exportovat související poznámky do HTML“ a " "určuje, zda budou zahrnouty všechny související poznámky při exportu do HTML." -#: ../data/org.gnome.gnote.gschema.xml.in.h:71 +#: ../data/org.gnome.gnote.gschema.xml.in.h:66 msgid "Synchronization Client ID" msgstr "ID synchronizačního klienta" -#: ../data/org.gnome.gnote.gschema.xml.in.h:72 +#: ../data/org.gnome.gnote.gschema.xml.in.h:67 msgid "" "Unique identifier for this Gnote client, used when communicating with a " "synchronization server." @@ -518,11 +436,11 @@ "Jedinečný identifikátor klienta Gnote používaný při komunikaci se " "synchronizačním serverem." -#: ../data/org.gnome.gnote.gschema.xml.in.h:73 +#: ../data/org.gnome.gnote.gschema.xml.in.h:68 msgid "Synchronization Local Server Path" msgstr "Cesta k místnímu serveru synchronizace" -#: ../data/org.gnome.gnote.gschema.xml.in.h:74 +#: ../data/org.gnome.gnote.gschema.xml.in.h:69 msgid "" "Path to the synchronization server when using the filesystem synchronization " "service addin." @@ -530,21 +448,21 @@ "Cesta k synchronizačnímu serveru v případě používání doplňku pro " "synchronizaci systému souborů." -#: ../data/org.gnome.gnote.gschema.xml.in.h:75 +#: ../data/org.gnome.gnote.gschema.xml.in.h:70 msgid "Selected Synchronization Service Addin" msgstr "Nastavené synchronizační rozšíření" -#: ../data/org.gnome.gnote.gschema.xml.in.h:76 +#: ../data/org.gnome.gnote.gschema.xml.in.h:71 msgid "" "Unique identifier for the currently configured note synchronization service " "addin." msgstr "Jedinečný identifikátor nastaveného rozšíření synchronizace poznámek." -#: ../data/org.gnome.gnote.gschema.xml.in.h:77 +#: ../data/org.gnome.gnote.gschema.xml.in.h:72 msgid "Note Synchronization Conflict Saved Behavior" msgstr "Výchozí akce při konfliktu poznámek" -#: ../data/org.gnome.gnote.gschema.xml.in.h:78 +#: ../data/org.gnome.gnote.gschema.xml.in.h:73 msgid "" "Integer value indicating if there is a preference to always perform a " "specific behavior when a conflict is detected, instead of prompting the " @@ -557,11 +475,11 @@ "okně Předvolby -> Synchronizace -> Pokročilé. Akce jsou analogicky číslovány " "od 0 (vždy se zeptat) do 2." -#: ../data/org.gnome.gnote.gschema.xml.in.h:79 +#: ../data/org.gnome.gnote.gschema.xml.in.h:74 msgid "Automatic Background Synchronization Timeout" msgstr "Časový limit automatické synchronizace na pozadí" -#: ../data/org.gnome.gnote.gschema.xml.in.h:80 +#: ../data/org.gnome.gnote.gschema.xml.in.h:75 msgid "" "Integer value indicating how frequently to perform a background sync of your " "notes (when sync is configured). Any value less than 1 indicates that " @@ -573,11 +491,11 @@ "hodnota nižší než 1 znamená, že je synchronizace vypnutá. Nejnižší " "přijatelná kladná hodnota je 5. Hodnota představuje čas v minutách." -#: ../data/org.gnome.gnote.gschema.xml.in.h:81 +#: ../data/org.gnome.gnote.gschema.xml.in.h:76 msgid "Accept SSL Certificates" msgstr "Přijímat certifikáty SSL" -#: ../data/org.gnome.gnote.gschema.xml.in.h:82 +#: ../data/org.gnome.gnote.gschema.xml.in.h:77 msgid "" "Use wdfs option \"-ac\" to accept SSL certificates without prompting the " "user." @@ -585,27 +503,27 @@ "Chcete-li přijímat certifikáty SSL bez zobrazení výzvy, spouštějte wdfs s " "přepínačem „-ac“." -#: ../data/org.gnome.gnote.gschema.xml.in.h:83 +#: ../data/org.gnome.gnote.gschema.xml.in.h:78 msgid "Share URL" msgstr "Adresa URL sdílení" -#: ../data/org.gnome.gnote.gschema.xml.in.h:84 +#: ../data/org.gnome.gnote.gschema.xml.in.h:79 msgid "WebDAV share URL where notes are synchronized to." msgstr "Adresa URL sdílení WebDAV, do kterého jsou poznámky synchronizovány." -#: ../data/org.gnome.gnote.gschema.xml.in.h:85 +#: ../data/org.gnome.gnote.gschema.xml.in.h:80 msgid "Share username" msgstr "Uživatelské jméno sdílení" -#: ../data/org.gnome.gnote.gschema.xml.in.h:86 +#: ../data/org.gnome.gnote.gschema.xml.in.h:81 msgid "Username to access WebDAV share." msgstr "Uživatelské jméno pro přístup ke sdílení WebDAV." -#: ../data/org.gnome.gnote.gschema.xml.in.h:87 +#: ../data/org.gnome.gnote.gschema.xml.in.h:82 msgid "Timestamp format" msgstr "Formát časové značky" -#: ../data/org.gnome.gnote.gschema.xml.in.h:88 +#: ../data/org.gnome.gnote.gschema.xml.in.h:83 msgid "" "The date format that is used for the timestamp. It follows the format of " "strftime(3)." @@ -613,11 +531,11 @@ "Formát data, který se používá pro datové razítko. Vychází z formátů funkce " "strftime(3)." -#: ../data/org.gnome.gnote.gschema.xml.in.h:89 +#: ../data/org.gnome.gnote.gschema.xml.in.h:84 msgid "Time between checks" msgstr "Doba mezi kontrolami" -#: ../data/org.gnome.gnote.gschema.xml.in.h:90 +#: ../data/org.gnome.gnote.gschema.xml.in.h:85 msgid "" "Time interval between note directory checks (in seconds). Min value is 5." msgstr "" @@ -625,7 +543,6 @@ "možná hodnota je 5." #: ../src/actionmanager.cpp:84 ../src/actionmanager.cpp:171 -#: ../src/tray.cpp:465 msgid "_Quit" msgstr "U_končit" @@ -634,7 +551,6 @@ msgstr "Ukončit Gnote" #: ../src/actionmanager.cpp:89 ../src/actionmanager.cpp:168 -#: ../src/tray.cpp:448 msgid "_Preferences" msgstr "_Předvolby" @@ -662,19 +578,19 @@ msgid "TrayIcon" msgstr "Ikona v panelu" -#: ../src/actionmanager.cpp:107 ../src/tray.cpp:225 +#: ../src/actionmanager.cpp:107 msgid "Create _New Note" msgstr "Vytvořit _novou poznámku" -#: ../src/actionmanager.cpp:107 ../src/tray.cpp:227 +#: ../src/actionmanager.cpp:107 msgid "Create a new note" msgstr "Vytvořit novou poznámku" -#: ../src/actionmanager.cpp:112 ../src/tray.cpp:234 +#: ../src/actionmanager.cpp:112 msgid "_Search All Notes" msgstr "_Hledat ve všech poznámkách" -#: ../src/actionmanager.cpp:112 ../src/tray.cpp:236 +#: ../src/actionmanager.cpp:112 msgid "Open the Search All Notes window" msgstr "Otevřít okno Hledat ve všech poznámkách" @@ -686,7 +602,7 @@ msgid "New _Window" msgstr "No_vé okno" -#: ../src/actionmanager.cpp:169 ../src/tray.cpp:453 +#: ../src/actionmanager.cpp:169 msgid "_Help" msgstr "Nápo_věda" @@ -1039,10 +955,6 @@ "Doplněk „Sledování složky s poznámkami“: Aktualizace přerušena, chyba " "zpracování %s: %s" -#: ../src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp:35 -msgid "_Directory check interval:" -msgstr "Interval kontrol s_ložky:" - #: ../src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in.in.h:1 msgid "Note Directory Watcher" msgstr "Sledování složky s poznámkami" @@ -1055,6 +967,10 @@ msgid "Aurimas Černius and Tomboy original authors" msgstr "Aurimas Černius a původní autoři aplikace Tomboy." +#: ../src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp:35 +msgid "_Directory check interval:" +msgstr "Interval kontrol s_ložky:" + #: ../src/addins/noteoftheday/noteoftheday.cpp:33 msgid "Today: Template" msgstr "Dnes: Šablona" @@ -1166,8 +1082,8 @@ msgid "Pierre-Yves Luyten" msgstr "Pierre-Yves Luyten" -#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:1 #: ../src/addins/specialnotes/specialnotesapplicationaddin.cpp:38 +#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:1 msgid "Special Notes" msgstr "Speciální poznámky" @@ -1385,15 +1301,15 @@ msgid "Exception thrown when creating note: %s" msgstr "Došlo k výjimce při vytváření poznámky: %s" -#: ../src/gnote.cpp:200 +#: ../src/gnote.cpp:185 msgid "Gnote is already running. Exiting..." msgstr "Gnote již běží. Ukončuje se…" -#: ../src/gnote.cpp:365 +#: ../src/gnote.cpp:289 msgid "and Tomboy original authors." msgstr "a původní autoři aplikace Tomboy." -#: ../src/gnote.cpp:371 +#: ../src/gnote.cpp:295 msgid "translator-credits" msgstr "" "Miloslav Trmač , 2005, 2006\n" @@ -1403,92 +1319,92 @@ "Lucas Lommer , 2008, 2009\n" "Marek Černocký , 2009, 2010, 2011, 2012" -#: ../src/gnote.cpp:380 +#: ../src/gnote.cpp:304 msgid "" -"Copyright © 2010-2014 Aurimas Cernius\n" +"Copyright © 2010-2015 Aurimas Cernius\n" "Copyright © 2009-2011 Debarshi Ray\n" "Copyright © 2009 Hubert Figuiere\n" "Copyright © 2004-2009 the Tomboy original authors." msgstr "" -"Copyright © 2010 – 2014 Aurimas Cernius\n" +"Copyright © 2010 – 2015 Aurimas Cernius\n" "Copyright © 2009 – 2011 Debarshi Ray\n" "Copyright © 2009 Hubert Figuiere\n" "Copyright © 2004 – 2009 původní autoři Tomboy." -#: ../src/gnote.cpp:384 +#: ../src/gnote.cpp:308 msgid "A simple and easy to use desktop note-taking application." msgstr "" "Jednoduchá a snadno použitelná aplikace pro poznámky na pracovní ploše." -#: ../src/gnote.cpp:395 +#: ../src/gnote.cpp:319 msgid "Homepage" msgstr "Domovská stránka" -#: ../src/gnote.cpp:570 +#: ../src/gnote.cpp:494 msgid "Run Gnote in background." msgstr "Spustit Gnote na pozadí" -#: ../src/gnote.cpp:571 +#: ../src/gnote.cpp:495 msgid "Run Gnote as GNOME Shell search provider." msgstr "Spustit Gnote jako poskytovatele vyhledávání pro GNOME Shell" -#: ../src/gnote.cpp:572 +#: ../src/gnote.cpp:496 msgid "Specify the path of the directory containing the notes." msgstr "Určit cestu ke složce obsahující poznámky." -#: ../src/gnote.cpp:572 +#: ../src/gnote.cpp:496 msgid "path" msgstr "cesta" -#: ../src/gnote.cpp:573 +#: ../src/gnote.cpp:497 msgid "Open the search all notes window with the search text." msgstr "Otevřít okno Hledat ve všech poznámkách s hledaným textem." -#: ../src/gnote.cpp:573 ../src/gnote.cpp:578 +#: ../src/gnote.cpp:497 ../src/gnote.cpp:502 msgid "text" msgstr "text" -#: ../src/gnote.cpp:574 +#: ../src/gnote.cpp:498 msgid "Print version information." msgstr "Vypsat informace o verzi." -#: ../src/gnote.cpp:575 +#: ../src/gnote.cpp:499 msgid "Create and display a new note, with a optional title." msgstr "Vytvořit a zobrazit novou poznámku s volitelným názvem." -#: ../src/gnote.cpp:575 +#: ../src/gnote.cpp:499 msgid "title" msgstr "název" -#: ../src/gnote.cpp:576 +#: ../src/gnote.cpp:500 msgid "Display the existing note matching title." msgstr "Zobrazit existující poznámku odpovídající názvem." -#: ../src/gnote.cpp:576 +#: ../src/gnote.cpp:500 msgid "title/url" msgstr "název/url" -#: ../src/gnote.cpp:577 +#: ../src/gnote.cpp:501 msgid "Display the 'Start Here' note." msgstr "Zobrazit poznámku „Začněte zde“." -#: ../src/gnote.cpp:578 +#: ../src/gnote.cpp:502 msgid "Search and highlight text in the opened note." msgstr "Hledat a zvýraznit text v otevřené poznámce." -#: ../src/gnote.cpp:582 +#: ../src/gnote.cpp:506 msgid "A note taking application" msgstr "Aplikace na dělání poznámek" -#: ../src/gnote.cpp:582 +#: ../src/gnote.cpp:506 msgid "Gnote options at launch" msgstr "Volby Gnote při spouštění" -#: ../src/gnote.cpp:659 +#: ../src/gnote.cpp:583 msgid "Could not connect to remote instance." msgstr "Nelze se připojit ke vzdálené instanci." -#: ../src/gnote.cpp:775 +#: ../src/gnote.cpp:699 msgid "Version %1%" msgstr "Verze %1%" @@ -1506,6 +1422,23 @@ msgid "Window is not embedded" msgstr "Okno není vloženo" +#. Probably IOException or UnauthorizedAccessException? +#: ../src/notebase.cpp:200 ../src/note.cpp:382 +#, c-format +msgid "Exception while saving note: %s" +msgstr "Došlo k výjimce při ukládání poznámky: %s" + +#. write failure, but not critical +#: ../src/notebase.cpp:444 +#, c-format +msgid "Failed to update note format: %s" +msgstr "Selhala aktualizace formátu poznámky: %s" + +#: ../src/notebase.cpp:568 +#, c-format +msgid "Filesystem error: %s" +msgstr "Chyba souborového systému: %s" + #: ../src/notebooks/createnotebookdialog.cpp:41 msgid "Create Notebook" msgstr "Vytváření sešitu" @@ -1639,12 +1572,6 @@ "volného místa a můžete zapisovat do složky ~/.local/share/gnote. Podrobné " "chybové hlášení naleznete v ~/.gnote.log." -#. Probably IOException or UnauthorizedAccessException? -#: ../src/note.cpp:382 ../src/notebase.cpp:200 -#, c-format -msgid "Exception while saving note: %s" -msgstr "Došlo k výjimce při ukládání poznámky: %s" - #: ../src/note.cpp:474 #, c-format msgid "Error while saving: %s" @@ -1654,16 +1581,13 @@ msgid "Setting text content for closed notes not supported" msgstr "Nastavení textového obsahu pro uzavřenou poznámku není podporováno" -#. write failure, but not critical -#: ../src/notebase.cpp:444 -#, c-format -msgid "Failed to update note format: %s" -msgstr "Selhala aktualizace formátu poznámky: %s" +#: ../src/notemanagerbase.cpp:105 ../src/preferencesdialog.cpp:320 +msgid "New Note Template" +msgstr "Nová šablona" -#: ../src/notebase.cpp:568 -#, c-format -msgid "Filesystem error: %s" -msgstr "Chyba souborového systému: %s" +#: ../src/notemanagerbase.cpp:359 +msgid "Describe your new note here." +msgstr "Sem napište svou novou poznámku." #: ../src/notemanager.cpp:133 msgid "" @@ -1752,14 +1676,6 @@ msgid "Error parsing note XML, skipping \"%s\": %s" msgstr "Chyba při zpracování kódu XML poznámky, přeskakuje se „%s“: %s" -#: ../src/notemanagerbase.cpp:105 ../src/preferencesdialog.cpp:332 -msgid "New Note Template" -msgstr "Nová šablona" - -#: ../src/notemanagerbase.cpp:359 -msgid "Describe your new note here." -msgstr "Sem napište svou novou poznámku." - #: ../src/noterenamedialog.cpp:123 msgid "Rename Note Links?" msgstr "Přejmenovat odkazy na poznámku?" @@ -1869,47 +1785,47 @@ msgid "Save _Title" msgstr "Uloži_t název" -#: ../src/notewindow.cpp:562 ../src/notewindow.cpp:1084 +#: ../src/notewindow.cpp:562 ../src/notewindow.cpp:1085 msgid "Cannot create note" msgstr "Nelze vytvořit poznámku" -#: ../src/notewindow.cpp:827 +#: ../src/notewindow.cpp:828 msgid "_Link" msgstr "_Odkaz" -#: ../src/notewindow.cpp:828 +#: ../src/notewindow.cpp:829 msgid "_Bold" msgstr "_Tučné" -#: ../src/notewindow.cpp:829 +#: ../src/notewindow.cpp:830 msgid "_Italic" msgstr "_Kurzíva" -#: ../src/notewindow.cpp:830 +#: ../src/notewindow.cpp:831 msgid "_Strikeout" msgstr "_Přeškrtnuté" -#: ../src/notewindow.cpp:832 +#: ../src/notewindow.cpp:833 msgid "_Highlight" msgstr "_Zvýraznění" -#: ../src/notewindow.cpp:834 +#: ../src/notewindow.cpp:835 msgid "_Normal" msgstr "_Normální" -#: ../src/notewindow.cpp:836 +#: ../src/notewindow.cpp:837 msgid "Hu_ge" msgstr "_Obrovské" -#: ../src/notewindow.cpp:838 +#: ../src/notewindow.cpp:839 msgid "_Large" msgstr "_Velké" -#: ../src/notewindow.cpp:840 +#: ../src/notewindow.cpp:841 msgid "S_mall" msgstr "_Malé" -#: ../src/notewindow.cpp:842 +#: ../src/notewindow.cpp:843 msgid "Bullets" msgstr "Odrážky" @@ -1921,44 +1837,30 @@ msgid "Links" msgstr "Odkazy" -#: ../src/preferencesdialog.cpp:125 -msgid "Hotkeys" -msgstr "Klávesové zkratky" - #. TRANSLATORS: Addin category. -#: ../src/preferencesdialog.cpp:129 ../src/sharp/addinstreemodel.cpp:164 +#: ../src/preferencesdialog.cpp:125 ../src/sharp/addinstreemodel.cpp:164 msgid "Synchronization" msgstr "Synchronizace" -#: ../src/preferencesdialog.cpp:131 +#: ../src/preferencesdialog.cpp:127 msgid "Plugins" msgstr "Zásuvné moduly" -#: ../src/preferencesdialog.cpp:208 +#: ../src/preferencesdialog.cpp:204 #, c-format msgid "Plugin %s is absent" msgstr "Zásuvný modul %s schází" -#. Status icon -#: ../src/preferencesdialog.cpp:247 -msgid "Use status _icon" -msgstr "Používat stavovou _ikonu" - -#: ../src/preferencesdialog.cpp:248 -msgid "Show icon in tray, which is the central place of control." -msgstr "" -"Zobrazovat ikonu na hlavní liště, kde slouží jako ústřední místo ovládání." - #. Open in new window -#: ../src/preferencesdialog.cpp:255 +#: ../src/preferencesdialog.cpp:243 msgid "Always _open notes in new window" msgstr "Poznámku vždy _otevřít v novém okně" -#: ../src/preferencesdialog.cpp:268 +#: ../src/preferencesdialog.cpp:256 msgid "_Spell check while typing" msgstr "_Kontrola překlepů během psaní" -#: ../src/preferencesdialog.cpp:269 +#: ../src/preferencesdialog.cpp:257 msgid "" "Misspellings will be underlined in red, with correct spelling suggestions " "shown in the context menu." @@ -1967,61 +1869,61 @@ "kontextové nabídce." #. Auto bulleted list -#: ../src/preferencesdialog.cpp:279 +#: ../src/preferencesdialog.cpp:267 msgid "Enable auto-_bulleted lists" msgstr "Po_volit automatické seznamy s odrážkami" -#: ../src/preferencesdialog.cpp:280 +#: ../src/preferencesdialog.cpp:268 msgid "Start new bulleted list by starting new line with character \"-\"." msgstr "Při započetí nového řádku znakem „-“ začít nový seznam s odrážkami." -#: ../src/preferencesdialog.cpp:289 +#: ../src/preferencesdialog.cpp:277 msgid "Use custom _font" msgstr "Používat vlastní _písmo" -#: ../src/preferencesdialog.cpp:307 +#: ../src/preferencesdialog.cpp:295 msgid "When renaming a linked note: " msgstr "Při přejmenování odkazované poznámky:" -#: ../src/preferencesdialog.cpp:311 +#: ../src/preferencesdialog.cpp:299 msgid "Ask me what to do" msgstr "Dotázat se mě, co udělat" -#: ../src/preferencesdialog.cpp:312 +#: ../src/preferencesdialog.cpp:300 msgid "Never rename links" msgstr "Odkazy nikdy nepřejmenovat" -#: ../src/preferencesdialog.cpp:313 +#: ../src/preferencesdialog.cpp:301 msgid "Always rename links" msgstr "Odkazy vždy přejmenovat" -#: ../src/preferencesdialog.cpp:333 +#: ../src/preferencesdialog.cpp:321 msgid "" "Use the new note template to specify the text that should be used when " "creating a new note." msgstr "Použijte šablonu k upřesnění, jaký text se má vložit do nové poznámky." -#: ../src/preferencesdialog.cpp:338 +#: ../src/preferencesdialog.cpp:326 msgid "Open New Note Template" msgstr "Otevřít šablonu" #. internal links -#: ../src/preferencesdialog.cpp:395 +#: ../src/preferencesdialog.cpp:383 msgid "_Automatically link to notes" msgstr "_Automaticky odkazovat na poznámky" -#: ../src/preferencesdialog.cpp:396 +#: ../src/preferencesdialog.cpp:384 msgid "Enable this option to create a link when text matches note title." msgstr "" "Tuto volbu zapněte, aby se vytvářely odkazy v situaci, kdy se text shoduje s " "názvem poznámky." #. URLs -#: ../src/preferencesdialog.cpp:402 +#: ../src/preferencesdialog.cpp:390 msgid "Create links for _URLs" msgstr "Vytvářet odkazy pro adresy _URL" -#: ../src/preferencesdialog.cpp:403 +#: ../src/preferencesdialog.cpp:391 msgid "" "Enable this option to create links for URLs. Clicking will open URL with " "appropriate program." @@ -2030,11 +1932,11 @@ "tyto adresy otevřou v příslušném programu." #. WikiWords... -#: ../src/preferencesdialog.cpp:410 +#: ../src/preferencesdialog.cpp:398 msgid "Highlight _WikiWords" msgstr "Zvýrazňovat _WikiSlova" -#: ../src/preferencesdialog.cpp:411 +#: ../src/preferencesdialog.cpp:399 msgid "" "Enable this option to highlight words ThatLookLikeThis. Clicking the " "word will create a note with that name." @@ -2042,90 +1944,55 @@ "Tuto volbu zapněte, aby se zvýrazňovala slova, KteráVypadajíTakto. " "Kliknutím na slovo se vytvoří poznámka s takovým názvem." -#. Hotkeys... -#: ../src/preferencesdialog.cpp:441 -msgid "Listen for _hotkeys" -msgstr "Používat _klávesové zkratky" - -#: ../src/preferencesdialog.cpp:442 -msgid "" -"Hotkeys allow you to quickly access your notes from anywhere with a " -"keypress. Example Hotkeys: <Control><Shift>F11, <" -"Alt>N" -msgstr "" -"Klávesové zkratky vám umožňují rychle používat své poznámky odkudkoliv " -"stiskem klávesy. Příklady klávesových zkratek: <Control><" -"Shift>F11, <Alt>N" - -#. Show notes menu keybinding... -#: ../src/preferencesdialog.cpp:464 -msgid "Show notes _menu" -msgstr "Zobrazit nabídku pozná_mek" - -#. Open Start Here keybinding... -#: ../src/preferencesdialog.cpp:481 -msgid "Open \"_Start Here\"" -msgstr "Otevřít „_Začněte zde“" - -#. Create new note keybinding... -#: ../src/preferencesdialog.cpp:497 -msgid "Create _new note" -msgstr "Vytvořit _novou poznámku" - -#. Open Search window keybinding... -#: ../src/preferencesdialog.cpp:513 -msgid "Open Search _Window" -msgstr "Otevřít _okno hledání" - -#: ../src/preferencesdialog.cpp:553 +#: ../src/preferencesdialog.cpp:431 msgid "Ser_vice:" msgstr "Služ_ba:" -#: ../src/preferencesdialog.cpp:609 ../src/preferencesdialog.cpp:1239 +#: ../src/preferencesdialog.cpp:487 ../src/preferencesdialog.cpp:1117 msgid "Not configurable" msgstr "Nedostupné" -#: ../src/preferencesdialog.cpp:636 +#: ../src/preferencesdialog.cpp:514 msgid "Automatical background s_ync interval (minutes)" msgstr "Interval automatické s_ynchronizace na pozadí (v minutách)" #. "Advanced..." button to bring up extra sync config dialog -#: ../src/preferencesdialog.cpp:660 +#: ../src/preferencesdialog.cpp:538 msgid "_Advanced..." msgstr "P_okročilé…" -#: ../src/preferencesdialog.cpp:707 +#: ../src/preferencesdialog.cpp:585 msgid "The following plugins are installed:" msgstr "Máte nainstalovány následující zásuvné moduly:" #. TODO: In a future version, add in an "Install Add-ins..." button #. TODO: In a future version, add in a "Repositories..." button -#: ../src/preferencesdialog.cpp:742 +#: ../src/preferencesdialog.cpp:620 msgid "_Enable" msgstr "_Povolit" -#: ../src/preferencesdialog.cpp:748 +#: ../src/preferencesdialog.cpp:626 msgid "_Disable" msgstr "_Zakázat" -#: ../src/preferencesdialog.cpp:906 +#: ../src/preferencesdialog.cpp:784 msgid "Not Implemented" msgstr "Není implementováno" -#: ../src/preferencesdialog.cpp:922 +#: ../src/preferencesdialog.cpp:800 msgid "%1% Preferences" msgstr "Předvolby %1%" -#: ../src/preferencesdialog.cpp:1057 +#: ../src/preferencesdialog.cpp:935 msgid "Choose Note Font" msgstr "Zvolte písmo poznámek" #. Create dialog -#: ../src/preferencesdialog.cpp:1155 +#: ../src/preferencesdialog.cpp:1033 msgid "Other Synchronization Options" msgstr "Další volby synchronizace" -#: ../src/preferencesdialog.cpp:1158 +#: ../src/preferencesdialog.cpp:1036 msgid "" "When a conflict is detected between a local note and a note on the " "configured synchronization server:" @@ -2134,23 +2001,23 @@ "synchronizačním serveru:" #. label.Xalign = 0; -#: ../src/preferencesdialog.cpp:1162 +#: ../src/preferencesdialog.cpp:1040 msgid "Always ask me what to do" msgstr "Vždy se mě zeptat, co dělat" -#: ../src/preferencesdialog.cpp:1166 +#: ../src/preferencesdialog.cpp:1044 msgid "Rename my local note" msgstr "Přejmenovat moji místní poznámku" -#: ../src/preferencesdialog.cpp:1170 +#: ../src/preferencesdialog.cpp:1048 msgid "Replace my local note with the server's update" msgstr "Zaměnit moji místní poznámku s poznámkou na serveru" -#: ../src/preferencesdialog.cpp:1272 +#: ../src/preferencesdialog.cpp:1150 msgid "Are you sure?" msgstr "Jste si jisti?" -#: ../src/preferencesdialog.cpp:1273 +#: ../src/preferencesdialog.cpp:1151 msgid "" "Clearing your synchronization settings is not recommended. You may be " "forced to synchronize all of your notes again when you save new settings." @@ -2158,11 +2025,11 @@ "Nedoporučuje se mazat nastavení synchronizace. Při příští synchronizaci " "můžete být znovu vyzváni k synchronizaci všech svých poznámek." -#: ../src/preferencesdialog.cpp:1283 +#: ../src/preferencesdialog.cpp:1161 msgid "Resetting Synchronization Settings" msgstr "Obnovuje se nastavení synchronizace" -#: ../src/preferencesdialog.cpp:1284 +#: ../src/preferencesdialog.cpp:1162 msgid "" "You have disabled the configured synchronization service. Your " "synchronization settings will now be cleared. You may be forced to " @@ -2172,11 +2039,11 @@ "nyní smazáno. Může se stát, že při uložení nového nastavení budete muset " "synchronizovat všechny své poznámky znovu." -#: ../src/preferencesdialog.cpp:1350 +#: ../src/preferencesdialog.cpp:1228 msgid "Connection successful" msgstr "Úspěšné připojení" -#: ../src/preferencesdialog.cpp:1351 +#: ../src/preferencesdialog.cpp:1229 msgid "" "Gnote is ready to synchronize your notes. Would you like to synchronize them " "now?" @@ -2184,7 +2051,7 @@ "Aplikace Gnote je připravena synchronizovat vaše poznámky. Chcete je " "synchronizovat právě teď?" -#: ../src/preferencesdialog.cpp:1375 +#: ../src/preferencesdialog.cpp:1253 msgid "" "Please check your information and try again. The log file %1% may contain " "more information about the error." @@ -2192,19 +2059,19 @@ "Zkontrolujte prosím zadané informace a zkuste to znovu. Můžete se také " "zkusit o chybě najít více informací v souboru %1% se záznamem." -#: ../src/preferencesdialog.cpp:1380 +#: ../src/preferencesdialog.cpp:1258 msgid "Error connecting" msgstr "Chyba připojování" -#: ../src/preferencesdialog.cpp:1443 +#: ../src/preferencesdialog.cpp:1321 msgid "Version:" msgstr "Verze:" -#: ../src/preferencesdialog.cpp:1446 +#: ../src/preferencesdialog.cpp:1324 msgid "Author:" msgstr "Autor:" -#: ../src/preferencesdialog.cpp:1451 +#: ../src/preferencesdialog.cpp:1329 msgid "Copyright:" msgstr "Copyright:" @@ -2673,7 +2540,7 @@ "The FUSE module could not be loaded. Please check that it is installed " "properly and try again." msgstr "" -"Nelez načíst modul FUSE. Zkontrolujte prosím, zda je správně nainstalován a " +"Nelze načíst modul FUSE. Zkontrolujte prosím, zda je správně nainstalován a " "zkuste to znovu." #: ../src/synchronization/syncutils.cpp:157 @@ -2696,18 +2563,6 @@ "spuštění. Přidejte „modprobe fuse“ do /etc/init.d/boot.local nebo „fuse“ do /" "etc/modules." -#: ../src/tray.cpp:54 -msgid "Take notes" -msgstr "Probrat poznámky" - -#: ../src/tray.cpp:167 -msgid " (new)" -msgstr " (nová)" - -#: ../src/tray.cpp:458 -msgid "_About Gnote" -msgstr "O _aplikaci Gnote" - #: ../src/utils.cpp:144 msgid "" "The \"Gnote Manual\" could not be found. Please verify that your " diff -Nru gnote-3.14.2/po/de.po gnote-3.16.0/po/de.po --- gnote-3.14.2/po/de.po 2015-01-17 12:53:20.000000000 +0000 +++ gnote-3.16.0/po/de.po 2015-03-07 18:13:28.000000000 +0000 @@ -21,16 +21,16 @@ "Project-Id-Version: gnote master\n" "Report-Msgid-Bugs-To: http://bugzilla.gnome.org/enter_bug.cgi?" "product=gnote&keywords=I18N+L10N&component=general\n" -"POT-Creation-Date: 2014-10-01 08:25+0000\n" -"PO-Revision-Date: 2014-10-05 22:08+0100\n" -"Last-Translator: Christian Kirbach \n" +"POT-Creation-Date: 2014-05-02 10:44+0000\n" +"PO-Revision-Date: 2014-05-01 20:11+0100\n" +"Last-Translator: Benjamin Steinwender \n" "Language-Team: Deutsch \n" "Language: de\n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" "Plural-Forms: nplurals=2; plural=(n != 1);\n" -"X-Generator: Poedit 1.5.4\n" +"X-Generator: Poedit 1.6.4\n" #: ../data/appdata/gnote.appdata.xml.in.h:1 msgid "" @@ -341,12 +341,12 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:47 msgid "Enable closing notes with escape" -msgstr "Schließen von Notizen mit der Esc-Taste aktivieren" +msgstr "Schließen von Notizen mit Escape aktivieren" #: ../data/org.gnome.gnote.gschema.xml.in.h:48 msgid "If enabled, an opened note can be closed by hitting the escape key." msgstr "" -"Wenn aktiviert, kann eine geöffnete Notiz durch Betätigen der Esc-Taste " +"Wenn aktiviert, kann eine geöffnete Notiz durch Betätigen der Escape-Taste " "geschlossen werden." #: ../data/org.gnome.gnote.gschema.xml.in.h:49 @@ -373,27 +373,14 @@ "Open notes in new window instead of replacing active content of the same " "window" msgstr "" -"Notizen in einem neuen Fenster öffnen anstatt aktiven Inhalt des selben " +"Notizen in einem neuen Fenster öffnen anstatt aktiven Inhalt des selbsen " "Fensters zu ersetzen" #: ../data/org.gnome.gnote.gschema.xml.in.h:53 -msgid "Save note window size and autosize note window to it" -msgstr "Fenstergröße von Notizen speichern und automatisch anpassen" - -#: ../data/org.gnome.gnote.gschema.xml.in.h:54 -msgid "" -"Saves note window size and automatically resizes main window to this size, " -"when note is opened." -msgstr "" -"Legt fest, ob die Notizen-Fenstergröße gespeichert werden soll und beim " -"Programmstart das Hauptfenster automatisch an die Größe angepasst werden " -"soll." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:55 msgid "Show applet menu" msgstr "Applet-Menü anzeigen" -#: ../data/org.gnome.gnote.gschema.xml.in.h:56 +#: ../data/org.gnome.gnote.gschema.xml.in.h:54 msgid "" "The global keybinding for showing the Gnote applet's menu. The format looks " "like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " @@ -409,11 +396,11 @@ "speziellen Zeichenkette »disabled« belegt wird, gibt es keine Tastenbelegung " "für diese Aktion." -#: ../data/org.gnome.gnote.gschema.xml.in.h:57 +#: ../data/org.gnome.gnote.gschema.xml.in.h:55 msgid "Open Start Here" msgstr "»Hier starten« öffnen" -#: ../data/org.gnome.gnote.gschema.xml.in.h:58 +#: ../data/org.gnome.gnote.gschema.xml.in.h:56 msgid "" "The global keybinding for opening the \"Start Here\" note. The format looks " "like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " @@ -429,11 +416,11 @@ "speziellen Zeichenkette »disabled« belegt wird, gibt es keine Tastenbelegung " "für diese Aktion." -#: ../data/org.gnome.gnote.gschema.xml.in.h:59 +#: ../data/org.gnome.gnote.gschema.xml.in.h:57 msgid "Create a new Note" msgstr "Eine neue Notiz anlegen" -#: ../data/org.gnome.gnote.gschema.xml.in.h:60 +#: ../data/org.gnome.gnote.gschema.xml.in.h:58 msgid "" "The global keybinding for creating and displaying a new Note. The format " "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " @@ -449,11 +436,11 @@ "Option mit der speziellen Zeichenkette »disabled« belegt wird, gibt es keine " "Tastenbelegung für diese Aktion." -#: ../data/org.gnome.gnote.gschema.xml.in.h:61 +#: ../data/org.gnome.gnote.gschema.xml.in.h:59 msgid "Open Search Dialog" msgstr "Suchdialog öffnen" -#: ../data/org.gnome.gnote.gschema.xml.in.h:62 +#: ../data/org.gnome.gnote.gschema.xml.in.h:60 msgid "" "The global keybinding for opening the Note Search dialog. The format looks " "like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " @@ -469,11 +456,11 @@ "speziellen Zeichenkette »disabled« belegt wird, gibt es keine Tastenbelegung " "für diese Aktion." -#: ../data/org.gnome.gnote.gschema.xml.in.h:63 +#: ../data/org.gnome.gnote.gschema.xml.in.h:61 msgid "Open Recent Changes" msgstr "Letzte Änderungen öffnen" -#: ../data/org.gnome.gnote.gschema.xml.in.h:64 +#: ../data/org.gnome.gnote.gschema.xml.in.h:62 msgid "" "The global keybinding for opening the Recent Changes dialog. The format " "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " @@ -489,34 +476,34 @@ "diese Option mit der speziellen Zeichenkette »disabled« belegt wird, gibt es " "keine Tastenbelegung für diese Aktion." -#: ../data/org.gnome.gnote.gschema.xml.in.h:65 +#: ../data/org.gnome.gnote.gschema.xml.in.h:63 msgid "HTML Export Last Directory" msgstr "HTML-Export: Letzter Ordner" -#: ../data/org.gnome.gnote.gschema.xml.in.h:66 +#: ../data/org.gnome.gnote.gschema.xml.in.h:64 msgid "" "The last directory a note was exported to using the Export To HTML plugin." msgstr "" -"Der letzte Ordner, in den eine Notiz über die Erweiterung »In HTML " -"exportieren« exportiert wurde." +"Der letzte Ordner, in das eine Notiz über das »In HTML exportieren«-Plugin " +"exportiert wurde." -#: ../data/org.gnome.gnote.gschema.xml.in.h:67 +#: ../data/org.gnome.gnote.gschema.xml.in.h:65 msgid "HTML Export Linked Notes" msgstr "HTML-Export: Verknüpfte Notizen" -#: ../data/org.gnome.gnote.gschema.xml.in.h:68 +#: ../data/org.gnome.gnote.gschema.xml.in.h:66 msgid "" "The last setting for the 'Export linked notes' checkbox in the Export to " "HTML plugin." msgstr "" -"Die letzte Einstellung des Ankreuzfelds »Verknüpfte Notizen exportieren« in " -"der Erweiterung »In HTML exportieren«." +"Die letzte Einstellung des Ankreuzfelds »Verknüpfte Notizen exportieren« im " +"»In HTML exportieren«-Plugin." -#: ../data/org.gnome.gnote.gschema.xml.in.h:69 +#: ../data/org.gnome.gnote.gschema.xml.in.h:67 msgid "HTML Export All Linked Notes" msgstr "HTML-Export: Alle verknüpften Notizen" -#: ../data/org.gnome.gnote.gschema.xml.in.h:70 +#: ../data/org.gnome.gnote.gschema.xml.in.h:68 msgid "" "The last setting for the 'Include all other linked notes' checkbox in the " "Export to HTML plugin. This setting is used in conjunction with the 'HTML " @@ -524,16 +511,16 @@ "recursively) should be included during an export to HTML." msgstr "" "Die letzte Einstellung für das Ankreuzfeld »Verknüpfte Notizen exportieren« " -"in der HTML-Export-Erweiterung. Diese Einstellung wird in Verbindung mit der " +"im HTML-Export-Plugin. Diese Einstellung wird in Verbindung mit der " "Einstellung für »HTML-Export: Verknüpfte Notizen« genutzt, um festzulegen, " -"ob alle (rekursiv gefundenen) Notizen in den Export nach HTML einbezogen " +"ob alle(rekursiv gefundenen) Notizen in den Export nach HTML einbezogen " "werden sollen." -#: ../data/org.gnome.gnote.gschema.xml.in.h:71 +#: ../data/org.gnome.gnote.gschema.xml.in.h:69 msgid "Synchronization Client ID" msgstr "Abgleich-Client ID" -#: ../data/org.gnome.gnote.gschema.xml.in.h:72 +#: ../data/org.gnome.gnote.gschema.xml.in.h:70 msgid "" "Unique identifier for this Gnote client, used when communicating with a " "sychronization server." @@ -541,22 +528,22 @@ "Eindeutiger Schlüssel für diesen Gnote-Client, der für die Kommunikation mit " "einem Abgleich-Server verwendet wird." -#: ../data/org.gnome.gnote.gschema.xml.in.h:73 +#: ../data/org.gnome.gnote.gschema.xml.in.h:71 msgid "Synchronization Local Server Path" msgstr "Lokaler Pfad des Abgleich-Server" -#: ../data/org.gnome.gnote.gschema.xml.in.h:74 +#: ../data/org.gnome.gnote.gschema.xml.in.h:72 msgid "" "Path to the synchronization server when using the filesystem synchronization " "service addin." msgstr "" "Pfad zum Abgleich-Server bei Verwendung der Dateisystem-Abgleich-Erweiterung." -#: ../data/org.gnome.gnote.gschema.xml.in.h:75 +#: ../data/org.gnome.gnote.gschema.xml.in.h:73 msgid "Selected Synchronization Service Addin" msgstr "Ausgewählte Abgleich-Erweiterung" -#: ../data/org.gnome.gnote.gschema.xml.in.h:76 +#: ../data/org.gnome.gnote.gschema.xml.in.h:74 msgid "" "Unique identifier for the currently configured note synchronization service " "addin." @@ -564,11 +551,11 @@ "Eindeutiger Schlüssel für die momentan konfigurierte Erweiterung für den " "Abgleich der Notizen." -#: ../data/org.gnome.gnote.gschema.xml.in.h:77 +#: ../data/org.gnome.gnote.gschema.xml.in.h:75 msgid "Note Synchronization Conflict Saved Behavior" msgstr "Gespeichertes Verhalten für Konflikte bei dem Abgleich der Notizen" -#: ../data/org.gnome.gnote.gschema.xml.in.h:78 +#: ../data/org.gnome.gnote.gschema.xml.in.h:76 msgid "" "Integer value indicating if there is a preference to always perform a " "specific behavior when a conflict is detected, instead of prompting the " @@ -577,17 +564,17 @@ "conflict situation on a case-by-case basis." msgstr "" "Ganzzahl, die angibt, ob es eine Festlegung gibt, beim Erkennen eines " -"Konfliktes immer ein spezifisches Verhalten durchzulaufen, statt das Problem " +"Konfliktes immer ein spezifisches Verhalten durchzulaufen statt das Problem " "dem Benutzer zu melden. Die Werte sind einer internen Aufzählung zugeordnet. " "0 legt fest, dass beim Auftreten eines Konfliktes dieser an den Benutzer " "gemeldet werden soll, so dass von Fall zu Fall entschieden werden kann, wie " "mit der Konfliktsituation umgegangen werden soll." -#: ../data/org.gnome.gnote.gschema.xml.in.h:79 +#: ../data/org.gnome.gnote.gschema.xml.in.h:77 msgid "Automatic Background Synchronization Timeout" msgstr "Zeitüberschreitung beim automatischen Abgleichen im Hintergrund" -#: ../data/org.gnome.gnote.gschema.xml.in.h:80 +#: ../data/org.gnome.gnote.gschema.xml.in.h:78 msgid "" "Integer value indicating how frequently to perform a background sync of your " "notes (when sync is configured). Any value less than 1 indicates that " @@ -600,11 +587,11 @@ "niedrigste akzeptable positive Wert ist 5. Der Wert wird in Minuten " "angegeben." -#: ../data/org.gnome.gnote.gschema.xml.in.h:81 +#: ../data/org.gnome.gnote.gschema.xml.in.h:79 msgid "Accept SSL Certificates" msgstr "SSL-Zertifikate akzeptieren" -#: ../data/org.gnome.gnote.gschema.xml.in.h:82 +#: ../data/org.gnome.gnote.gschema.xml.in.h:80 msgid "" "Use wdfs option \"-ac\" to accept SSL certificates without prompting the " "user." @@ -612,27 +599,27 @@ "wdfs-Option »-ac« zum Akzeptieren von SSL-Zertifikaten ohne Nachfrage beim " "Benutzer verwenden." -#: ../data/org.gnome.gnote.gschema.xml.in.h:83 +#: ../data/org.gnome.gnote.gschema.xml.in.h:81 msgid "Share URL" msgstr "Adresse der Freigabe" -#: ../data/org.gnome.gnote.gschema.xml.in.h:84 +#: ../data/org.gnome.gnote.gschema.xml.in.h:82 msgid "WebDAV share URL where notes are synchronized to." msgstr "Adresse der WebDAV-Freigabe für den Abgleich der Notizen." -#: ../data/org.gnome.gnote.gschema.xml.in.h:85 +#: ../data/org.gnome.gnote.gschema.xml.in.h:83 msgid "Share username" msgstr "Benutzername für die Freigabe" -#: ../data/org.gnome.gnote.gschema.xml.in.h:86 +#: ../data/org.gnome.gnote.gschema.xml.in.h:84 msgid "Username to access WebDAV share." msgstr "Benutzername für den Zugriff auf die WebDAV-Freigabe" -#: ../data/org.gnome.gnote.gschema.xml.in.h:87 +#: ../data/org.gnome.gnote.gschema.xml.in.h:85 msgid "Timestamp format" msgstr "Zeitstempel-Format" -#: ../data/org.gnome.gnote.gschema.xml.in.h:88 +#: ../data/org.gnome.gnote.gschema.xml.in.h:86 msgid "" "The date format that is used for the timestamp. It follows the format of " "strftime(3)." @@ -640,11 +627,11 @@ "Das Datumsformat, das für den Zeitstempel verwendet wird. Es folgt den " "Vorgaben von strftime(3)." -#: ../data/org.gnome.gnote.gschema.xml.in.h:89 +#: ../data/org.gnome.gnote.gschema.xml.in.h:87 msgid "Time between checks" msgstr "Zeitintervall zwischen Prüfungen" -#: ../data/org.gnome.gnote.gschema.xml.in.h:90 +#: ../data/org.gnome.gnote.gschema.xml.in.h:88 msgid "" "Time interval between note directory checks (in seconds). Min value is 5." msgstr "" @@ -750,7 +737,7 @@ #: ../src/addinmanager.cpp:187 #, c-format msgid "Note plugin %s is absent" -msgstr "Notiz-Erweiterung %s fehlt" +msgstr "Notiz-Plugin %s fehlt" #: ../src/addinmanager.cpp:224 #, c-format @@ -901,8 +888,8 @@ msgstr "Erstellen der GTG-Schnittstelle aus XML schlug fehl: %s" #: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:100 -msgid "Failed to create D-Bus proxy for GTG" -msgstr "Erstellen des D-Bus-Proxy für GTG schlug fehl" +msgid "Failed to create D_Bus proxy for GTG" +msgstr "Erstellen des D_Bus-Proxy für GTG schlug fehl" #: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:116 #, c-format @@ -1043,7 +1030,7 @@ #: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:263 #, c-format msgid "NoteDirectoryWatcher: Error reading note title from %s" -msgstr "NoteDirectoryWatcher: Fehler beim Lesen des Notiztitels von %s" +msgstr "NoteDirectoryWatcher: Fehler beim Lesen des Notiztitlels von %s" #. TRANSLATORS: %s is file #: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:271 @@ -1414,15 +1401,15 @@ msgid "Exception thrown when creating note: %s" msgstr "Ausnahme trat beim Erstellen der Notiz auf: %s" -#: ../src/gnote.cpp:200 +#: ../src/gnote.cpp:198 msgid "Gnote is already running. Exiting..." msgstr "Gnote läuft bereits. Beenden …" -#: ../src/gnote.cpp:365 +#: ../src/gnote.cpp:359 msgid "and Tomboy original authors." msgstr "und die Originalautoren von Tomboy." -#: ../src/gnote.cpp:371 +#: ../src/gnote.cpp:365 msgid "translator-credits" msgstr "" "Philipp Meier \n" @@ -1431,10 +1418,9 @@ "Hendrik Richter \n" "Andre Klapper \n" "Mario Blättermann \n" -"Benjamin Steinwender \n" -"Christian Kirbach " +"Benjamin Steinwender " -#: ../src/gnote.cpp:380 +#: ../src/gnote.cpp:374 msgid "" "Copyright © 2010-2014 Aurimas Cernius\n" "Copyright © 2009-2011 Debarshi Ray\n" @@ -1446,80 +1432,75 @@ "Copyright © 2009 Hubert Figuiere\n" "Copyright © 2004-2009 Originalautoren von Tomboy." -#: ../src/gnote.cpp:384 +#: ../src/gnote.cpp:378 msgid "A simple and easy to use desktop note-taking application." msgstr "Eine einfache und leicht bedienbare Anwendung für Notizen" -#: ../src/gnote.cpp:395 +#: ../src/gnote.cpp:389 msgid "Homepage" msgstr "Homepage" -#: ../src/gnote.cpp:570 +#: ../src/gnote.cpp:563 msgid "Run Gnote in background." msgstr "Gnote im Hintergrund ausführen." -#: ../src/gnote.cpp:571 -msgid "Run Gnote as GNOME Shell search provider." -msgstr "Gnote als Suchanbieter in der GNOME-Shell ausführen." - -#: ../src/gnote.cpp:572 +#: ../src/gnote.cpp:564 msgid "Specify the path of the directory containing the notes." msgstr "Pfad zum Ordner angeben, der die Notizen enthält." -# Pfad?? -#: ../src/gnote.cpp:572 +#: ../src/gnote.cpp:564 msgid "path" msgstr "path" -#: ../src/gnote.cpp:573 +#: ../src/gnote.cpp:565 msgid "Open the search all notes window with the search text." msgstr "Fenster zum Durchsuchen aller Notizen öffnen." -#: ../src/gnote.cpp:573 ../src/gnote.cpp:578 +#: ../src/gnote.cpp:565 ../src/gnote.cpp:570 msgid "text" msgstr "text" -#: ../src/gnote.cpp:574 +#: ../src/gnote.cpp:566 msgid "Print version information." msgstr "Versionsinformationen anzeigen." -#: ../src/gnote.cpp:575 +#: ../src/gnote.cpp:567 msgid "Create and display a new note, with a optional title." msgstr "Eine neue Notiz anlegen und anzeigen, mit einem optionalen Titel." -#: ../src/gnote.cpp:575 +#: ../src/gnote.cpp:567 msgid "title" msgstr "title" -#: ../src/gnote.cpp:576 +#: ../src/gnote.cpp:568 msgid "Display the existing note matching title." msgstr "Eine vorhandene Notiz dieses Titels anzeigen." -#: ../src/gnote.cpp:576 +#: ../src/gnote.cpp:568 msgid "title/url" msgstr "title/url" -#: ../src/gnote.cpp:577 +#: ../src/gnote.cpp:569 msgid "Display the 'Start Here' note." msgstr "Zeigt die »Hier starten«-Notiz an." -#: ../src/gnote.cpp:578 +#: ../src/gnote.cpp:570 msgid "Search and highlight text in the opened note." msgstr "Text in einer geöffneten Notiz suchen und hervorheben." -#: ../src/gnote.cpp:582 +#: ../src/gnote.cpp:574 msgid "A note taking application" msgstr "Eine Notizzettel-Anwendung" -#: ../src/gnote.cpp:582 +#: ../src/gnote.cpp:574 msgid "Gnote options at launch" msgstr "Optionen beim Start von Gnote" -#: ../src/gnote.cpp:659 +#: ../src/gnote.cpp:651 msgid "Could not connect to remote instance." msgstr "Es konnte nicht mit der entfernten Instanz verbunden werden." -#: ../src/gnote.cpp:775 +#: ../src/gnote.cpp:767 msgid "Version %1%" msgstr "Version %1%" @@ -1529,11 +1510,11 @@ msgid "Failed to load icon (%s, %d): %s" msgstr "Fehler beim Laden des Symbols (%s, %d): %s" -#: ../src/noteaddin.cpp:108 ../src/noteaddin.cpp:122 ../src/noteaddin.cpp:135 +#: ../src/noteaddin.cpp:108 ../src/noteaddin.cpp:121 ../src/noteaddin.cpp:134 msgid "Plugin is disposing already" -msgstr "Erweiterung wird bereits aufgeräumt" +msgstr "" -#: ../src/noteaddin.cpp:139 +#: ../src/noteaddin.cpp:138 msgid "Window is not embedded" msgstr "Fenster ist nicht eingebettet" @@ -1631,11 +1612,11 @@ msgid "Active" msgstr "Aktiv" -#: ../src/notebuffer.cpp:1505 +#: ../src/notebuffer.cpp:1498 msgid " tag mismatch" msgstr "Tag stimmt nicht überein" -#: ../src/notebuffer.cpp:1584 +#: ../src/notebuffer.cpp:1577 #, c-format msgid "Exception: %s" msgstr "Ausnahme: %s" @@ -1672,7 +1653,7 @@ "~/.gnote.log." #. Probably IOException or UnauthorizedAccessException? -#: ../src/note.cpp:382 ../src/notebase.cpp:200 +#: ../src/note.cpp:382 ../src/notebase.cpp:199 #, c-format msgid "Exception while saving note: %s" msgstr "Ausnahme beim Speichern der Notiz: %s" @@ -1688,12 +1669,12 @@ "Das Festlegen eines Inhalts für geschlossene Notizen wird nicht unterstützt" #. write failure, but not critical -#: ../src/notebase.cpp:444 +#: ../src/notebase.cpp:443 #, c-format msgid "Failed to update note format: %s" msgstr "Aktualisieren des Notizformats schlug fehl: %s" -#: ../src/notebase.cpp:568 +#: ../src/notebase.cpp:567 #, c-format msgid "Filesystem error: %s" msgstr "Dateisystem-Fehler: %s" @@ -1728,8 +1709,8 @@ "Gedanken zu ordnen.\n" "\n" "Sie können neue Notizen zum Festhalten Ihrer Ideen anlegen, indem Sie den " -"Menüpunkt »Neue Notiz anlegen« aus dem Gnote-Notizmenü in Ihrem GNOME-Panel " -"auswählen.\n" +"Menüpunkt »Neue Notiz anlegen« aus dem Gnote-Notizenmenü in Ihrem GNOME-" +"Panel auswählen.\n" "\n" "Dann ordnen Sie die von Ihnen angelegten Notizen, indem Sie " "zusammengehörende Notizen und Ideen miteinander verknüpfen.\n" @@ -1794,7 +1775,7 @@ msgid "New Note Template" msgstr "Neue Notizbuchvorlage" -#: ../src/notemanagerbase.cpp:359 +#: ../src/notemanagerbase.cpp:356 msgid "Describe your new note here." msgstr "Beschreiben Sie ihre neue Notiz hier." @@ -1855,36 +1836,47 @@ msgid "Ad_vanced" msgstr "Er_weitert" -#: ../src/notewindow.cpp:372 +#: ../src/notewindow.cpp:368 msgid "_Link to New Note" msgstr "_Verknüpfung zu neuer Notiz" -#: ../src/notewindow.cpp:380 +#: ../src/notewindow.cpp:376 msgid "Te_xt" msgstr "Te_xt" -#: ../src/notewindow.cpp:417 -msgid "Set properties of text" -msgstr "Text-Einstellungen" - -#: ../src/notewindow.cpp:421 -msgid "Is Important" -msgstr "Ist Wichtig" +#: ../src/notewindow.cpp:404 +msgid "Pin" +msgstr "Anheften" + +#: ../src/notewindow.cpp:408 ../src/notewindow.cpp:621 +msgid "Remove from important notes" +msgstr "Von wichtigen Notizen entfernen" + +#: ../src/notewindow.cpp:412 ../src/notewindow.cpp:625 +msgid "Mark note as important" +msgstr "Notiz als wichtig markieren" #: ../src/notewindow.cpp:422 -msgid "Toggle notes presence in Important Notes notebook" -msgstr "Schaltet Notiz-Präsenz in der Notizsammlung Wichtige Notizen" +msgid "Link" +msgstr "Verknüpfung" -#: ../src/notewindow.cpp:430 ../src/searchnoteswidget.cpp:144 -#: ../src/searchnoteswidget.cpp:147 -msgid "_Delete" -msgstr "_Löschen" +#: ../src/notewindow.cpp:428 +msgid "Link selected text to a new note (Ctrl-L)" +msgstr "Gewählten Text mit einer neuen Notiz verknüpfen (Strg+L)" + +#: ../src/notewindow.cpp:434 +msgid "_Text" +msgstr "_Text" + +#: ../src/notewindow.cpp:439 +msgid "Set properties of text" +msgstr "Text-Einstellungen" -#: ../src/notewindow.cpp:430 +#: ../src/notewindow.cpp:449 msgid "Delete this note" msgstr "Diese Notiz löschen" -#: ../src/notewindow.cpp:446 +#: ../src/notewindow.cpp:467 msgid "" "This note is a template note. It determines the default content of regular " "notes, and will not show up in the note menu or search window." @@ -1893,66 +1885,70 @@ "regulärer Notizen fest und wird nicht im Notizmenü oder im Suchfenster " "angezeigt." -#: ../src/notewindow.cpp:449 +#: ../src/notewindow.cpp:470 msgid "Convert to regular note" msgstr "In reguläre Notiz umwandeln" -#: ../src/notewindow.cpp:452 +#: ../src/notewindow.cpp:473 msgid "Save Si_ze" msgstr "_Größe speichern" -#: ../src/notewindow.cpp:456 +#: ../src/notewindow.cpp:477 msgid "Save Se_lection" msgstr "Auswah_l speichern" -#: ../src/notewindow.cpp:460 +#: ../src/notewindow.cpp:481 msgid "Save _Title" msgstr "_Titel speichern" -#: ../src/notewindow.cpp:562 ../src/notewindow.cpp:1084 +#: ../src/notewindow.cpp:583 msgid "Cannot create note" msgstr "Notiz konnte nicht angelegt werden" -#: ../src/notewindow.cpp:827 -msgid "_Link" -msgstr "_Verweis" - -#: ../src/notewindow.cpp:828 +#: ../src/notewindow.cpp:849 msgid "_Bold" msgstr "_Fett" -#: ../src/notewindow.cpp:829 +#: ../src/notewindow.cpp:850 msgid "_Italic" msgstr "_Kursiv" -#: ../src/notewindow.cpp:830 +#: ../src/notewindow.cpp:851 msgid "_Strikeout" msgstr "_Durchgestrichen" -#: ../src/notewindow.cpp:832 +#: ../src/notewindow.cpp:853 msgid "_Highlight" msgstr "_Hervorheben" -#: ../src/notewindow.cpp:834 +#: ../src/notewindow.cpp:855 msgid "_Normal" msgstr "_Normal" -#: ../src/notewindow.cpp:836 +#: ../src/notewindow.cpp:857 msgid "Hu_ge" msgstr "_Riesig" -#: ../src/notewindow.cpp:838 +#: ../src/notewindow.cpp:859 msgid "_Large" msgstr "_Groß" -#: ../src/notewindow.cpp:840 +#: ../src/notewindow.cpp:861 msgid "S_mall" msgstr "_Klein" -#: ../src/notewindow.cpp:842 +#: ../src/notewindow.cpp:863 msgid "Bullets" msgstr "Aufzählungspunkte" +#: ../src/notewindow.cpp:866 +msgid "Increase Font Size" +msgstr "Schrift vergrößern" + +#: ../src/notewindow.cpp:867 +msgid "Decrease Font Size" +msgstr "Schrift verkleinern" + #: ../src/preferencesdialog.cpp:121 msgid "General" msgstr "Allgemein" @@ -2067,8 +2063,8 @@ #: ../src/preferencesdialog.cpp:403 msgid "" -"Enable this option to create links for URLs. Clicking will open URL with " -"apropriate program." +"Enable this option to create a link for URLs. Clicking will open that URL " +"with apropriate program." msgstr "" "Aktivieren Sie diese Einstellung, um Verweise für Adressen zu erstellen. " "Durch einen Klick auf diese Adresse wird das zugehörige Programm geöffnet." @@ -2090,7 +2086,7 @@ #. Hotkeys... #: ../src/preferencesdialog.cpp:441 msgid "Listen for _hotkeys" -msgstr "Auf _Tastenkombinationen achten" +msgstr "Nach _Tastenkombinationen lauschen" #: ../src/preferencesdialog.cpp:442 msgid "" @@ -2098,10 +2094,9 @@ "keypress. Example Hotkeys: <Control><Shift>F11, <" "Alt>N" msgstr "" -"Tastenkombinationen erlauben schnellen Zugang zu Ihren Notizen über einen " -"Tastendruck, egal welche Anwendung Sie gerade benutzen. Beispiele für " -"Tastenkombinationen: <Control><Shift>F11, <Alt>" -"N" +"Hotkeys erlauben schnellen Zugang zu Ihren Notizen über einen Tastendruck, " +"egal welche Anwendung Sie gerade benutzen. Beispiele für Hotkeys: <" +"Control><Shift>F11, <Alt>N" #. Show notes menu keybinding... #: ../src/preferencesdialog.cpp:464 @@ -2118,10 +2113,10 @@ msgid "Create _new note" msgstr "_Neue Notiz anlegen" -#. Open Search window keybinding... +#. Open Search All Notes window keybinding... #: ../src/preferencesdialog.cpp:513 -msgid "Open Search _Window" -msgstr "_Suchdialog öffnen" +msgid "Open \"Search _All Notes\"" +msgstr "»_Alle Notizen durchsuchen« öffnen" #: ../src/preferencesdialog.cpp:553 msgid "Ser_vice:" @@ -2142,7 +2137,7 @@ #: ../src/preferencesdialog.cpp:707 msgid "The following plugins are installed:" -msgstr "Die folgenden Erweiterungen sind installiert:" +msgstr "Die folgenden Plugins sind installiert:" #. TODO: In a future version, add in an "Install Add-ins..." button #. TODO: In a future version, add in a "Repositories..." button @@ -2276,7 +2271,7 @@ msgid "Find _Previous" msgstr "_Vorheriger Treffer" -#: ../src/recentchanges.cpp:673 +#: ../src/recentchanges.cpp:670 msgid "_Close" msgstr "S_chließen" @@ -2293,6 +2288,10 @@ msgid "Open In New _Window" msgstr "In neuem _Fenster öffnen" +#: ../src/searchnoteswidget.cpp:144 ../src/searchnoteswidget.cpp:147 +msgid "_Delete" +msgstr "_Löschen" + #: ../src/searchnoteswidget.cpp:150 msgid "Re_name..." msgstr "_Umbenennen …" @@ -2472,13 +2471,13 @@ msgstr "Beim Verbinden zum angegebenen Server ist ein Fehler aufgetreten" #. TRANSLATORS: %s is file -#: ../src/synchronization/gnotesyncclient.cpp:165 +#: ../src/synchronization/gnotesyncclient.cpp:154 #, c-format msgid "Unparsable last-sync-date element in %s" msgstr "Last-sync-date Element in %s ist nicht analysierbar" #. TRANSLATORS: %s is file -#: ../src/synchronization/gnotesyncclient.cpp:175 +#: ../src/synchronization/gnotesyncclient.cpp:164 #, c-format msgid "Unparsable last-sync-rev element in %s" msgstr "Last-sync-rev Eelement in %s ist nicht analysierbar" @@ -2688,25 +2687,18 @@ msgid "Synchronize Notes" msgstr "Notizen abgleichen" -#: ../src/synchronization/syncmanager.cpp:85 -#: ../src/synchronization/syncmanager.cpp:102 -#: ../src/synchronization/syncmanager.cpp:575 -#, c-format -msgid "Report a bug. Cast failed: %s" -msgstr "Erstellen Sie einen Fehlerbericht. Typenumwandlung fehlgeschlagen: %s" - -#: ../src/synchronization/syncmanager.cpp:148 +#: ../src/synchronization/syncmanager.cpp:124 #, c-format msgid "Error cleaning up addin after synchronization: %s" msgstr "Fehler beim Aufräumen der Erweiterung nach dem Abgleich: %s" -#: ../src/synchronization/syncmanager.cpp:173 +#: ../src/synchronization/syncmanager.cpp:149 #, c-format msgid "Exception while creating SyncServer: %s" msgstr "Ausnahme beim Erstellen von SyncServer: %s" #. top-level try -#: ../src/synchronization/syncmanager.cpp:377 +#: ../src/synchronization/syncmanager.cpp:353 #, c-format msgid "Synchronization failed with the following exception: %s" msgstr "Der Abgleich schlug fehl mit folgender Meldung: %s" @@ -2851,30 +2843,6 @@ msgid "_Open Link" msgstr "Link ö_ffnen" -#~ msgid "Pin" -#~ msgstr "Anheften" - -#~ msgid "Remove from important notes" -#~ msgstr "Von wichtigen Notizen entfernen" - -#~ msgid "Mark note as important" -#~ msgstr "Notiz als wichtig markieren" - -#~ msgid "Link selected text to a new note (Ctrl-L)" -#~ msgstr "Gewählten Text mit einer neuen Notiz verknüpfen (Strg+L)" - -#~ msgid "_Text" -#~ msgstr "_Text" - -#~ msgid "Increase Font Size" -#~ msgstr "Schrift vergrößern" - -#~ msgid "Decrease Font Size" -#~ msgstr "Schrift verkleinern" - -#~ msgid "Open \"Search _All Notes\"" -#~ msgstr "»_Alle Notizen durchsuchen« öffnen" - #~ msgid "Add-ins" #~ msgstr "Add-Ins" @@ -3024,3 +2992,6 @@ #~ msgid "_Tools" #~ msgstr "_Werkzeuge" + +#~ msgid "Run Gnote as a GNOME panel applet." +#~ msgstr "Gnote als Applet im GNOME-Panel ausführen." diff -Nru gnote-3.14.2/po/es.po gnote-3.16.0/po/es.po --- gnote-3.14.2/po/es.po 2015-01-17 12:53:20.000000000 +0000 +++ gnote-3.16.0/po/es.po 2015-03-07 18:13:28.000000000 +0000 @@ -6,15 +6,15 @@ # MIguel Rodriguez Núñez , 2013. # Miguel Rodriguez Nuñez , 2014. # Miguel Rodríguez Núñez , 2013, 2014. -# Daniel Mustieles , 2009, 2010, 2011, 2012, 2013, 2014. +# Daniel Mustieles , 2009, 2010, 2011, 2012, 2013, 2014, 2015. # msgid "" msgstr "" "Project-Id-Version: gnote.master\n" "Report-Msgid-Bugs-To: http://bugzilla.gnome.org/enter_bug.cgi?" "product=gnote&keywords=I18N+L10N&component=general\n" -"POT-Creation-Date: 2014-09-21 15:07+0000\n" -"PO-Revision-Date: 2014-09-22 13:52+0200\n" +"POT-Creation-Date: 2015-01-20 09:21+0000\n" +"PO-Revision-Date: 2015-01-20 11:15+0100\n" "Last-Translator: Daniel Mustieles \n" "Language-Team: Español; Castellano \n" "Language: \n" @@ -338,15 +338,8 @@ msgstr "Usar icono de estado al iniciar como aplicación" #: ../data/org.gnome.gnote.gschema.xml.in.h:50 -msgid "" -"Has affect only when started as an application. When set to TRUE, shows a " -"status icon. If set to FALSE, Search All Notes window is used as main " -"application window, closing which makes application to exit." -msgstr "" -"Sólo tiene efecto cuando se inicia como aplicación. Cuando es cierto, " -"muestra un icono de estado. Si es falso, la ventana «Buscar en todas las " -"notas» se usa como ventana principal de la aplicación, cerrando la que hace " -"que la aplicación termine." +msgid "Deprecated, has no effect." +msgstr "Obsoleto, no tiene ningún efecto" #: ../data/org.gnome.gnote.gschema.xml.in.h:51 msgid "Open notes in new window" @@ -379,116 +372,37 @@ msgstr "Mostrar el menú de miniaplicaciones" #: ../data/org.gnome.gnote.gschema.xml.in.h:56 -msgid "" -"The global keybinding for showing the Gnote applet's menu. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such " -"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " -"special string \"disabled\", then there will be no keybinding for this " -"action." -msgstr "" -"Combinación de teclas global para mostrar el menú de miniaplicaciones de " -"Gnote. El formato sería \\\"<Control>a\\\" o \\\"<Mayús><" -"Alt>F1. El analizador léxico es bastante tolerante y permite letras " -"mayúsculas o minúsculas, y abreviaciones tales como \\\"<Ctl>\\\" y \\" -"\"<Ctrl>\\\". Si activa la opción de cadena especial \\\"disabled\\" -"\" (desactivada) no habrá combinación de teclas para esta acción." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:57 msgid "Open Start Here" msgstr "Abrir comenzar aquí" -#: ../data/org.gnome.gnote.gschema.xml.in.h:58 -msgid "" -"The global keybinding for opening the \"Start Here\" note. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such " -"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " -"special string \"disabled\", then there will be no keybinding for this " -"action." -msgstr "" -"Combinación de teclas global para abrir «Comenzar aquí». El formato sería " -"«<Control>a» o «<Shift><Alt>F1». El analizador léxico es " -"bastante tolerante y permite letras mayúsculas o minúsculas, y abreviaciones " -"tales como «<Ctl>» y «<Ctrl>». Si activa la opción de cadena " -"especial «desactivada» no habrá combinación de teclas para esta acción." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:59 +#: ../data/org.gnome.gnote.gschema.xml.in.h:57 msgid "Create a new Note" msgstr "Crear una nota nueva" -#: ../data/org.gnome.gnote.gschema.xml.in.h:60 -msgid "" -"The global keybinding for creating and displaying a new Note. The format " -"looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " -"parser is fairly liberal and allows lower or upper case, and also " -"abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the " -"option to the special string \"disabled\", then there will be no keybinding " -"for this action." -msgstr "" -"Combinación de teclas global para crear y mostrar una nota nueva. El formato " -"sería «<Control>a» o «<Shift><Alt>F1». El analizador " -"léxico es bastante tolerante y permite letras mayúsculas o minúsculas, y " -"abreviaciones tales como «<Ctl>» y «<Ctrl>». Si activa la opción " -"de cadena especial «desactivada» no habrá combinación de teclas para esta " -"acción." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:61 +#: ../data/org.gnome.gnote.gschema.xml.in.h:58 msgid "Open Search Dialog" msgstr "Abrir el cuadro de diálogo de buscar" -#: ../data/org.gnome.gnote.gschema.xml.in.h:62 -msgid "" -"The global keybinding for opening the Note Search dialog. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such " -"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " -"special string \"disabled\", then there will be no keybinding for this " -"action." -msgstr "" -"Combinación de teclas global para abrir el diálogo de buscar notas. El " -"formato sería «<Control>a» o «<Shift><Alt>F1». El " -"analizador léxico es bastante tolerante y permite letras mayúsculas o " -"minúsculas, y abreviaciones tales como «<Ctl>» y «<Ctrl>». Si " -"activa la opción de cadena especial «desactivada» no habrá combinación de " -"teclas para esta acción." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:63 +#: ../data/org.gnome.gnote.gschema.xml.in.h:59 msgid "Open Recent Changes" msgstr "Abrir cambios recientes" -#: ../data/org.gnome.gnote.gschema.xml.in.h:64 -msgid "" -"The global keybinding for opening the Recent Changes dialog. The format " -"looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " -"parser is fairly liberal and allows lower or upper case, and also " -"abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the " -"option to the special string \"disabled\", then there will be no keybinding " -"for this action." -msgstr "" -"Combinación de teclas global para abrir el diálogo de cambios recientes. El " -"formato sería «<Control>a» o «<Shift><Alt>F1». El " -"analizador léxico es bastante tolerante y permite letras mayúsculas o " -"minúsculas, y abreviaciones tales como «<Ctl>» y «<Ctrl>». Si " -"activa la opción de cadena especial «desactivada» no habrá combinación de " -"teclas para esta acción." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:65 +#: ../data/org.gnome.gnote.gschema.xml.in.h:60 msgid "HTML Export Last Directory" msgstr "Exportar a la último carpeta usada en formato HTML" -#: ../data/org.gnome.gnote.gschema.xml.in.h:66 +#: ../data/org.gnome.gnote.gschema.xml.in.h:61 msgid "" "The last directory a note was exported to using the Export To HTML plugin." msgstr "" "La última carpeta donde se exportó una nota usando el complemento Exportar a " "HTML." -#: ../data/org.gnome.gnote.gschema.xml.in.h:67 +#: ../data/org.gnome.gnote.gschema.xml.in.h:62 msgid "HTML Export Linked Notes" msgstr "Exportar las notas enlazadas a HTML" -#: ../data/org.gnome.gnote.gschema.xml.in.h:68 +#: ../data/org.gnome.gnote.gschema.xml.in.h:63 msgid "" "The last setting for the 'Export linked notes' checkbox in the Export to " "HTML plugin." @@ -496,11 +410,11 @@ "Las última casilla de preferencias para «Exportar las notas enlazadas a " "HTML» en el complemento Exportar a HTML." -#: ../data/org.gnome.gnote.gschema.xml.in.h:69 +#: ../data/org.gnome.gnote.gschema.xml.in.h:64 msgid "HTML Export All Linked Notes" msgstr "Exportar todas las notas enlazadas a HTML" -#: ../data/org.gnome.gnote.gschema.xml.in.h:70 +#: ../data/org.gnome.gnote.gschema.xml.in.h:65 msgid "" "The last setting for the 'Include all other linked notes' checkbox in the " "Export to HTML plugin. This setting is used in conjunction with the 'HTML " @@ -513,23 +427,23 @@ "las notas (encontradas recursivamente) deberían ser incluídas durante la " "exportación a HTML." -#: ../data/org.gnome.gnote.gschema.xml.in.h:71 +#: ../data/org.gnome.gnote.gschema.xml.in.h:66 msgid "Synchronization Client ID" msgstr "ID del cliente de sincronización" -#: ../data/org.gnome.gnote.gschema.xml.in.h:72 +#: ../data/org.gnome.gnote.gschema.xml.in.h:67 msgid "" "Unique identifier for this Gnote client, used when communicating with a " -"sychronization server." +"synchronization server." msgstr "" "Identificador único para este cliente Gnote, usado al comunicar con un " "servidor de sincronización." -#: ../data/org.gnome.gnote.gschema.xml.in.h:73 +#: ../data/org.gnome.gnote.gschema.xml.in.h:68 msgid "Synchronization Local Server Path" msgstr "Ruta al servidor local de sincronización" -#: ../data/org.gnome.gnote.gschema.xml.in.h:74 +#: ../data/org.gnome.gnote.gschema.xml.in.h:69 msgid "" "Path to the synchronization server when using the filesystem synchronization " "service addin." @@ -537,11 +451,11 @@ "Ruta al servidor de sincronización cuando se use el complemento del servicio " "de sincronización de sistema de archivos." -#: ../data/org.gnome.gnote.gschema.xml.in.h:75 +#: ../data/org.gnome.gnote.gschema.xml.in.h:70 msgid "Selected Synchronization Service Addin" msgstr "Seleccione el complemento del servicio de sincronización" -#: ../data/org.gnome.gnote.gschema.xml.in.h:76 +#: ../data/org.gnome.gnote.gschema.xml.in.h:71 msgid "" "Unique identifier for the currently configured note synchronization service " "addin." @@ -549,12 +463,12 @@ "Identificador único para el complemento configurado del servicio de " "sincronización de notas." -#: ../data/org.gnome.gnote.gschema.xml.in.h:77 +#: ../data/org.gnome.gnote.gschema.xml.in.h:72 msgid "Note Synchronization Conflict Saved Behavior" msgstr "" "Comportamiento predeterminado para conflictos de sincronización de notas" -#: ../data/org.gnome.gnote.gschema.xml.in.h:78 +#: ../data/org.gnome.gnote.gschema.xml.in.h:73 msgid "" "Integer value indicating if there is a preference to always perform a " "specific behavior when a conflict is detected, instead of prompting the " @@ -568,11 +482,11 @@ "usuario desea ser preguntado cuando suceda un conflicto, de tal forma que el " "usuario manejará cada situación de conflicto caso por caso." -#: ../data/org.gnome.gnote.gschema.xml.in.h:79 +#: ../data/org.gnome.gnote.gschema.xml.in.h:74 msgid "Automatic Background Synchronization Timeout" msgstr "El tiempo de la sincronización automática en segundo plano ha expirado" -#: ../data/org.gnome.gnote.gschema.xml.in.h:80 +#: ../data/org.gnome.gnote.gschema.xml.in.h:75 msgid "" "Integer value indicating how frequently to perform a background sync of your " "notes (when sync is configured). Any value less than 1 indicates that " @@ -584,11 +498,11 @@ "Cualquier valor menor que 1 indica que la sincronización automática está " "desactivada. El valor mínimo es 5. Este valor se expresa en minutos." -#: ../data/org.gnome.gnote.gschema.xml.in.h:81 +#: ../data/org.gnome.gnote.gschema.xml.in.h:76 msgid "Accept SSL Certificates" msgstr "Aceptar certificados SSL" -#: ../data/org.gnome.gnote.gschema.xml.in.h:82 +#: ../data/org.gnome.gnote.gschema.xml.in.h:77 msgid "" "Use wdfs option \"-ac\" to accept SSL certificates without prompting the " "user." @@ -596,27 +510,27 @@ "Usar la opción wdfs «-ac» para aceptar certificados SSL sin preguntar al " "usuario." -#: ../data/org.gnome.gnote.gschema.xml.in.h:83 +#: ../data/org.gnome.gnote.gschema.xml.in.h:78 msgid "Share URL" msgstr "Compartir URL" -#: ../data/org.gnome.gnote.gschema.xml.in.h:84 +#: ../data/org.gnome.gnote.gschema.xml.in.h:79 msgid "WebDAV share URL where notes are synchronized to." msgstr "URL del recurso WebDAV compartido donde las notas se sincronizan." -#: ../data/org.gnome.gnote.gschema.xml.in.h:85 +#: ../data/org.gnome.gnote.gschema.xml.in.h:80 msgid "Share username" msgstr "Compartir nombre de usuario" -#: ../data/org.gnome.gnote.gschema.xml.in.h:86 +#: ../data/org.gnome.gnote.gschema.xml.in.h:81 msgid "Username to access WebDAV share." msgstr "Nombre de usuario para acceder a la compartición WebDAV" -#: ../data/org.gnome.gnote.gschema.xml.in.h:87 +#: ../data/org.gnome.gnote.gschema.xml.in.h:82 msgid "Timestamp format" msgstr "Formato de la marca de tiempo" -#: ../data/org.gnome.gnote.gschema.xml.in.h:88 +#: ../data/org.gnome.gnote.gschema.xml.in.h:83 msgid "" "The date format that is used for the timestamp. It follows the format of " "strftime(3)." @@ -624,11 +538,11 @@ "El formato de la fecha que se usa para la marca de tiempo. Sigue el formato " "de strftime(3)." -#: ../data/org.gnome.gnote.gschema.xml.in.h:89 +#: ../data/org.gnome.gnote.gschema.xml.in.h:84 msgid "Time between checks" msgstr "Tiempo entre comprobaciones" -#: ../data/org.gnome.gnote.gschema.xml.in.h:90 +#: ../data/org.gnome.gnote.gschema.xml.in.h:85 msgid "" "Time interval between note directory checks (in seconds). Min value is 5." msgstr "" @@ -636,7 +550,6 @@ "valor mínimo es 5." #: ../src/actionmanager.cpp:84 ../src/actionmanager.cpp:171 -#: ../src/tray.cpp:465 msgid "_Quit" msgstr "_Salir" @@ -645,7 +558,6 @@ msgstr "Salir de Gnote" #: ../src/actionmanager.cpp:89 ../src/actionmanager.cpp:168 -#: ../src/tray.cpp:448 msgid "_Preferences" msgstr "Prefere_ncias" @@ -673,19 +585,19 @@ msgid "TrayIcon" msgstr "Icono del área de notificación" -#: ../src/actionmanager.cpp:107 ../src/tray.cpp:225 +#: ../src/actionmanager.cpp:107 msgid "Create _New Note" msgstr "Crear una nota _nueva" -#: ../src/actionmanager.cpp:107 ../src/tray.cpp:227 +#: ../src/actionmanager.cpp:107 msgid "Create a new note" msgstr "Crear una nota nueva" -#: ../src/actionmanager.cpp:112 ../src/tray.cpp:234 +#: ../src/actionmanager.cpp:112 msgid "_Search All Notes" msgstr "_Buscar en todas las notas" -#: ../src/actionmanager.cpp:112 ../src/tray.cpp:236 +#: ../src/actionmanager.cpp:112 msgid "Open the Search All Notes window" msgstr "Abrir la ventana «Buscar en todas las notas»" @@ -697,7 +609,7 @@ msgid "New _Window" msgstr "_Ventana nueva" -#: ../src/actionmanager.cpp:169 ../src/tray.cpp:453 +#: ../src/actionmanager.cpp:169 msgid "_Help" msgstr "Ay_uda" @@ -1050,10 +962,6 @@ "Vigilante de la carpeta de notas: actualización abortada, error al analizar " "%s: %s" -#: ../src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp:35 -msgid "_Directory check interval:" -msgstr "Intervalo de comprobación de _carpeta:" - #: ../src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in.in.h:1 msgid "Note Directory Watcher" msgstr "Vigilante de la carpeta de notas" @@ -1066,6 +974,10 @@ msgid "Aurimas Černius and Tomboy original authors" msgstr "Aurimas Černius y los autores originales de Tomboy" +#: ../src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp:35 +msgid "_Directory check interval:" +msgstr "Intervalo de comprobación de _carpeta:" + #: ../src/addins/noteoftheday/noteoftheday.cpp:33 msgid "Today: Template" msgstr "Hoy: plantilla" @@ -1177,8 +1089,8 @@ msgid "Pierre-Yves Luyten" msgstr "Pierre-Yves Luyten" -#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:1 #: ../src/addins/specialnotes/specialnotesapplicationaddin.cpp:38 +#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:1 msgid "Special Notes" msgstr "Notas especiales" @@ -1397,15 +1309,15 @@ msgid "Exception thrown when creating note: %s" msgstr "Excepción al crear una nota: %s" -#: ../src/gnote.cpp:200 +#: ../src/gnote.cpp:185 msgid "Gnote is already running. Exiting..." msgstr "Gnote todavía está en ejecución. Saliendo..." -#: ../src/gnote.cpp:365 +#: ../src/gnote.cpp:289 msgid "and Tomboy original authors." msgstr "y los autores originales de Tomboy." -#: ../src/gnote.cpp:371 +#: ../src/gnote.cpp:295 msgid "translator-credits" msgstr "" "Miguel Rodríguez , 2013\n" @@ -1413,93 +1325,93 @@ "Jorge González , 2007-2008\n" "QA: Jorge González , 2009-2010" -#: ../src/gnote.cpp:380 +#: ../src/gnote.cpp:304 msgid "" -"Copyright © 2010-2014 Aurimas Cernius\n" +"Copyright © 2010-2015 Aurimas Cernius\n" "Copyright © 2009-2011 Debarshi Ray\n" "Copyright © 2009 Hubert Figuiere\n" "Copyright © 2004-2009 the Tomboy original authors." msgstr "" -"Copyright © 2010-2014 Aurimas Cernius\n" +"Copyright © 2010-2015 Aurimas Cernius\n" "Copyright © 2009-2011 Debarshi Ray\n" "Copyright © 2009 Hubert Figuiere\n" "Copyright © 2004-2009 los autores originales de Tomboy." -#: ../src/gnote.cpp:384 +#: ../src/gnote.cpp:308 msgid "A simple and easy to use desktop note-taking application." msgstr "" "Una aplicación simple y fácil de usar para tomar notas en el escritorio." -#: ../src/gnote.cpp:395 +#: ../src/gnote.cpp:319 msgid "Homepage" msgstr "Página web" -#: ../src/gnote.cpp:570 +#: ../src/gnote.cpp:494 msgid "Run Gnote in background." msgstr "Ejecutar Gnote en segundo plano." -#: ../src/gnote.cpp:571 +#: ../src/gnote.cpp:495 msgid "Run Gnote as GNOME Shell search provider." msgstr "Ejecutar Gnote con el buscador de GNOME Shell." -#: ../src/gnote.cpp:572 +#: ../src/gnote.cpp:496 msgid "Specify the path of the directory containing the notes." msgstr "Especificar la ruta de la carpeta que contiene las notas." -#: ../src/gnote.cpp:572 +#: ../src/gnote.cpp:496 msgid "path" msgstr "ruta" -#: ../src/gnote.cpp:573 +#: ../src/gnote.cpp:497 msgid "Open the search all notes window with the search text." msgstr "" "Abrir la ventana de búsqueda en todas las notas con el texto de búsqueda." -#: ../src/gnote.cpp:573 ../src/gnote.cpp:578 +#: ../src/gnote.cpp:497 ../src/gnote.cpp:502 msgid "text" msgstr "texto" -#: ../src/gnote.cpp:574 +#: ../src/gnote.cpp:498 msgid "Print version information." msgstr "Imprimir la información de la versión." -#: ../src/gnote.cpp:575 +#: ../src/gnote.cpp:499 msgid "Create and display a new note, with a optional title." msgstr "Crear y mostrar una nota nueva, con un título opcional" -#: ../src/gnote.cpp:575 +#: ../src/gnote.cpp:499 msgid "title" msgstr "título" -#: ../src/gnote.cpp:576 +#: ../src/gnote.cpp:500 msgid "Display the existing note matching title." msgstr "Mostrar el título de la nota correspondiente." -#: ../src/gnote.cpp:576 +#: ../src/gnote.cpp:500 msgid "title/url" msgstr "título/url" -#: ../src/gnote.cpp:577 +#: ../src/gnote.cpp:501 msgid "Display the 'Start Here' note." msgstr "Mostrar la nota «Comenzar aquí»." -#: ../src/gnote.cpp:578 +#: ../src/gnote.cpp:502 msgid "Search and highlight text in the opened note." msgstr "Mostrar y resaltar texto en la nota abierta." -#: ../src/gnote.cpp:582 +#: ../src/gnote.cpp:506 msgid "A note taking application" msgstr "Una aplicación para tomar notas" -#: ../src/gnote.cpp:582 +#: ../src/gnote.cpp:506 msgid "Gnote options at launch" msgstr "Opciones de Gnote al iniciar" -#: ../src/gnote.cpp:659 +#: ../src/gnote.cpp:583 msgid "Could not connect to remote instance." msgstr "No se pudo conectar con una instancia remota." -#: ../src/gnote.cpp:775 +#: ../src/gnote.cpp:699 msgid "Version %1%" msgstr "Versión %1%" @@ -1517,6 +1429,23 @@ msgid "Window is not embedded" msgstr "La ventana no está empotrada" +#. Probably IOException or UnauthorizedAccessException? +#: ../src/notebase.cpp:200 ../src/note.cpp:382 +#, c-format +msgid "Exception while saving note: %s" +msgstr "Se produjo un error al guardar la nota: %s" + +#. write failure, but not critical +#: ../src/notebase.cpp:444 +#, c-format +msgid "Failed to update note format: %s" +msgstr "Falló al actualizar el formato de la nota: %s" + +#: ../src/notebase.cpp:568 +#, c-format +msgid "Filesystem error: %s" +msgstr "Error del sistema de archivos: %s" + #: ../src/notebooks/createnotebookdialog.cpp:41 msgid "Create Notebook" msgstr "Crear un cuaderno de notas" @@ -1649,12 +1578,6 @@ "espacio libre en el disco y que tiene los permisos adecuados sobre ~/.local/" "share/gnote. Los detalles del error se pueden encontrar en ~/.gnote.log." -#. Probably IOException or UnauthorizedAccessException? -#: ../src/note.cpp:382 ../src/notebase.cpp:200 -#, c-format -msgid "Exception while saving note: %s" -msgstr "Se produjo un error al guardar la nota: %s" - #: ../src/note.cpp:474 #, c-format msgid "Error while saving: %s" @@ -1664,16 +1587,13 @@ msgid "Setting text content for closed notes not supported" msgstr "No se permite la configuración del texto de una nota cerrada." -#. write failure, but not critical -#: ../src/notebase.cpp:444 -#, c-format -msgid "Failed to update note format: %s" -msgstr "Falló al actualizar el formato de la nota: %s" +#: ../src/notemanagerbase.cpp:105 ../src/preferencesdialog.cpp:320 +msgid "New Note Template" +msgstr "Plantilla de nota nueva" -#: ../src/notebase.cpp:568 -#, c-format -msgid "Filesystem error: %s" -msgstr "Error del sistema de archivos: %s" +#: ../src/notemanagerbase.cpp:359 +msgid "Describe your new note here." +msgstr "Describa aquí su nota nueva." #: ../src/notemanager.cpp:133 msgid "" @@ -1765,14 +1685,6 @@ msgid "Error parsing note XML, skipping \"%s\": %s" msgstr "Error al analizar la nota XML, se omite «%s»: %s" -#: ../src/notemanagerbase.cpp:105 ../src/preferencesdialog.cpp:332 -msgid "New Note Template" -msgstr "Plantilla de nota nueva" - -#: ../src/notemanagerbase.cpp:359 -msgid "Describe your new note here." -msgstr "Describa aquí su nota nueva." - #: ../src/noterenamedialog.cpp:123 msgid "Rename Note Links?" msgstr "¿Renombrar enlaces de la nota?" @@ -1883,47 +1795,47 @@ msgid "Save _Title" msgstr "Guardar _título" -#: ../src/notewindow.cpp:562 ../src/notewindow.cpp:1084 +#: ../src/notewindow.cpp:562 ../src/notewindow.cpp:1085 msgid "Cannot create note" msgstr "No se puede crear la nota" -#: ../src/notewindow.cpp:827 +#: ../src/notewindow.cpp:828 msgid "_Link" msgstr "_Enlace" -#: ../src/notewindow.cpp:828 +#: ../src/notewindow.cpp:829 msgid "_Bold" msgstr "_Negrita" -#: ../src/notewindow.cpp:829 +#: ../src/notewindow.cpp:830 msgid "_Italic" msgstr "_Cursiva" -#: ../src/notewindow.cpp:830 +#: ../src/notewindow.cpp:831 msgid "_Strikeout" msgstr "_Tachado" -#: ../src/notewindow.cpp:832 +#: ../src/notewindow.cpp:833 msgid "_Highlight" msgstr "_Resaltado" -#: ../src/notewindow.cpp:834 +#: ../src/notewindow.cpp:835 msgid "_Normal" msgstr "_Normal" -#: ../src/notewindow.cpp:836 +#: ../src/notewindow.cpp:837 msgid "Hu_ge" msgstr "_Enorme" -#: ../src/notewindow.cpp:838 +#: ../src/notewindow.cpp:839 msgid "_Large" msgstr "_Grande" -#: ../src/notewindow.cpp:840 +#: ../src/notewindow.cpp:841 msgid "S_mall" msgstr "_Pequeña" -#: ../src/notewindow.cpp:842 +#: ../src/notewindow.cpp:843 msgid "Bullets" msgstr "Topos" @@ -1935,44 +1847,30 @@ msgid "Links" msgstr "Enlaces" -#: ../src/preferencesdialog.cpp:125 -msgid "Hotkeys" -msgstr "Teclas rápidas" - #. TRANSLATORS: Addin category. -#: ../src/preferencesdialog.cpp:129 ../src/sharp/addinstreemodel.cpp:164 +#: ../src/preferencesdialog.cpp:125 ../src/sharp/addinstreemodel.cpp:164 msgid "Synchronization" msgstr "Sincronización" -#: ../src/preferencesdialog.cpp:131 +#: ../src/preferencesdialog.cpp:127 msgid "Plugins" msgstr "Complementos" -#: ../src/preferencesdialog.cpp:208 +#: ../src/preferencesdialog.cpp:204 #, c-format msgid "Plugin %s is absent" msgstr "Falta el complemento %s" -#. Status icon -#: ../src/preferencesdialog.cpp:247 -msgid "Use status _icon" -msgstr "Usar _icono de estado" - -#: ../src/preferencesdialog.cpp:248 -msgid "Show icon in tray, which is the central place of control." -msgstr "" -"Muestra el icono en la bandeja, que es donde se ubica el control central." - #. Open in new window -#: ../src/preferencesdialog.cpp:255 +#: ../src/preferencesdialog.cpp:243 msgid "Always _open notes in new window" msgstr "_Abrir siempre las notas en una nueva ventana" -#: ../src/preferencesdialog.cpp:268 +#: ../src/preferencesdialog.cpp:256 msgid "_Spell check while typing" msgstr "_Corrección ortográfica al escribir" -#: ../src/preferencesdialog.cpp:269 +#: ../src/preferencesdialog.cpp:257 msgid "" "Misspellings will be underlined in red, with correct spelling suggestions " "shown in the context menu." @@ -1981,37 +1879,37 @@ "las sugerencias de corrección en el menú contextual." #. Auto bulleted list -#: ../src/preferencesdialog.cpp:279 +#: ../src/preferencesdialog.cpp:267 msgid "Enable auto-_bulleted lists" msgstr "Activar listas de _topos automáticos" -#: ../src/preferencesdialog.cpp:280 +#: ../src/preferencesdialog.cpp:268 msgid "Start new bulleted list by starting new line with character \"-\"." msgstr "" "Comienzo de una nueva lista de topos, que comienza por una nueva línea con " "el carácter «-»." -#: ../src/preferencesdialog.cpp:289 +#: ../src/preferencesdialog.cpp:277 msgid "Use custom _font" msgstr "Usar _tipografía personalizada" -#: ../src/preferencesdialog.cpp:307 +#: ../src/preferencesdialog.cpp:295 msgid "When renaming a linked note: " msgstr "Al renombrar una nota enlazada: " -#: ../src/preferencesdialog.cpp:311 +#: ../src/preferencesdialog.cpp:299 msgid "Ask me what to do" msgstr "Preguntarme qué hacer" -#: ../src/preferencesdialog.cpp:312 +#: ../src/preferencesdialog.cpp:300 msgid "Never rename links" msgstr "No renombrar nunca los enlaces" -#: ../src/preferencesdialog.cpp:313 +#: ../src/preferencesdialog.cpp:301 msgid "Always rename links" msgstr "Siempre renombrar enlaces" -#: ../src/preferencesdialog.cpp:333 +#: ../src/preferencesdialog.cpp:321 msgid "" "Use the new note template to specify the text that should be used when " "creating a new note." @@ -2019,40 +1917,40 @@ "Use la plantilla de la nota nueva para especificar el texto que se debe usar " "al crear una nota nueva." -#: ../src/preferencesdialog.cpp:338 +#: ../src/preferencesdialog.cpp:326 msgid "Open New Note Template" msgstr "Abrir la plantilla Nota nueva" #. internal links -#: ../src/preferencesdialog.cpp:395 +#: ../src/preferencesdialog.cpp:383 msgid "_Automatically link to notes" msgstr "Enlaza _automáticamente las notas" -#: ../src/preferencesdialog.cpp:396 +#: ../src/preferencesdialog.cpp:384 msgid "Enable this option to create a link when text matches note title." msgstr "" "Active esta opción para crear un enlace cuando el texto coincide con el " "título de la nota." #. URLs -#: ../src/preferencesdialog.cpp:402 +#: ../src/preferencesdialog.cpp:390 msgid "Create links for _URLs" msgstr "Crea enlaces para _URL" -#: ../src/preferencesdialog.cpp:403 +#: ../src/preferencesdialog.cpp:391 msgid "" "Enable this option to create links for URLs. Clicking will open URL with " -"apropriate program." +"appropriate program." msgstr "" "Active esta opción para crear enlaces para los URL. Al pulsar en el enlace " "se abrirá el URL con su correspondiente programa." #. WikiWords... -#: ../src/preferencesdialog.cpp:410 +#: ../src/preferencesdialog.cpp:398 msgid "Highlight _WikiWords" msgstr "Resaltar _wikipalabras" -#: ../src/preferencesdialog.cpp:411 +#: ../src/preferencesdialog.cpp:399 msgid "" "Enable this option to highlight words ThatLookLikeThis. Clicking the " "word will create a note with that name." @@ -2060,90 +1958,55 @@ "Active esta opción para resaltar palabras QueSeVenAsí. Al pulsar en " "la palabra se creará una nota con ese nombre." -#. Hotkeys... -#: ../src/preferencesdialog.cpp:441 -msgid "Listen for _hotkeys" -msgstr "Escuchar las _teclas rápidas" - -#: ../src/preferencesdialog.cpp:442 -msgid "" -"Hotkeys allow you to quickly access your notes from anywhere with a " -"keypress. Example Hotkeys: <Control><Shift>F11, <" -"Alt>N" -msgstr "" -"Las teclas rápidas le permiten acceder rápidamente a sus notas desde " -"cualquier parte con una pulsación de tecla. Ejemplo de teclas rápidas: " -"<Control><Mayús>F11, <Alt>N" - -#. Show notes menu keybinding... -#: ../src/preferencesdialog.cpp:464 -msgid "Show notes _menu" -msgstr "Mostrar el _menú de notas" - -#. Open Start Here keybinding... -#: ../src/preferencesdialog.cpp:481 -msgid "Open \"_Start Here\"" -msgstr "Abrir «Co_menzar aquí»" - -#. Create new note keybinding... -#: ../src/preferencesdialog.cpp:497 -msgid "Create _new note" -msgstr "Crear una nota _nueva" - -#. Open Search window keybinding... -#: ../src/preferencesdialog.cpp:513 -msgid "Open Search _Window" -msgstr "Abrir ventana de _búsqueda" - -#: ../src/preferencesdialog.cpp:553 +#: ../src/preferencesdialog.cpp:431 msgid "Ser_vice:" msgstr "Ser_vicio:" -#: ../src/preferencesdialog.cpp:609 ../src/preferencesdialog.cpp:1239 +#: ../src/preferencesdialog.cpp:487 ../src/preferencesdialog.cpp:1117 msgid "Not configurable" msgstr "No configurable" -#: ../src/preferencesdialog.cpp:636 +#: ../src/preferencesdialog.cpp:514 msgid "Automatical background s_ync interval (minutes)" msgstr "S_incronización automática en segundo plano cada (minutos)" #. "Advanced..." button to bring up extra sync config dialog -#: ../src/preferencesdialog.cpp:660 +#: ../src/preferencesdialog.cpp:538 msgid "_Advanced..." msgstr "_Avanzado…" -#: ../src/preferencesdialog.cpp:707 +#: ../src/preferencesdialog.cpp:585 msgid "The following plugins are installed:" msgstr "Los siguientes complementos están instalados:" #. TODO: In a future version, add in an "Install Add-ins..." button #. TODO: In a future version, add in a "Repositories..." button -#: ../src/preferencesdialog.cpp:742 +#: ../src/preferencesdialog.cpp:620 msgid "_Enable" msgstr "_Activar" -#: ../src/preferencesdialog.cpp:748 +#: ../src/preferencesdialog.cpp:626 msgid "_Disable" msgstr "_Desactivar" -#: ../src/preferencesdialog.cpp:906 +#: ../src/preferencesdialog.cpp:784 msgid "Not Implemented" msgstr "No implementado" -#: ../src/preferencesdialog.cpp:922 +#: ../src/preferencesdialog.cpp:800 msgid "%1% Preferences" msgstr "%1% Preferencias" -#: ../src/preferencesdialog.cpp:1057 +#: ../src/preferencesdialog.cpp:935 msgid "Choose Note Font" msgstr "Elegir la tipografía de la nota" #. Create dialog -#: ../src/preferencesdialog.cpp:1155 +#: ../src/preferencesdialog.cpp:1033 msgid "Other Synchronization Options" msgstr "Otras opciones de sincronización" -#: ../src/preferencesdialog.cpp:1158 +#: ../src/preferencesdialog.cpp:1036 msgid "" "When a conflict is detected between a local note and a note on the " "configured synchronization server:" @@ -2152,23 +2015,23 @@ "servidor de sincronización configurado:" #. label.Xalign = 0; -#: ../src/preferencesdialog.cpp:1162 +#: ../src/preferencesdialog.cpp:1040 msgid "Always ask me what to do" msgstr "Preguntarme siempre qué hacer" -#: ../src/preferencesdialog.cpp:1166 +#: ../src/preferencesdialog.cpp:1044 msgid "Rename my local note" msgstr "Renombrar mi nota local" -#: ../src/preferencesdialog.cpp:1170 +#: ../src/preferencesdialog.cpp:1048 msgid "Replace my local note with the server's update" msgstr "Reemplazar mi nota local con la actualización del servidor" -#: ../src/preferencesdialog.cpp:1272 +#: ../src/preferencesdialog.cpp:1150 msgid "Are you sure?" msgstr "¿Está seguro?" -#: ../src/preferencesdialog.cpp:1273 +#: ../src/preferencesdialog.cpp:1151 msgid "" "Clearing your synchronization settings is not recommended. You may be " "forced to synchronize all of your notes again when you save new settings." @@ -2176,11 +2039,11 @@ "No se recomienda limpiar sus ajustes de sincronización. Quizá se vea forzado " "a sincronizar todas sus notas de nuevo cuando guarde los nuevos ajustes." -#: ../src/preferencesdialog.cpp:1283 +#: ../src/preferencesdialog.cpp:1161 msgid "Resetting Synchronization Settings" msgstr "Reiniciando los ajustes de sincronización" -#: ../src/preferencesdialog.cpp:1284 +#: ../src/preferencesdialog.cpp:1162 msgid "" "You have disabled the configured synchronization service. Your " "synchronization settings will now be cleared. You may be forced to " @@ -2190,11 +2053,11 @@ "sincronización se limpiarán. Quizá se vea forzado a sincronizar todas sus " "notas de nuevo cuando guarde los ajustes nuevos." -#: ../src/preferencesdialog.cpp:1350 +#: ../src/preferencesdialog.cpp:1228 msgid "Connection successful" msgstr "Conectado correctamente" -#: ../src/preferencesdialog.cpp:1351 +#: ../src/preferencesdialog.cpp:1229 msgid "" "Gnote is ready to synchronize your notes. Would you like to synchronize them " "now?" @@ -2202,7 +2065,7 @@ "Gnote está preparado para sincronizar sus notas. ¿Quiere sincronizarlas " "ahora?" -#: ../src/preferencesdialog.cpp:1375 +#: ../src/preferencesdialog.cpp:1253 msgid "" "Please check your information and try again. The log file %1% may contain " "more information about the error." @@ -2210,19 +2073,19 @@ "Compruebe su información e inténtelo de nuevo. El archivo de registro %1% " "puede contener más información sobre el error." -#: ../src/preferencesdialog.cpp:1380 +#: ../src/preferencesdialog.cpp:1258 msgid "Error connecting" msgstr "Error al conectar" -#: ../src/preferencesdialog.cpp:1443 +#: ../src/preferencesdialog.cpp:1321 msgid "Version:" msgstr "Versión:" -#: ../src/preferencesdialog.cpp:1446 +#: ../src/preferencesdialog.cpp:1324 msgid "Author:" msgstr "Autor:" -#: ../src/preferencesdialog.cpp:1451 +#: ../src/preferencesdialog.cpp:1329 msgid "Copyright:" msgstr "Copyright:" @@ -2438,8 +2301,8 @@ msgstr "No se pudo activar FUSE." #: ../src/synchronization/fusesyncserviceaddin.cpp:246 -msgid "An error ocurred while connecting to the specified server" -msgstr "Ocurrió un error al conectar con el servidor especificado" +msgid "An error occurred while connecting to the specified server" +msgstr "Ocurrió un error al conectar al servidor especificado" #. TRANSLATORS: %s is file #: ../src/synchronization/gnotesyncclient.cpp:165 @@ -2714,18 +2577,6 @@ "al inicio. Añada «modprobe fuse» a /etc/init.d/boot.local o «fuse» a /etc/" "modules." -#: ../src/tray.cpp:54 -msgid "Take notes" -msgstr "Tomar notas" - -#: ../src/tray.cpp:167 -msgid " (new)" -msgstr " (nueva)" - -#: ../src/tray.cpp:458 -msgid "_About Gnote" -msgstr "Acerca _de Gnote" - #: ../src/utils.cpp:144 msgid "" "The \"Gnote Manual\" could not be found. Please verify that your " @@ -2820,6 +2671,134 @@ msgid "_Open Link" msgstr "_Abrir enlace" +#~ msgid "" +#~ "Has affect only when started as an application. When set to TRUE, shows a " +#~ "status icon. If set to FALSE, Search All Notes window is used as main " +#~ "application window, closing which makes application to exit." +#~ msgstr "" +#~ "Sólo tiene efecto cuando se inicia como aplicación. Cuando es cierto, " +#~ "muestra un icono de estado. Si es falso, la ventana «Buscar en todas las " +#~ "notas» se usa como ventana principal de la aplicación, cerrando la que " +#~ "hace que la aplicación termine." + +#~ msgid "" +#~ "The global keybinding for showing the Gnote applet's menu. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Combinación de teclas global para mostrar el menú de miniaplicaciones de " +#~ "Gnote. El formato sería \\\"<Control>a\\\" o \\\"<Mayús><" +#~ "Alt>F1. El analizador léxico es bastante tolerante y permite letras " +#~ "mayúsculas o minúsculas, y abreviaciones tales como \\\"<Ctl>\\\" y " +#~ "\\\"<Ctrl>\\\". Si activa la opción de cadena especial \\\"disabled" +#~ "\\\" (desactivada) no habrá combinación de teclas para esta acción." + +#~ msgid "" +#~ "The global keybinding for opening the \"Start Here\" note. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Combinación de teclas global para abrir «Comenzar aquí». El formato sería " +#~ "«<Control>a» o «<Shift><Alt>F1». El analizador léxico " +#~ "es bastante tolerante y permite letras mayúsculas o minúsculas, y " +#~ "abreviaciones tales como «<Ctl>» y «<Ctrl>». Si activa la " +#~ "opción de cadena especial «desactivada» no habrá combinación de teclas " +#~ "para esta acción." + +#~ msgid "" +#~ "The global keybinding for creating and displaying a new Note. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Combinación de teclas global para crear y mostrar una nota nueva. El " +#~ "formato sería «<Control>a» o «<Shift><Alt>F1». El " +#~ "analizador léxico es bastante tolerante y permite letras mayúsculas o " +#~ "minúsculas, y abreviaciones tales como «<Ctl>» y «<Ctrl>». Si " +#~ "activa la opción de cadena especial «desactivada» no habrá combinación de " +#~ "teclas para esta acción." + +#~ msgid "" +#~ "The global keybinding for opening the Note Search dialog. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Combinación de teclas global para abrir el diálogo de buscar notas. El " +#~ "formato sería «<Control>a» o «<Shift><Alt>F1». El " +#~ "analizador léxico es bastante tolerante y permite letras mayúsculas o " +#~ "minúsculas, y abreviaciones tales como «<Ctl>» y «<Ctrl>». Si " +#~ "activa la opción de cadena especial «desactivada» no habrá combinación de " +#~ "teclas para esta acción." + +#~ msgid "" +#~ "The global keybinding for opening the Recent Changes dialog. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Combinación de teclas global para abrir el diálogo de cambios recientes. " +#~ "El formato sería «<Control>a» o «<Shift><Alt>F1». El " +#~ "analizador léxico es bastante tolerante y permite letras mayúsculas o " +#~ "minúsculas, y abreviaciones tales como «<Ctl>» y «<Ctrl>». Si " +#~ "activa la opción de cadena especial «desactivada» no habrá combinación de " +#~ "teclas para esta acción." + +#~ msgid "Hotkeys" +#~ msgstr "Teclas rápidas" + +#~ msgid "Use status _icon" +#~ msgstr "Usar _icono de estado" + +#~ msgid "Show icon in tray, which is the central place of control." +#~ msgstr "" +#~ "Muestra el icono en la bandeja, que es donde se ubica el control central." + +#~ msgid "Listen for _hotkeys" +#~ msgstr "Escuchar las _teclas rápidas" + +#~ msgid "" +#~ "Hotkeys allow you to quickly access your notes from anywhere with a " +#~ "keypress. Example Hotkeys: <Control><Shift>F11, <" +#~ "Alt>N" +#~ msgstr "" +#~ "Las teclas rápidas le permiten acceder rápidamente a sus notas desde " +#~ "cualquier parte con una pulsación de tecla. Ejemplo de teclas rápidas: " +#~ "<Control><Mayús>F11, <Alt>N" + +#~ msgid "Show notes _menu" +#~ msgstr "Mostrar el _menú de notas" + +#~ msgid "Open \"_Start Here\"" +#~ msgstr "Abrir «Co_menzar aquí»" + +#~ msgid "Create _new note" +#~ msgstr "Crear una nota _nueva" + +#~ msgid "Open Search _Window" +#~ msgstr "Abrir ventana de _búsqueda" + +#~ msgid "Take notes" +#~ msgstr "Tomar notas" + +#~ msgid " (new)" +#~ msgstr " (nueva)" + +#~ msgid "_About Gnote" +#~ msgstr "Acerca _de Gnote" + #~ msgid "Open \"Search _All Notes\"" #~ msgstr "Abrir «Buscar en _todas las notas»" diff -Nru gnote-3.14.2/po/eu.po gnote-3.16.0/po/eu.po --- gnote-3.14.2/po/eu.po 2014-08-05 20:26:03.000000000 +0000 +++ gnote-3.16.0/po/eu.po 2015-03-07 18:13:28.000000000 +0000 @@ -1,13 +1,17 @@ +# Basque translation for gnote # Copyright (C) YEAR THE PACKAGE'S COPYRIGHT HOLDER # This file is distributed under the same license as the PACKAGE package. # -# Iñaki Larrañaga Murgoitio , 2014. +# Iñaki Larrañaga Murgoitio , 2014, 2015. +# Edurne Labaka , 2015. +# msgid "" msgstr "" -"Project-Id-Version: \n" -"Report-Msgid-Bugs-To: \n" -"POT-Creation-Date: 2014-07-15 14:00+0200\n" -"PO-Revision-Date: 2014-07-15 14:08+0200\n" +"Project-Id-Version: gnote master\n" +"Report-Msgid-Bugs-To: http://bugzilla.gnome.org/enter_bug.cgi?" +"product=gnote&keywords=I18N+L10N&component=general\n" +"POT-Creation-Date: 2015-02-07 17:11+0100\n" +"PO-Revision-Date: 2015-02-07 17:11+0100\n" "Last-Translator: Iñaki Larrañaga Murgoitio \n" "Language-Team: Basque \n" "Language: eu\n" @@ -174,14 +178,14 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:21 msgid "Minimum number of notes to show in menu" -msgstr "Gutxiengo ohar-kopurua menuan erakusteko" +msgstr "Gutxieneko ohar kopurua menuan erakusteko" #: ../data/org.gnome.gnote.gschema.xml.in.h:22 msgid "" "Integer determining the minimum number of notes to show in the Gnote note " "menu." msgstr "" -"Gutxiengo ohar-kopurua zehazten duen osokoa, Gnote-ko oharren menuan " +"Gutxieneko ohar kopurua zehazten duen osokoa, Gnote-ko oharren menuan " "bistaratzeko." #: ../data/org.gnome.gnote.gschema.xml.in.h:23 @@ -193,7 +197,7 @@ "Whitespace-separated list of note URIs for notes that should always appear " "in the Gnote note menu." msgstr "" -"Oharren URIak zuriunez bereiztutako zerrenda, oharrak Gnote-ren oharren " +"Oharren URIak zuriunez bereizitako zerrenda, oharrak Gnote-ren oharren " "menuan beti egoteko." #: ../data/org.gnome.gnote.gschema.xml.in.h:25 @@ -293,7 +297,7 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:45 msgid "Link Updating Behavior on Note Rename" -msgstr "Esteken eguneraketen portaera oharra izenez aldatzean" +msgstr "Esteken eguneratzeen portaera oharra izenez aldatzean" #: ../data/org.gnome.gnote.gschema.xml.in.h:46 msgid "" @@ -305,7 +309,7 @@ "indicates that link text should be updated to the new note name so that it " "will continue linking to the renamed note." msgstr "" -"Ohar bat izenez aldatzean esteka zehatz baten eguneraketa egitean beti " +"Ohar bat izenez aldatzean esteka zehatz baten eguneratzea egitean beti " "portaera jakin bat lantzeko ezarpenik dagoen adierazten du osoko balioak, " "erabiltzaileari galdetu ordez. Balioak barneko zenbaketa jarraitzen du: 0 " "balioak ohar baten izena aldatzean beste oharretako estekei eragingo dien " @@ -327,15 +331,8 @@ msgstr "Erabili egoera-ikonoa, aplikazio gisa abiaraztean" #: ../data/org.gnome.gnote.gschema.xml.in.h:50 -msgid "" -"Has affect only when started as an application. When set to TRUE, shows a " -"status icon. If set to FALSE, Search All Notes window is used as main " -"application window, closing which makes application to exit." -msgstr "" -"Aplikazio bat bezala abiaraztean eragiten du soilik. TRUE (egia) gisa " -"ezartzen bada, egoeraren ikonoa erakusten du. FALSE (faltsua) gisa " -"ezartzean, 'Ohar guztiak' leihoa erabiliko da leiho nagusi gisa, eta leiho " -"hori ixteak aplikaziotik irtetea eragingo du." +msgid "Deprecated, has no effect." +msgstr "Zaharkitua, ez du eraginik sortzen." #: ../data/org.gnome.gnote.gschema.xml.in.h:51 msgid "Open notes in new window" @@ -351,8 +348,8 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:53 msgid "Save note window size and autosize note window to it" msgstr "" -"Gorde oharraren leihoaren tamaina eta aldatu oharren leihoa tamaina horretara " -"automatikoki" +"Gorde oharraren leihoaren tamaina eta aldatu oharren leihoa tamaina " +"horretara automatikoki" #: ../data/org.gnome.gnote.gschema.xml.in.h:54 msgid "" @@ -360,137 +357,56 @@ "when note is opened." msgstr "" "Gorde oharraren leihoaren tamaina eta aldatu leiho nagusia tamaina horretara " -"automatikoki " -"ohar bat irekitzean." +"automatikoki ohar bat irekitzean." #: ../data/org.gnome.gnote.gschema.xml.in.h:55 msgid "Show applet menu" msgstr "Erakutsi miniaplikazioen menua" #: ../data/org.gnome.gnote.gschema.xml.in.h:56 -msgid "" -"The global keybinding for showing the Gnote applet's menu. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such " -"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " -"special string \"disabled\", then there will be no keybinding for this " -"action." -msgstr "" -"Laster-tekla orokorra Gnote miniaplikazioaren menua erakusteko. Formatuak " -"honelako itxura du '<Control>a' edo '<Shift><Alt>F1'. " -"Analizatzailea nahiko eskuzabala da, letra maiuskulak eta minuskulak " -"erabiltzen uzten du, eta baita '<Ctl>' edo '<Ctrl>' bezalako " -"laburdurak ere. Aukera 'desgaituta' bezala zehazten baduzu, ez da ekintzaren " -"laster-teklarik egongo." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:57 msgid "Open Start Here" msgstr "Ireki 'Hasi hemen'" -#: ../data/org.gnome.gnote.gschema.xml.in.h:58 -msgid "" -"The global keybinding for opening the \"Start Here\" note. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such " -"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " -"special string \"disabled\", then there will be no keybinding for this " -"action." -msgstr "" -"Laster-tekla orokorra 'Hasi hemen' oharra irekitzeko. Formatuak honelako " -"itxura du '<Control>a' edo '<Shift><Alt>F1'. " -"Analizatzailea nahiko eskuzabala da, letra maiuskulak eta minuskulak " -"erabiltzen uzten du, eta baita '<Ctl>' edo '<Ctrl>' bezalako " -"laburdurak ere. Aukera 'desgaituta' bezala zehazten baduzu, ez da ekintzaren " -"laster-teklarik egongo." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:59 +#: ../data/org.gnome.gnote.gschema.xml.in.h:57 msgid "Create a new Note" msgstr "Sortu ohar berria" -#: ../data/org.gnome.gnote.gschema.xml.in.h:60 -msgid "" -"The global keybinding for creating and displaying a new Note. The format " -"looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " -"parser is fairly liberal and allows lower or upper case, and also " -"abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the " -"option to the special string \"disabled\", then there will be no keybinding " -"for this action." -msgstr "" -"Laster-tekla orokorra ohar berria sortzeko eta bistaratzeko. Formatuak " -"honelako itxura du '<Kontrol>a' edo '<Shift><Alt>F1'. " -"Analizatzailea nahiko eskuzabala da, letra maiuskulak eta minuskulak " -"erabiltzen uzten du, eta baita '<Ctl>' edo '<Ctrl>' bezalako " -"laburdurak ere. Aukera 'desgaituta' bezala zehazten baduzu, ez da ekintzaren " -"laster-teklarik egongo." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:61 +#: ../data/org.gnome.gnote.gschema.xml.in.h:58 msgid "Open Search Dialog" msgstr "Ireki bilaketa-leihoa" -#: ../data/org.gnome.gnote.gschema.xml.in.h:62 -msgid "" -"The global keybinding for opening the Note Search dialog. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such " -"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " -"special string \"disabled\", then there will be no keybinding for this " -"action." -msgstr "" -"Laster-tekla orokorra 'Ohar-bilaketa' leihoa irekitzeko. Formatuak honelako " -"itxura du '<Control>a' edo '<Shift><Alt>F1'. " -"Analizatzailea nahiko eskuzabala da, letra maiuskulak eta minuskulak " -"erabiltzen uzten du, eta baita '<Ctl>' edo '<Ctrl>' bezalako " -"laburdurak ere. Aukera 'desgaituta' bezala zehazten baduzu, ez da ekintzaren " -"laster-teklarik egongo." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:63 +#: ../data/org.gnome.gnote.gschema.xml.in.h:59 msgid "Open Recent Changes" msgstr "Ireki azken aldaketak" -#: ../data/org.gnome.gnote.gschema.xml.in.h:64 -msgid "" -"The global keybinding for opening the Recent Changes dialog. The format " -"looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " -"parser is fairly liberal and allows lower or upper case, and also " -"abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the " -"option to the special string \"disabled\", then there will be no keybinding " -"for this action." -msgstr "" -"Laster-tekla orokorra 'Azken aldaketak' leihoa irekitzeko. Formatuak " -"honelako itxura du '<Control>a' edo '<Shift><Alt>F1'. " -"Analizatzailea nahiko eskuzabala da, letra maiuskulak eta minuskulak " -"erabiltzen uzten du, eta baita '<Ctl>' edo '<Ctrl>' bezalako " -"laburdurak ere. Aukera 'desgaituta' bezala zehazten baduzu, ez da ekintzaren " -"laster-teklarik egongo." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:65 +#: ../data/org.gnome.gnote.gschema.xml.in.h:60 msgid "HTML Export Last Directory" msgstr "HTML esportatu azken direktorioa" -#: ../data/org.gnome.gnote.gschema.xml.in.h:66 +#: ../data/org.gnome.gnote.gschema.xml.in.h:61 msgid "" "The last directory a note was exported to using the Export To HTML plugin." msgstr "" "Ohar bat esportatu zen azken direktorioa 'Esportatu HTMLra' plugina " "erabiltzen." -#: ../data/org.gnome.gnote.gschema.xml.in.h:67 +#: ../data/org.gnome.gnote.gschema.xml.in.h:62 msgid "HTML Export Linked Notes" msgstr "HTML esportatu estekatutako oharrak" -#: ../data/org.gnome.gnote.gschema.xml.in.h:68 +#: ../data/org.gnome.gnote.gschema.xml.in.h:63 msgid "" "The last setting for the 'Export linked notes' checkbox in the Export to " "HTML plugin." msgstr "" -"'Eportatu estekatutako oharrak'en kontro-laukiaren azken ezarpena 'Esportatu " -"HTMLra' pluginean." +"'Esportatu estekatutako oharrak'en kontrol-laukiaren azken ezarpena " +"'Esportatu HTMLra' pluginean." -#: ../data/org.gnome.gnote.gschema.xml.in.h:69 +#: ../data/org.gnome.gnote.gschema.xml.in.h:64 msgid "HTML Export All Linked Notes" msgstr "HTML esportatu estekatutako ohar guztiak" -#: ../data/org.gnome.gnote.gschema.xml.in.h:70 +#: ../data/org.gnome.gnote.gschema.xml.in.h:65 msgid "" "The last setting for the 'Include all other linked notes' checkbox in the " "Export to HTML plugin. This setting is used in conjunction with the 'HTML " @@ -503,23 +419,23 @@ "(errekurtsiboki aurkitutakoak) HTML esportatzean erabiliko diren edo ez " "zehazteko erabiltzen da." -#: ../data/org.gnome.gnote.gschema.xml.in.h:71 +#: ../data/org.gnome.gnote.gschema.xml.in.h:66 msgid "Synchronization Client ID" msgstr "Sinkronizazio-bezeroaren IDa" -#: ../data/org.gnome.gnote.gschema.xml.in.h:72 +#: ../data/org.gnome.gnote.gschema.xml.in.h:67 msgid "" "Unique identifier for this Gnote client, used when communicating with a " -"sychronization server." +"synchronization server." msgstr "" "Gnote bezero honen identifikatzaile esklusiboa, sinkronizazio-" "zerbitzariarekin komunikatzean erabiltzeko." -#: ../data/org.gnome.gnote.gschema.xml.in.h:73 +#: ../data/org.gnome.gnote.gschema.xml.in.h:68 msgid "Synchronization Local Server Path" msgstr "Sinkronizazio lokaleko zerbitzariaren bide-izena" -#: ../data/org.gnome.gnote.gschema.xml.in.h:74 +#: ../data/org.gnome.gnote.gschema.xml.in.h:69 msgid "" "Path to the synchronization server when using the filesystem synchronization " "service addin." @@ -527,11 +443,11 @@ "Sinkronizazio-zerbitzariaren bide-izena fitxategi-sistemako sinkronizazio-" "zerbitzuaren gehigarria erabiltzean." -#: ../data/org.gnome.gnote.gschema.xml.in.h:75 +#: ../data/org.gnome.gnote.gschema.xml.in.h:70 msgid "Selected Synchronization Service Addin" msgstr "Hautatutako sinkronizazio-zerbitzuaren gehigarria" -#: ../data/org.gnome.gnote.gschema.xml.in.h:76 +#: ../data/org.gnome.gnote.gschema.xml.in.h:71 msgid "" "Unique identifier for the currently configured note synchronization service " "addin." @@ -539,11 +455,11 @@ "Unean konfiguratutako oharren sinkronizazio-zerbitzu gehigarriaren " "identifikatzaile esklusiboa." -#: ../data/org.gnome.gnote.gschema.xml.in.h:77 +#: ../data/org.gnome.gnote.gschema.xml.in.h:72 msgid "Note Synchronization Conflict Saved Behavior" msgstr "Oharren sinkronizazio-gatazken portaera" -#: ../data/org.gnome.gnote.gschema.xml.in.h:78 +#: ../data/org.gnome.gnote.gschema.xml.in.h:73 msgid "" "Integer value indicating if there is a preference to always perform a " "specific behavior when a conflict is detected, instead of prompting the " @@ -557,11 +473,11 @@ "galdetzea adierazten du, horrela erabiltzailea arduratuko da gatazka " "bakoitzaren aurrean landu beharrekoarekin." -#: ../data/org.gnome.gnote.gschema.xml.in.h:79 +#: ../data/org.gnome.gnote.gschema.xml.in.h:74 msgid "Automatic Background Synchronization Timeout" msgstr "Atzeko planoko sinkronizazio automatikoaren denbora-muga" -#: ../data/org.gnome.gnote.gschema.xml.in.h:80 +#: ../data/org.gnome.gnote.gschema.xml.in.h:75 msgid "" "Integer value indicating how frequently to perform a background sync of your " "notes (when sync is configured). Any value less than 1 indicates that " @@ -573,11 +489,11 @@ "baliok sink. automatikoa desgaituta dagoela adierazten du. Onartzen den " "balio positiborik baxuena 5 da. Balioak minutuak adierazten ditu." -#: ../data/org.gnome.gnote.gschema.xml.in.h:81 +#: ../data/org.gnome.gnote.gschema.xml.in.h:76 msgid "Accept SSL Certificates" msgstr "Onartu SSL ziurtagiriak" -#: ../data/org.gnome.gnote.gschema.xml.in.h:82 +#: ../data/org.gnome.gnote.gschema.xml.in.h:77 msgid "" "Use wdfs option \"-ac\" to accept SSL certificates without prompting the " "user." @@ -585,27 +501,27 @@ "Erabili wdfs aukera \"-ac\" erabiltzaileari galdetu gabe SSL ziurtagiriak " "onartzeko." -#: ../data/org.gnome.gnote.gschema.xml.in.h:83 +#: ../data/org.gnome.gnote.gschema.xml.in.h:78 msgid "Share URL" msgstr "Partekatu URLa" -#: ../data/org.gnome.gnote.gschema.xml.in.h:84 +#: ../data/org.gnome.gnote.gschema.xml.in.h:79 msgid "WebDAV share URL where notes are synchronized to." msgstr "WebDAV-ek oharrak sinkronizatzen diren URLa partekatzen du." -#: ../data/org.gnome.gnote.gschema.xml.in.h:85 +#: ../data/org.gnome.gnote.gschema.xml.in.h:80 msgid "Share username" msgstr "Partekatu erabiltzaile-izena" -#: ../data/org.gnome.gnote.gschema.xml.in.h:86 +#: ../data/org.gnome.gnote.gschema.xml.in.h:81 msgid "Username to access WebDAV share." msgstr "Erabiltzaile-izena WebDAV partekatzea atzitzeko." -#: ../data/org.gnome.gnote.gschema.xml.in.h:87 +#: ../data/org.gnome.gnote.gschema.xml.in.h:82 msgid "Timestamp format" msgstr "Denbora-zigiluaren formatua" -#: ../data/org.gnome.gnote.gschema.xml.in.h:88 +#: ../data/org.gnome.gnote.gschema.xml.in.h:83 msgid "" "The date format that is used for the timestamp. It follows the format of " "strftime(3)." @@ -613,11 +529,11 @@ "Denbora-zigiluan erabiltzen den data-formatua. strftime(3) funtzioaren " "formatua jarraitzen du." -#: ../data/org.gnome.gnote.gschema.xml.in.h:89 +#: ../data/org.gnome.gnote.gschema.xml.in.h:84 msgid "Time between checks" -msgstr "Egiaztaketen arteko denbora" +msgstr "Egiaztapenen arteko denbora" -#: ../data/org.gnome.gnote.gschema.xml.in.h:90 +#: ../data/org.gnome.gnote.gschema.xml.in.h:85 msgid "" "Time interval between note directory checks (in seconds). Min value is 5." msgstr "" @@ -625,7 +541,6 @@ "balioa 5 da." #: ../src/actionmanager.cpp:84 ../src/actionmanager.cpp:171 -#: ../src/tray.cpp:465 msgid "_Quit" msgstr "I_rten" @@ -634,7 +549,6 @@ msgstr "Irten Gnote-tik" #: ../src/actionmanager.cpp:89 ../src/actionmanager.cpp:168 -#: ../src/tray.cpp:448 msgid "_Preferences" msgstr "_Hobespenak" @@ -662,19 +576,19 @@ msgid "TrayIcon" msgstr "Erretiluaren ikonoa" -#: ../src/actionmanager.cpp:107 ../src/tray.cpp:225 +#: ../src/actionmanager.cpp:107 msgid "Create _New Note" msgstr "_Sortu ohar berria" -#: ../src/actionmanager.cpp:107 ../src/tray.cpp:227 +#: ../src/actionmanager.cpp:107 msgid "Create a new note" msgstr "Sortu ohar berria" -#: ../src/actionmanager.cpp:112 ../src/tray.cpp:234 +#: ../src/actionmanager.cpp:112 msgid "_Search All Notes" msgstr "_Bilatu ohar guztiak" -#: ../src/actionmanager.cpp:112 ../src/tray.cpp:236 +#: ../src/actionmanager.cpp:112 msgid "Open the Search All Notes window" msgstr "Ireki 'Bilatu ohar guztiak' leihoa" @@ -686,7 +600,7 @@ msgid "New _Window" msgstr "Leiho _berria" -#: ../src/actionmanager.cpp:169 ../src/tray.cpp:453 +#: ../src/actionmanager.cpp:169 msgid "_Help" msgstr "_Laguntza" @@ -832,7 +746,7 @@ #: ../src/addins/bugzilla/bugzillapreferences.cpp:372 msgid "If you remove an icon it is permanently lost." -msgstr "Ikono bat ezabatzen baduzu betirako galduko da." +msgstr "Ikono bat ezabatzen baduzu betiko galduko da." #: ../src/addins/bugzilla/bugzillapreferences.cpp:394 #, c-format @@ -868,8 +782,8 @@ msgstr "Huts egin du GTG interfazea XMLtik sortzean: %s" #: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:100 -msgid "Failed to create D_Bus proxy for GTG" -msgstr "Huts egin du GTG-ren DBus proxya sortzean" +msgid "Failed to create D-Bus proxy for GTG" +msgstr "Huts egin du GTG-ren D-Bus proxya sortzean" #: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:116 #, c-format @@ -1005,7 +919,7 @@ #, c-format msgid "NoteDirectoryWatcher: Update aborted, error reading %s: %s" msgstr "" -"NoteDirectoryWatcher: eguneraketa abortatuta. Errorea '%s' irakurtzean: %s" +"NoteDirectoryWatcher: eguneratzea abortatuta. Errorea '%s' irakurtzean: %s" #. TRANSLATORS: %s is file #: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:263 @@ -1031,11 +945,7 @@ #, c-format msgid "NoteDirectoryWatcher: Update aborted, error parsing %s: %s" msgstr "" -"NoteDirectoryWatcher: eguneraketa abortatuta. Errorea '%s' aztertzean: %s" - -#: ../src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp:35 -msgid "_Directory check interval:" -msgstr "Direktorioa begiratzeko _bitartea:" +"NoteDirectoryWatcher: eguneratzea abortatuta. Errorea '%s' aztertzean: %s" #: ../src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in.in.h:1 msgid "Note Directory Watcher" @@ -1050,6 +960,10 @@ msgid "Aurimas Černius and Tomboy original authors" msgstr "Aurimas Černius eta Tomboy-ren jatorriko egileak" +#: ../src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp:35 +msgid "_Directory check interval:" +msgstr "Direktorioa begiratzeko _bitartea:" + #: ../src/addins/noteoftheday/noteoftheday.cpp:33 msgid "Today: Template" msgstr "Gaur: txantiloia" @@ -1160,8 +1074,8 @@ msgid "Pierre-Yves Luyten" msgstr "Pierre-Yves Luyten" -#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:1 #: ../src/addins/specialnotes/specialnotesapplicationaddin.cpp:38 +#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:1 msgid "Special Notes" msgstr "Ohar bereziak" @@ -1379,99 +1293,103 @@ msgid "Exception thrown when creating note: %s" msgstr "Salbuespena gertatu da oharra sortzean: %s" -#: ../src/gnote.cpp:198 +#: ../src/gnote.cpp:185 msgid "Gnote is already running. Exiting..." msgstr "Gnote jadanik exekutatzen ari da. Irteten..." -#: ../src/gnote.cpp:359 +#: ../src/gnote.cpp:289 msgid "and Tomboy original authors." msgstr "eta Tomboy-ren jatorriko egileak." -#: ../src/gnote.cpp:365 +#: ../src/gnote.cpp:295 msgid "translator-credits" msgstr "Iñaki Larrañaga Murgoitio " -#: ../src/gnote.cpp:374 +#: ../src/gnote.cpp:304 msgid "" -"Copyright © 2010-2014 Aurimas Cernius\n" +"Copyright © 2010-2015 Aurimas Cernius\n" "Copyright © 2009-2011 Debarshi Ray\n" "Copyright © 2009 Hubert Figuiere\n" "Copyright © 2004-2009 the Tomboy original authors." msgstr "" -"Copyright-a © 2010-2014 Aurimas Cernius\n" -"Copyright-a © 2009-2011 Debarshi Ray\n" -"Copyright-a © 2009 Hubert Figuiere\n" +"Copyright © 2010-2015 Aurimas Cernius\n" +"Copyright © 2009-2011 Debarshi Ray\n" +"Copyright © 2009 Hubert Figuiere\n" "Copyright-a © 2004-2009 Tomboy-ren jatorriko egileak." -#: ../src/gnote.cpp:378 +#: ../src/gnote.cpp:308 msgid "A simple and easy to use desktop note-taking application." msgstr "Oharrak hartzeko mahaigaineko aplikazio sinple eta erraza." -#: ../src/gnote.cpp:389 +#: ../src/gnote.cpp:319 msgid "Homepage" msgstr "Gune nagusia" -#: ../src/gnote.cpp:563 +#: ../src/gnote.cpp:494 msgid "Run Gnote in background." msgstr "Exekutatu Gnote atzeko planoan." -#: ../src/gnote.cpp:564 +#: ../src/gnote.cpp:495 +msgid "Run Gnote as GNOME Shell search provider." +msgstr "Exekutatu Gnote GNOMEren shell-eko bilaketa-hornitzaile gisa." + +#: ../src/gnote.cpp:496 msgid "Specify the path of the directory containing the notes." msgstr "Zehaztu oharrak dituen direktorioaren bide-izena." -#: ../src/gnote.cpp:564 +#: ../src/gnote.cpp:496 msgid "path" msgstr "bide-izena" -#: ../src/gnote.cpp:565 +#: ../src/gnote.cpp:497 msgid "Open the search all notes window with the search text." msgstr "'Bilatu ohar guztietan' leihoa irekitzen du bilatzeko testuarekin." -#: ../src/gnote.cpp:565 ../src/gnote.cpp:570 +#: ../src/gnote.cpp:497 ../src/gnote.cpp:502 msgid "text" msgstr "testua" -#: ../src/gnote.cpp:566 +#: ../src/gnote.cpp:498 msgid "Print version information." msgstr "Erakutsi bertsioaren informazioa." -#: ../src/gnote.cpp:567 +#: ../src/gnote.cpp:499 msgid "Create and display a new note, with a optional title." msgstr "Sortu eta bistaratu ohar berria, aukerako izenburuarekin." -#: ../src/gnote.cpp:567 +#: ../src/gnote.cpp:499 msgid "title" msgstr "izenburua" -#: ../src/gnote.cpp:568 +#: ../src/gnote.cpp:500 msgid "Display the existing note matching title." msgstr "Bistaratu izenburuarekin bat datorren eta existitzen den oharra." -#: ../src/gnote.cpp:568 +#: ../src/gnote.cpp:500 msgid "title/url" msgstr "izenburua/urla" -#: ../src/gnote.cpp:569 +#: ../src/gnote.cpp:501 msgid "Display the 'Start Here' note." msgstr "Bistaratu 'Hasi hemen' oharra." -#: ../src/gnote.cpp:570 +#: ../src/gnote.cpp:502 msgid "Search and highlight text in the opened note." msgstr "Bilatu eta nabarmendu testua irekitako oharrean." -#: ../src/gnote.cpp:574 +#: ../src/gnote.cpp:506 msgid "A note taking application" msgstr "Oharrak hartzeko aplikazioa" -#: ../src/gnote.cpp:574 +#: ../src/gnote.cpp:506 msgid "Gnote options at launch" msgstr "Gnote-ren abioko aukerak" -#: ../src/gnote.cpp:651 +#: ../src/gnote.cpp:583 msgid "Could not connect to remote instance." msgstr "Ezin izan da urruneko instantziarekin konektatu." -#: ../src/gnote.cpp:767 +#: ../src/gnote.cpp:699 msgid "Version %1%" msgstr "%1% bertsioa" @@ -1482,7 +1400,6 @@ msgstr "Huts egin du ikonoa (%s, %d) kargatzean: %s" #: ../src/noteaddin.cpp:108 ../src/noteaddin.cpp:122 ../src/noteaddin.cpp:135 -#, fuzzy msgid "Plugin is disposing already" msgstr "Plugina jadanik ezarrita dago" @@ -1490,6 +1407,23 @@ msgid "Window is not embedded" msgstr "Leihoa ez dago kapsulatuta" +#. Probably IOException or UnauthorizedAccessException? +#: ../src/notebase.cpp:200 ../src/note.cpp:382 +#, c-format +msgid "Exception while saving note: %s" +msgstr "Salbuespena oharra gordetzean: %s" + +#. write failure, but not critical +#: ../src/notebase.cpp:444 +#, c-format +msgid "Failed to update note format: %s" +msgstr "Huts egin du oharraren formatua eguneratzean: %s" + +#: ../src/notebase.cpp:568 +#, c-format +msgid "Filesystem error: %s" +msgstr "Fitxategi-sistemaren errorea: %s" + #: ../src/notebooks/createnotebookdialog.cpp:41 msgid "Create Notebook" msgstr "Sortu koadernoa" @@ -1583,11 +1517,11 @@ msgid "Active" msgstr "Aktibo" -#: ../src/notebuffer.cpp:1498 +#: ../src/notebuffer.cpp:1505 msgid " tag mismatch" msgstr " etiketa falta da" -#: ../src/notebuffer.cpp:1577 +#: ../src/notebuffer.cpp:1584 #, c-format msgid "Exception: %s" msgstr "Salbuespena: %s" @@ -1606,7 +1540,7 @@ #: ../src/note.cpp:70 msgid "If you delete a note it is permanently lost." -msgstr "Ohar bat ezabatzen baduzu, betirako galduko da." +msgstr "Ohar bat ezabatzen baduzu, betiko galduko da." #: ../src/note.cpp:106 msgid "Error saving note data." @@ -1622,12 +1556,6 @@ "libre dagoela, eta ~/.local/share/gnote direktoriorako baimen egokiak " "dituzula. Errorearen xehetasunak ~/.gnote.log fitxategian aurki dezakezu." -#. Probably IOException or UnauthorizedAccessException? -#: ../src/note.cpp:382 ../src/notebase.cpp:200 -#, c-format -msgid "Exception while saving note: %s" -msgstr "Salbuespena oharra gordetzean: %s" - #: ../src/note.cpp:474 #, c-format msgid "Error while saving: %s" @@ -1637,16 +1565,13 @@ msgid "Setting text content for closed notes not supported" msgstr "Testuaren edukia itxitako oharretan ezartzea ez dago onartuta" -#. write failure, but not critical -#: ../src/notebase.cpp:444 -#, c-format -msgid "Failed to update note format: %s" -msgstr "Huts egin du oharraren formatua eguneratzean: %s" +#: ../src/notemanagerbase.cpp:105 ../src/preferencesdialog.cpp:320 +msgid "New Note Template" +msgstr "Oharren txantiloi berria" -#: ../src/notebase.cpp:568 -#, c-format -msgid "Filesystem error: %s" -msgstr "Fitxategi-sistemaren errorea: %s" +#: ../src/notemanagerbase.cpp:359 +msgid "Describe your new note here." +msgstr "Azaldu ohar berria hemen." #: ../src/notemanager.cpp:133 msgid "" @@ -1735,14 +1660,6 @@ msgid "Error parsing note XML, skipping \"%s\": %s" msgstr "Errorea oharraren XMLa aztertzean, '%s' saltatzen: %s" -#: ../src/notemanagerbase.cpp:105 ../src/preferencesdialog.cpp:332 -msgid "New Note Template" -msgstr "Oharren txantiloi berria" - -#: ../src/notemanagerbase.cpp:359 -msgid "Describe your new note here." -msgstr "Azaldu ohar berria hemen." - #: ../src/noterenamedialog.cpp:123 msgid "Rename Note Links?" msgstr "Aldatu oharren esteken izenak?" @@ -1852,47 +1769,47 @@ msgid "Save _Title" msgstr "Gorde _izenburua" -#: ../src/notewindow.cpp:562 ../src/notewindow.cpp:1084 +#: ../src/notewindow.cpp:562 ../src/notewindow.cpp:1085 msgid "Cannot create note" msgstr "Ezin da oharra sortu" -#: ../src/notewindow.cpp:827 +#: ../src/notewindow.cpp:828 msgid "_Link" msgstr "_Estekatu" -#: ../src/notewindow.cpp:828 +#: ../src/notewindow.cpp:829 msgid "_Bold" msgstr "_Lodia" -#: ../src/notewindow.cpp:829 +#: ../src/notewindow.cpp:830 msgid "_Italic" msgstr "_Etzana" -#: ../src/notewindow.cpp:830 +#: ../src/notewindow.cpp:831 msgid "_Strikeout" msgstr "_Marratua" -#: ../src/notewindow.cpp:832 +#: ../src/notewindow.cpp:833 msgid "_Highlight" msgstr "_Nabarmendu" -#: ../src/notewindow.cpp:834 +#: ../src/notewindow.cpp:835 msgid "_Normal" msgstr "_Arrunta" -#: ../src/notewindow.cpp:836 +#: ../src/notewindow.cpp:837 msgid "Hu_ge" msgstr "_Oso handia" -#: ../src/notewindow.cpp:838 +#: ../src/notewindow.cpp:839 msgid "_Large" msgstr "_Handia" -#: ../src/notewindow.cpp:840 +#: ../src/notewindow.cpp:841 msgid "S_mall" msgstr "T_xikia" -#: ../src/notewindow.cpp:842 +#: ../src/notewindow.cpp:843 msgid "Bullets" msgstr "Buletak" @@ -1904,43 +1821,30 @@ msgid "Links" msgstr "Estekak" -#: ../src/preferencesdialog.cpp:125 -msgid "Hotkeys" -msgstr "Laster-teklak" - #. TRANSLATORS: Addin category. -#: ../src/preferencesdialog.cpp:129 ../src/sharp/addinstreemodel.cpp:164 +#: ../src/preferencesdialog.cpp:125 ../src/sharp/addinstreemodel.cpp:164 msgid "Synchronization" msgstr "Sinkronizazioa" -#: ../src/preferencesdialog.cpp:131 +#: ../src/preferencesdialog.cpp:127 msgid "Plugins" msgstr "Pluginak" -#: ../src/preferencesdialog.cpp:208 +#: ../src/preferencesdialog.cpp:204 #, c-format msgid "Plugin %s is absent" msgstr "'%s' plugina falta da" -#. Status icon -#: ../src/preferencesdialog.cpp:247 -msgid "Use status _icon" -msgstr "Erabili egoera-_ikonoa" - -#: ../src/preferencesdialog.cpp:248 -msgid "Show icon in tray, which is the central place of control." -msgstr "Erakutsi ikonoa erretiluan, kontrolaren leku nagusia da." - #. Open in new window -#: ../src/preferencesdialog.cpp:255 +#: ../src/preferencesdialog.cpp:243 msgid "Always _open notes in new window" msgstr "_Ireki beti oharrak leiho berrietan" -#: ../src/preferencesdialog.cpp:268 +#: ../src/preferencesdialog.cpp:256 msgid "_Spell check while typing" msgstr "Egiaztatu _ortografia idaztean" -#: ../src/preferencesdialog.cpp:269 +#: ../src/preferencesdialog.cpp:257 msgid "" "Misspellings will be underlined in red, with correct spelling suggestions " "shown in the context menu." @@ -1950,35 +1854,35 @@ "erakutsiko dira." #. Auto bulleted list -#: ../src/preferencesdialog.cpp:279 +#: ../src/preferencesdialog.cpp:267 msgid "Enable auto-_bulleted lists" msgstr "Gaitu _buletdun zerrenda automatikoak" -#: ../src/preferencesdialog.cpp:280 +#: ../src/preferencesdialog.cpp:268 msgid "Start new bulleted list by starting new line with character \"-\"." msgstr "Hasi buletdun zerrendak lerro berriak '-' karakterearekin hasiz" -#: ../src/preferencesdialog.cpp:289 +#: ../src/preferencesdialog.cpp:277 msgid "Use custom _font" msgstr "Erabili letra-tipo _pertsonalizatua" -#: ../src/preferencesdialog.cpp:307 +#: ../src/preferencesdialog.cpp:295 msgid "When renaming a linked note: " msgstr "Estekatutako oharra izenez aldatzean: " -#: ../src/preferencesdialog.cpp:311 +#: ../src/preferencesdialog.cpp:299 msgid "Ask me what to do" msgstr "Galdetu zer egin" -#: ../src/preferencesdialog.cpp:312 +#: ../src/preferencesdialog.cpp:300 msgid "Never rename links" msgstr "Inoiz ez aldatu esteken izenak" -#: ../src/preferencesdialog.cpp:313 +#: ../src/preferencesdialog.cpp:301 msgid "Always rename links" msgstr "Beti aldatu esteken izenak" -#: ../src/preferencesdialog.cpp:333 +#: ../src/preferencesdialog.cpp:321 msgid "" "Use the new note template to specify the text that should be used when " "creating a new note." @@ -1986,40 +1890,40 @@ "Oharren txantiloi berria erabili ohar berri bat sortzean erabiliko den " "testua zehazteko." -#: ../src/preferencesdialog.cpp:338 +#: ../src/preferencesdialog.cpp:326 msgid "Open New Note Template" msgstr "Ireki oharren txantiloi berria" #. internal links -#: ../src/preferencesdialog.cpp:395 +#: ../src/preferencesdialog.cpp:383 msgid "_Automatically link to notes" msgstr "Estekatu _automatikoki oharretara" -#: ../src/preferencesdialog.cpp:396 +#: ../src/preferencesdialog.cpp:384 msgid "Enable this option to create a link when text matches note title." msgstr "" "Gaitu aukera hau testua oharraren izenburuarekin bat datorrenean esteka bat " "sortzeko." #. URLs -#: ../src/preferencesdialog.cpp:402 +#: ../src/preferencesdialog.cpp:390 msgid "Create links for _URLs" msgstr "Sortu _URLen estekak" -#: ../src/preferencesdialog.cpp:403 +#: ../src/preferencesdialog.cpp:391 msgid "" -"Enable this option to create a link for URLs. Clicking will open that URL " -"with apropriate program." +"Enable this option to create links for URLs. Clicking will open URL with " +"appropriate program." msgstr "" "Gaitu aukera hau URLen esteka sortzeko. Klik eginez URL hori dagokion " "programarekin irekiko da." #. WikiWords... -#: ../src/preferencesdialog.cpp:410 +#: ../src/preferencesdialog.cpp:398 msgid "Highlight _WikiWords" msgstr "Nabarmendu _WikiWords-ak" -#: ../src/preferencesdialog.cpp:411 +#: ../src/preferencesdialog.cpp:399 msgid "" "Enable this option to highlight words ThatLookLikeThis. Clicking the " "word will create a note with that name." @@ -2027,90 +1931,55 @@ "Gaitu aukera hau HonenItxuraDuten hitzak nabarmentzeko. Egin klik " "hitzaren gainean izen horrekin ohar bat sortzeko." -#. Hotkeys... -#: ../src/preferencesdialog.cpp:441 -msgid "Listen for _hotkeys" -msgstr "Entzun _laster-teklak" - -#: ../src/preferencesdialog.cpp:442 -msgid "" -"Hotkeys allow you to quickly access your notes from anywhere with a " -"keypress. Example Hotkeys: <Control><Shift>F11, <" -"Alt>N" -msgstr "" -"Laster-teklek zure oharretara edonondik azkar sartzen lagunduko dizute. " -"Laster-tekla adibidea: <Kontrol><Maius>F11, <Alt>" -"N" - -#. Show notes menu keybinding... -#: ../src/preferencesdialog.cpp:464 -msgid "Show notes _menu" -msgstr "Erakutsi oharren _menua" - -#. Open Start Here keybinding... -#: ../src/preferencesdialog.cpp:481 -msgid "Open \"_Start Here\"" -msgstr "Ireki '_Hasi hemen'" - -#. Create new note keybinding... -#: ../src/preferencesdialog.cpp:497 -msgid "Create _new note" -msgstr "Sortu _ohar berria" - -#. Open Search All Notes window keybinding... -#: ../src/preferencesdialog.cpp:513 -msgid "Open \"Search _All Notes\"" -msgstr "Ireki '_Bilatu ohar guztiak'" - -#: ../src/preferencesdialog.cpp:553 +#: ../src/preferencesdialog.cpp:431 msgid "Ser_vice:" msgstr "_Zerbitzua:" -#: ../src/preferencesdialog.cpp:609 ../src/preferencesdialog.cpp:1239 +#: ../src/preferencesdialog.cpp:487 ../src/preferencesdialog.cpp:1117 msgid "Not configurable" msgstr "Ez da konfiguragarria" -#: ../src/preferencesdialog.cpp:636 +#: ../src/preferencesdialog.cpp:514 msgid "Automatical background s_ync interval (minutes)" msgstr "Sinkronizatu automatikoki atz. planoan (minutuak)" #. "Advanced..." button to bring up extra sync config dialog -#: ../src/preferencesdialog.cpp:660 +#: ../src/preferencesdialog.cpp:538 msgid "_Advanced..." msgstr "_Aurreratua..." -#: ../src/preferencesdialog.cpp:707 +#: ../src/preferencesdialog.cpp:585 msgid "The following plugins are installed:" msgstr "Honako pluginak daude instalatuta:" #. TODO: In a future version, add in an "Install Add-ins..." button #. TODO: In a future version, add in a "Repositories..." button -#: ../src/preferencesdialog.cpp:742 +#: ../src/preferencesdialog.cpp:620 msgid "_Enable" msgstr "_Gaitu" -#: ../src/preferencesdialog.cpp:748 +#: ../src/preferencesdialog.cpp:626 msgid "_Disable" msgstr "_Desgaitu" -#: ../src/preferencesdialog.cpp:906 +#: ../src/preferencesdialog.cpp:784 msgid "Not Implemented" msgstr "Inplementatu gabe" -#: ../src/preferencesdialog.cpp:922 +#: ../src/preferencesdialog.cpp:800 msgid "%1% Preferences" msgstr "%1%(r)en hobespenak" -#: ../src/preferencesdialog.cpp:1057 +#: ../src/preferencesdialog.cpp:935 msgid "Choose Note Font" msgstr "Aukeratu oharraren letra-tipoa" #. Create dialog -#: ../src/preferencesdialog.cpp:1155 +#: ../src/preferencesdialog.cpp:1033 msgid "Other Synchronization Options" msgstr "Bestelako sinkronizazioko aukerak" -#: ../src/preferencesdialog.cpp:1158 +#: ../src/preferencesdialog.cpp:1036 msgid "" "When a conflict is detected between a local note and a note on the " "configured synchronization server:" @@ -2119,23 +1988,23 @@ "gatazkak detektatzen direnean:" #. label.Xalign = 0; -#: ../src/preferencesdialog.cpp:1162 +#: ../src/preferencesdialog.cpp:1040 msgid "Always ask me what to do" msgstr "Galdetu beti zer egin." -#: ../src/preferencesdialog.cpp:1166 +#: ../src/preferencesdialog.cpp:1044 msgid "Rename my local note" msgstr "Aldatu lokaleko oharraren izena." -#: ../src/preferencesdialog.cpp:1170 +#: ../src/preferencesdialog.cpp:1048 msgid "Replace my local note with the server's update" -msgstr "Ordeztu lokaleko oharra zerbitzariko eguneraketarekin" +msgstr "Ordeztu lokaleko oharra zerbitzariko eguneratzearekin" -#: ../src/preferencesdialog.cpp:1272 +#: ../src/preferencesdialog.cpp:1150 msgid "Are you sure?" msgstr "Ziur zaude?" -#: ../src/preferencesdialog.cpp:1273 +#: ../src/preferencesdialog.cpp:1151 msgid "" "Clearing your synchronization settings is not recommended. You may be " "forced to synchronize all of your notes again when you save new settings." @@ -2143,11 +2012,11 @@ "Ez da aholkatzen sinkronizazioaren ezarpenak garbitzea. Zure ohar guztiak " "berriro sinkronizatu beharko dituzu ezarpen berriak gordetzean." -#: ../src/preferencesdialog.cpp:1283 +#: ../src/preferencesdialog.cpp:1161 msgid "Resetting Synchronization Settings" msgstr "Sinkronizazio-ezarpenak berrezartzen" -#: ../src/preferencesdialog.cpp:1284 +#: ../src/preferencesdialog.cpp:1162 msgid "" "You have disabled the configured synchronization service. Your " "synchronization settings will now be cleared. You may be forced to " @@ -2157,11 +2026,11 @@ "konfigurazioak garbitu egingo dira. Zure ohar guztiak berriro sinkronizatu " "beharko dituzu ezarpen berriak gordetzean." -#: ../src/preferencesdialog.cpp:1350 +#: ../src/preferencesdialog.cpp:1228 msgid "Connection successful" msgstr "Ongi konektatu da" -#: ../src/preferencesdialog.cpp:1351 +#: ../src/preferencesdialog.cpp:1229 msgid "" "Gnote is ready to synchronize your notes. Would you like to synchronize them " "now?" @@ -2169,7 +2038,7 @@ "Gnote prest dago zure oharrak sinkronizatzeko. Nahi dituzu oharrak orain " "sinkronizatzea?" -#: ../src/preferencesdialog.cpp:1375 +#: ../src/preferencesdialog.cpp:1253 msgid "" "Please check your information and try again. The log file %1% may contain " "more information about the error." @@ -2177,19 +2046,19 @@ "Egiaztatu informazioa eta saiatu berriro. '%1%' egunkariak erroreari buruzko " "informazio gehiago eduki dezake." -#: ../src/preferencesdialog.cpp:1380 +#: ../src/preferencesdialog.cpp:1258 msgid "Error connecting" msgstr "Errorea konektatzean" -#: ../src/preferencesdialog.cpp:1443 +#: ../src/preferencesdialog.cpp:1321 msgid "Version:" msgstr "Bertsioa:" -#: ../src/preferencesdialog.cpp:1446 +#: ../src/preferencesdialog.cpp:1324 msgid "Author:" msgstr "Egilea:" -#: ../src/preferencesdialog.cpp:1451 +#: ../src/preferencesdialog.cpp:1329 msgid "Copyright:" msgstr "Copyright-a:" @@ -2393,7 +2262,7 @@ #: ../src/synchronization/fusesyncserviceaddin.cpp:196 msgid "Timeout connecting to server." -msgstr "Denbora iraungituta zerbitzariarekin konektatzean." +msgstr "Denbora iraungita zerbitzariarekin konektatzean." #: ../src/synchronization/fusesyncserviceaddin.cpp:202 msgid "Error connecting to server." @@ -2404,17 +2273,17 @@ msgstr "Ezin izan da FUSE gaitu." #: ../src/synchronization/fusesyncserviceaddin.cpp:246 -msgid "An error ocurred while connecting to the specified server" +msgid "An error occurred while connecting to the specified server" msgstr "Errorea gertatu da zehaztutako zerbitzariarekin konektatzean" #. TRANSLATORS: %s is file -#: ../src/synchronization/gnotesyncclient.cpp:166 +#: ../src/synchronization/gnotesyncclient.cpp:165 #, c-format msgid "Unparsable last-sync-date element in %s" msgstr "'last-sync-date' elementua ezin da aztertu '%s'(e)n" #. TRANSLATORS: %s is file -#: ../src/synchronization/gnotesyncclient.cpp:176 +#: ../src/synchronization/gnotesyncclient.cpp:175 #, c-format msgid "Unparsable last-sync-rev element in %s" msgstr "'last-sync-rev' elementua ezin da aztertu '%s'(e)n" @@ -2516,11 +2385,11 @@ #: ../src/synchronization/syncdialog.cpp:521 msgid "Preparing to download updates from server..." -msgstr "Zerbitzaritik eguneraketak deskargatzeko prestatzen..." +msgstr "Zerbitzaritik eguneratzeak deskargatzeko prestatzen..." #: ../src/synchronization/syncdialog.cpp:524 msgid "Preparing to upload updates to server..." -msgstr "Zerbitzarira eguneraketak bidaltzeko prestatzen..." +msgstr "Zerbitzarira eguneratzeak bidaltzeko prestatzen..." #: ../src/synchronization/syncdialog.cpp:527 msgid "Uploading notes to server..." @@ -2680,18 +2549,6 @@ "abioan. Gehitu 'modprobe fuse' lerroa /etc/init.d/boot.local fitxategian edo " "'fuse' lerroa /etc/modules fitxategian" -#: ../src/tray.cpp:54 -msgid "Take notes" -msgstr "Hartu oharrak" - -#: ../src/tray.cpp:167 -msgid " (new)" -msgstr " (berria)" - -#: ../src/tray.cpp:458 -msgid "_About Gnote" -msgstr "Gnote-ri _buruz" - #: ../src/utils.cpp:144 msgid "" "The \"Gnote Manual\" could not be found. Please verify that your " @@ -2786,6 +2643,133 @@ msgid "_Open Link" msgstr "_Ireki esteka" +#~ msgid "" +#~ "Has affect only when started as an application. When set to TRUE, shows a " +#~ "status icon. If set to FALSE, Search All Notes window is used as main " +#~ "application window, closing which makes application to exit." +#~ msgstr "" +#~ "Aplikazio bat bezala abiaraztean eragiten du soilik. TRUE (egia) gisa " +#~ "ezartzen bada, egoeraren ikonoa erakusten du. FALSE (faltsua) gisa " +#~ "ezartzean, 'Ohar guztiak' leihoa erabiliko da leiho nagusi gisa, eta " +#~ "leiho hori ixteak aplikaziotik irtetea eragingo du." + +#~ msgid "" +#~ "The global keybinding for showing the Gnote applet's menu. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Laster-tekla orokorra Gnote miniaplikazioaren menua erakusteko. Formatuak " +#~ "honelako itxura du '<Control>a' edo '<Shift><Alt>F1'. " +#~ "Analizatzailea nahiko eskuzabala da, letra maiuskulak eta minuskulak " +#~ "erabiltzen uzten du, eta baita '<Ctl>' edo '<Ctrl>' bezalako " +#~ "laburdurak ere. Aukera 'desgaituta' bezala zehazten baduzu, ez da " +#~ "ekintzaren laster-teklarik egongo." + +#~ msgid "" +#~ "The global keybinding for opening the \"Start Here\" note. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Laster-tekla orokorra 'Hasi hemen' oharra irekitzeko. Formatuak honelako " +#~ "itxura du '<Control>a' edo '<Shift><Alt>F1'. " +#~ "Analizatzailea nahiko eskuzabala da, letra maiuskulak eta minuskulak " +#~ "erabiltzen uzten du, eta baita '<Ctl>' edo '<Ctrl>' bezalako " +#~ "laburdurak ere. Aukera 'desgaituta' bezala zehazten baduzu, ez da " +#~ "ekintzaren laster-teklarik egongo." + +#~ msgid "" +#~ "The global keybinding for creating and displaying a new Note. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Laster-tekla orokorra ohar berria sortzeko eta bistaratzeko. Formatuak " +#~ "honelako itxura du '<Kontrol>a' edo '<Shift><Alt>F1'. " +#~ "Analizatzailea nahiko eskuzabala da, letra maiuskulak eta minuskulak " +#~ "erabiltzen uzten du, eta baita '<Ctl>' edo '<Ctrl>' bezalako " +#~ "laburdurak ere. Aukera 'desgaituta' bezala zehazten baduzu, ez da " +#~ "ekintzaren laster-teklarik egongo." + +#~ msgid "" +#~ "The global keybinding for opening the Note Search dialog. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Laster-tekla orokorra 'Ohar-bilaketa' leihoa irekitzeko. Formatuak " +#~ "honelako itxura du '<Control>a' edo '<Shift><Alt>F1'. " +#~ "Analizatzailea nahiko eskuzabala da, letra maiuskulak eta minuskulak " +#~ "erabiltzen uzten du, eta baita '<Ctl>' edo '<Ctrl>' bezalako " +#~ "laburdurak ere. Aukera 'desgaituta' bezala zehazten baduzu, ez da " +#~ "ekintzaren laster-teklarik egongo." + +#~ msgid "" +#~ "The global keybinding for opening the Recent Changes dialog. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Laster-tekla orokorra 'Azken aldaketak' leihoa irekitzeko. Formatuak " +#~ "honelako itxura du '<Control>a' edo '<Shift><Alt>F1'. " +#~ "Analizatzailea nahiko eskuzabala da, letra maiuskulak eta minuskulak " +#~ "erabiltzen uzten du, eta baita '<Ctl>' edo '<Ctrl>' bezalako " +#~ "laburdurak ere. Aukera 'desgaituta' bezala zehazten baduzu, ez da " +#~ "ekintzaren laster-teklarik egongo." + +#~ msgid "Hotkeys" +#~ msgstr "Laster-teklak" + +#~ msgid "Use status _icon" +#~ msgstr "Erabili egoera-_ikonoa" + +#~ msgid "Show icon in tray, which is the central place of control." +#~ msgstr "Erakutsi ikonoa erretiluan, kontrolaren leku nagusia da." + +#~ msgid "Listen for _hotkeys" +#~ msgstr "Entzun _laster-teklak" + +#~ msgid "" +#~ "Hotkeys allow you to quickly access your notes from anywhere with a " +#~ "keypress. Example Hotkeys: <Control><Shift>F11, <" +#~ "Alt>N" +#~ msgstr "" +#~ "Laster-teklek zure oharretara edonondik azkar sartzen lagunduko dizute. " +#~ "Laster-tekla adibidea: <Kontrol><Maius>F11, <" +#~ "Alt>N" + +#~ msgid "Show notes _menu" +#~ msgstr "Erakutsi oharren _menua" + +#~ msgid "Open \"_Start Here\"" +#~ msgstr "Ireki '_Hasi hemen'" + +#~ msgid "Create _new note" +#~ msgstr "Sortu _ohar berria" + +#~ msgid "Open Search _Window" +#~ msgstr "Ireki _bilaketa-leihoa" + +#~ msgid "Take notes" +#~ msgstr "Hartu oharrak" + +#~ msgid " (new)" +#~ msgstr " (berria)" + +#~ msgid "_About Gnote" +#~ msgstr "Gnote-ri _buruz" + #~ msgid "Pin" #~ msgstr "PINa" @@ -2806,3 +2790,6 @@ #~ msgid "Decrease Font Size" #~ msgstr "Txikiagotu letra-tamaina" + +#~ msgid "Open \"Search _All Notes\"" +#~ msgstr "Ireki '_Bilatu ohar guztiak'" diff -Nru gnote-3.14.2/po/gu.po gnote-3.16.0/po/gu.po --- gnote-3.14.2/po/gu.po 2015-01-17 12:53:20.000000000 +0000 +++ gnote-3.16.0/po/gu.po 2015-03-07 18:13:28.000000000 +0000 @@ -9,8 +9,8 @@ "Project-Id-Version: gnote.master.gu\n" "Report-Msgid-Bugs-To: http://bugzilla.gnome.org/enter_bug." "cgi?product=gnote&keywords=I18N+L10N&component=general\n" -"POT-Creation-Date: 2014-11-11 21:17+0000\n" -"PO-Revision-Date: 2014-11-12 15:28+0530\n" +"POT-Creation-Date: 2014-09-04 08:21+0000\n" +"PO-Revision-Date: 2014-09-04 15:33+0530\n" "Last-Translator: \n" "Language-Team: American English \n" "Language: \n" @@ -31,7 +31,7 @@ msgid "" "Gnote also supports synchronization to make it possible to use on multiple " "devices." -msgstr "Gnote પણ ઘણાં ઉપકરણો પર વાપરવા માટે તેને શક્ય બનાવવા માટે સુમેળને આધાર આપે છે." +msgstr "" #: ../data/gnote.desktop.in.in.h:1 ../src/recentchanges.cpp:45 #: ../src/recentchanges.cpp:479 @@ -47,6 +47,7 @@ msgstr "નોંધ-લેનાર" #: ../data/gnote.desktop.in.in.h:4 +#| msgid "note;idea;link;organize;" msgid "notes;idea;link;organize;" msgstr "નોંધ;વિચાર;કડી;સંચાલન;" @@ -70,16 +71,17 @@ msgid "" "Enable this option to automatically create a link, when text matches note " "title." -msgstr "કડીને આપમેળે બનાવવા માટે આ વિકલ્પને સક્રિય કરો, જયારે લખાણ નોંધ શીર્ષક સાથે બંધબેસે." +msgstr "" #: ../data/org.gnome.gnote.gschema.xml.in.h:5 +#, fuzzy #| msgid "Update links in referencing notes" msgid "Create links for URLs in notes" -msgstr "નોંધોમાં URLs માટે કડીઓને બનાવો" +msgstr "સંદર્ભ નોંધમાં કડીઓ સુધારો" #: ../data/org.gnome.gnote.gschema.xml.in.h:6 msgid "Enable this option to create links for URLs in notes." -msgstr "નોંધોમાં URLs માટે કડીઓને બનાવવા માટે આ વિકલ્પને સક્રિય કરો." +msgstr "" #: ../data/org.gnome.gnote.gschema.xml.in.h:7 msgid "Enable WikiWord highlighting" @@ -222,15 +224,17 @@ msgstr "પિક્સેલમાં શોધ વિન્ડો સ્પ્લીટર સ્થાનને નક્કી કરે છે; Gnote બહાર નીકળવા પર સંગ્રહેલ છે." #: ../data/org.gnome.gnote.gschema.xml.in.h:33 +#| msgid "Saved height of Search window" msgid "Saved sorting of the Search window." msgstr "શોધ વિન્ડોની સંગ્રહ થયેલ ક્રમ." #: ../data/org.gnome.gnote.gschema.xml.in.h:34 +#, fuzzy #| msgid "" #| "Determines Search window splitter position in pixels; stored on Gnote " #| "exit." msgid "Determines Search window initial sorting." -msgstr "શોધ વિન્ડો પ્રારંભિક ક્રમને નક્કી કરી રહયા છે." +msgstr "પિક્સેલમાં શોધ વિન્ડો સ્પ્લીટર સ્થાનને નક્કી કરે છે; Gnote બહાર નીકળવા પર સંગ્રહેલ છે." #: ../data/org.gnome.gnote.gschema.xml.in.h:35 msgid "FUSE Mounting Timeout (ms)" @@ -320,6 +324,7 @@ "વિન્ડોમાં વાપરેલ છે, બંધ કરી રહ્યા છે જે કાર્યક્રમ બહાર નીકળવાનો છે." #: ../data/org.gnome.gnote.gschema.xml.in.h:51 +#| msgid "Open In New _Window" msgid "Open notes in new window" msgstr "નવી વિન્ડોમાં નોંધોને ખોલો" @@ -327,18 +332,17 @@ msgid "" "Open notes in new window instead of replacing active content of the same " "window" -msgstr "એજ વિન્ડોનાં સક્રિય સમાવિષ્ટને બદલવાને બદલે નવી વિન્ડોમાં નોંધોને ખોલો" +msgstr "" #: ../data/org.gnome.gnote.gschema.xml.in.h:53 msgid "Save note window size and autosize note window to it" -msgstr "નોંધ વિન્ડો માપને સંગ્રહો અને તેની માટે નોંધ વિન્ડોનું માપ બદલો" +msgstr "" #: ../data/org.gnome.gnote.gschema.xml.in.h:54 msgid "" "Saves note window size and automatically resizes main window to this size, " "when note is opened." msgstr "" -"નોંધ વિન્ડો માપને સંગ્રહે છે આ માપમાં મુખ્ય વિન્ડોનું માપ આપમેળે બદલે છે, જ્યારે નોંધ ખુલ્લી હોય." #: ../data/org.gnome.gnote.gschema.xml.in.h:55 msgid "Show applet menu" @@ -577,7 +581,7 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:90 msgid "Time interval between note directory checks (in seconds). Min value is 5." -msgstr "નોંધ ચકાસણીઓ (સેકંડમાં) વચ્ચે સમય અંતરાલ. ન્યૂનત્તમ કિંમત ૫ છે." +msgstr "" #: ../src/actionmanager.cpp:84 ../src/actionmanager.cpp:171 #: ../src/tray.cpp:465 @@ -652,7 +656,7 @@ #: ../src/addininfo.cpp:124 #, c-format msgid "Incompatible plug-in %s: expected %s, got %s" -msgstr "અસુસંગત પ્લગઇન %s: ઇચ્છિત %s, %s મળ્યું" +msgstr "" #: ../src/addinmanager.cpp:133 #, c-format @@ -687,20 +691,21 @@ #: ../src/addinmanager.cpp:228 #, c-format msgid "Failed to load addin info for %s: %s" -msgstr "%s માટે એડઇન જાણકારી લાવવાનું નિષ્ફળ: %s" +msgstr "" #: ../src/addinmanager.cpp:352 msgid "Trying to load addins when they are already loaded" -msgstr "એડઇનને લાવવાનો પ્રયત્ન કરી રહ્યા છે જ્યારે તેઓ પહેલેથી લાવેલ છે" +msgstr "" #: ../src/addins/backlinks/backlinkmenuitem.cpp:41 msgid "What links here?" msgstr "અહિંયા કઇ કડીઓ છે?" #: ../src/addins/backlinks/backlinkmenuitem.cpp:42 +#, fuzzy #| msgid "What links here?" msgid "Which notes have links to here?" -msgstr "અહિંયા નોંધો પાસે કઇ કડીઓ છે?" +msgstr "અહિંયા કઇ કડીઓ છે?" #: ../src/addins/backlinks/backlinks.desktop.in.in.h:1 msgid "Backlinks" @@ -790,10 +795,10 @@ msgstr "જો તમે ચિહ્નને દૂર કરો તો તે કાયમ માટે ગુમ થઇ જશે." #: ../src/addins/bugzilla/bugzillapreferences.cpp:394 -#, c-format +#, fuzzy, c-format #| msgid "Error saving icon" msgid "Error removing icon %s: %s" -msgstr "ચિહ્ન %s ને દૂર કરી રહયા હોય ત્યારે ભૂલ: %s" +msgstr "ચિહ્નને સંગ્રહ કરવા દરમ્યાન ભૂલ" #: ../src/addins/exporttogtg/exporttogtg.desktop.in.in.h:1 #: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:71 @@ -810,7 +815,7 @@ #: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:3 #: ../src/addins/statistics/statistics.desktop.in.in.h:3 msgid "Aurimas Černius" -msgstr "Aurimas Černius" +msgstr "" #: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:72 msgid "Export note as Getting Things GNOME task" @@ -818,16 +823,16 @@ #: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:86 msgid "GTG XML loaded, but interface not found" -msgstr "GTG XML લાવેલ છે, પરંતુ ઇન્ટરફેસ મળ્યુ નથી" +msgstr "" #: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:92 #, c-format msgid "Failed to create GTG interface from XML: %s" -msgstr "XML માંથી GTG ઇન્ટરફેસને બનાવવામાં નિષ્ફળ: %s" +msgstr "" #: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:100 -msgid "Failed to create D-Bus proxy for GTG" -msgstr "GTG માટે D-Bus પ્રોક્સીને બનાવવામાં નિષ્ફળ" +msgid "Failed to create D_Bus proxy for GTG" +msgstr "" #: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:116 #, c-format @@ -856,14 +861,15 @@ msgstr "બધી બીજી કડી થયેલ નોંધોને સમાવો" #: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:77 +#, fuzzy #| msgid "Export to HTML" msgid "Export note to HTML" -msgstr "HTML માં નોંધની નિકાસ કરો" +msgstr "HTML ની નિકાસ કરો" #: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:117 #, c-format msgid "Could not open exported note in a web browser: %s" -msgstr "વેબ બ્રાઉઝરમાં નિકાસ થયેલ નોંધને ખોલી શક્યા નહિં: %s" +msgstr "" #: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:121 msgid "Your note was exported to \"%1%\"." @@ -875,10 +881,10 @@ #: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:144 #: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:152 -#, c-format +#, fuzzy, c-format #| msgid "Could not save the file \"%s\"" msgid "Could not export: %s" -msgstr "નિકાસ કરી શક્યા નહિં: %s" +msgstr "ફાઇલ \"%s\" નો સંગ્રહ કરી શકાયુ નહિં" #: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:155 #, c-format @@ -906,9 +912,10 @@ msgstr "સ્થાનિક ફોલ્ડર" #: ../src/addins/filesystemsyncservice/filesystemsyncservice.desktop.in.in.h:1 +#, fuzzy #| msgid "Local Directory Sync Service Add-in" msgid "Local Directory Sync Service Plugin" -msgstr "સ્થાનિક ડિરેક્ટરી સુમેળ સેવા પ્લગઇન" +msgstr "સ્થાનિક ડિરેક્ટરી સુમેળ સેવા ઉમેરો" #: ../src/addins/filesystemsyncservice/filesystemsyncservice.desktop.in.in.h:2 msgid "Synchronize Gnote Notes to a local file system path" @@ -943,9 +950,10 @@ msgstr "કર્સર સ્થાન પર હાલની તારીખ અને સમયને દાખલ કરે છે." #: ../src/addins/inserttimestamp/inserttimestampnoteaddin.cpp:46 +#, fuzzy #| msgid "Insert Timestamp" msgid "Insert Timestamp into note" -msgstr "નોંધમાં ટાઇમસ્ટેમ્પને દાખલ કરો" +msgstr "ટાઇમસ્ટેમ્પને દાખલ કરો" #. Label #: ../src/addins/inserttimestamp/inserttimestamppreferences.cpp:70 @@ -964,35 +972,35 @@ #: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:236 #, c-format msgid "NoteDirectoryWatcher: Update aborted, error reading %s: %s" -msgstr "NoteDirectoryWatcher: સુધારો કાઢી નાંખેલ છે, %s ને વાંચી રહ્યા હોય ત્યારે ભૂલ: %s" +msgstr "" #. TRANSLATORS: %s is file #: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:263 #, c-format msgid "NoteDirectoryWatcher: Error reading note title from %s" -msgstr "NoteDirectoryWatcher: %s માંથી નોંધ શીર્ષકને વાંચી રહ્યા હોય ત્યારે ભૂલ" +msgstr "" #. TRANSLATORS: %s is file #: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:271 #, c-format msgid "NoteDirectoryWatcher: Unknown error creating note from %s" -msgstr "NoteDirectoryWatcher: અજ્ઞાત ભૂલ %s માંથી નોંધને બનાવી રહ્યા છે" +msgstr "" #. TRANSLATORS: first %s is file, second is error #: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:277 #, c-format msgid "NoteDirectoryWatcher: Error creating note from %s: %s" -msgstr "NoteDirectoryWatcher: %s માંથી નોંધને બનાવી રહ્યા હોય ત્યારે ભૂલ: %s" +msgstr "" #. TRANSLATORS: first %s is file, second is error #: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:290 #, c-format msgid "NoteDirectoryWatcher: Update aborted, error parsing %s: %s" -msgstr "NoteDirectoryWatcher: સુધારો કાઢી નાંખેલ છે, %s નું પદચ્છેદન કરી રહ્યા હોય ત્યારે ભૂલ: %s" +msgstr "" #: ../src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp:35 msgid "_Directory check interval:" -msgstr "ડિરેક્ટરી ચકાસણી અંતરાલ (_D):" +msgstr "" #: ../src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in.in.h:1 msgid "Note Directory Watcher" @@ -1020,7 +1028,7 @@ #: ../src/addins/noteoftheday/noteofthedaypreferences.cpp:72 #, c-format msgid "NoteOfTheDay could not create %s: %s" -msgstr "NoteOfTheDay એ %s ને બનાવી શક્યા નહિં: %s" +msgstr "" #: ../src/addins/noteoftheday/noteoftheday.cpp:155 msgid "Tasks" @@ -1072,6 +1080,7 @@ msgstr "છાપો" #: ../src/addins/printnotes/printnotesnoteaddin.cpp:61 +#| msgid "Quit Gnote" msgid "Print note" msgstr "નોંધ છાપો" @@ -1099,7 +1108,7 @@ #: ../src/addins/readonly/readonlynoteaddin.cpp:54 msgid "Make this note read-only" -msgstr "ફક્ત વાંચી શકાય તેવી આ નોંધને બનાવો" +msgstr "" #: ../src/addins/replacetitle/replacetitle.desktop.in.in.h:1 #: ../src/addins/replacetitle/replacetitlenoteaddin.cpp:51 @@ -1116,12 +1125,13 @@ #: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:1 #: ../src/addins/specialnotes/specialnotesapplicationaddin.cpp:38 +#| msgid "Search All Notes" msgid "Special Notes" msgstr "ખાસ નોંધો" #: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:2 msgid "Show special notes, that are otherwise hidden" -msgstr "ખાસ નોંધોને બતાવો, કે જે નહિંતો છુપાયેલ છે" +msgstr "" #: ../src/addins/statistics/statisticsapplicationaddin.cpp:50 msgid "Show Statistics" @@ -1129,6 +1139,7 @@ #: ../src/addins/statistics/statistics.desktop.in.in.h:1 #: ../src/addins/statistics/statisticswidget.cpp:171 +#| msgid "Status" msgid "Statistics" msgstr "પરિસ્થિતિઓ" @@ -1137,14 +1148,18 @@ msgstr "નોંધો વિશે વિવિધ પરિસ્થિતિઓ બતાવો." #: ../src/addins/statistics/statisticswidget.cpp:91 +#| msgid "All Notes" msgid "Total Notes:" msgstr "કુલ નોંધો:" #: ../src/addins/statistics/statisticswidget.cpp:97 +#| msgid "Notebooks" msgid "Total Notebooks:" msgstr "કુલ નોંધબુકો:" #: ../src/addins/statistics/statisticswidget.cpp:127 +#| msgid "Total: %1% note" +#| msgid_plural "Total: %1% notes" msgid "%1% note" msgid_plural "%1% notes" msgstr[0] "%1% નોંધ" @@ -1193,6 +1208,7 @@ #: ../src/addins/tableofcontents/tableofcontentsaction.cpp:38 #: ../src/addins/tableofcontents/tableofcontents.desktop.in.in.h:1 #: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:66 +#| msgid "Help _Contents" msgid "Table of Contents" msgstr "સમાવિષ્ટોનું કોષ્ટક" @@ -1213,19 +1229,19 @@ #. no toc items, and no action entries = empty menu #: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:140 msgid "(empty table of contents)" -msgstr "(સમાવિષ્ટોની ખાલી કોષ્ટક)" +msgstr "" #: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:155 msgid "Heading 1" -msgstr "મથાળું ૧" +msgstr "" #: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:161 msgid "Heading 2" -msgstr "મથાળું ૨" +msgstr "" #: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:167 msgid "Table of Contents Help" -msgstr "સમાવિષ્ટ મદદનાં કોષ્ટક" +msgstr "" #. namespace #: ../src/addins/todo/todo.desktop.in.in.h:1 @@ -1234,9 +1250,10 @@ #: ../src/addins/todo/todo.desktop.in.in.h:2 msgid "Highlight FIXME, TODO and XXX patterns in notes." -msgstr "નોંધોમાં FIXME, TODO અને XXX ભાતોને પ્રકાશિત કરો." +msgstr "" #: ../src/addins/todo/todo.desktop.in.in.h:3 +#| msgid "Aurimas Černius and Tomboy original authors" msgid "Aurimas Černius, Romain Tartière" msgstr "Aurimas Černius, Romain Tartière" @@ -1313,38 +1330,45 @@ "%1%" #: ../src/addins/webdavsyncservice/webdavsyncservice.desktop.in.in.h:1 +#, fuzzy #| msgid "WebDav Sync Service Add-in" msgid "WebDAV Sync Service Plugin" -msgstr "WebDav સુમેળ સેવા પ્લગઇન" +msgstr "WebDav સુમેળ સેવા ઉમેરો" #: ../src/addins/webdavsyncservice/webdavsyncservice.desktop.in.in.h:2 +#, fuzzy #| msgid "Synchronize Gnote Notes to a WebDav URL" msgid "Synchronize Gnote Notes to a WebDAV URL." -msgstr "WebDav URL માં Gnote નોંધનો સુમેળ કરો." +msgstr "WebDav URL માં Gnote નોંધનો સુમેળ કરો" #: ../src/dbus/remotecontrol-client-glue.cpp:138 #, c-format msgid "Remote call to %s failed" -msgstr "%s માં દૂરસ્થ કોલ નિષ્ફળ" +msgstr "" #: ../src/dbus/remotecontrol.cpp:82 #, c-format msgid "Exception thrown when creating note: %s" -msgstr "અપવાદ ફેંકાયુ જ્યાકે નોંધને બનાવી રહ્યા હોય: %s" +msgstr "" -#: ../src/gnote.cpp:200 +#: ../src/gnote.cpp:198 msgid "Gnote is already running. Exiting..." -msgstr "Gnote પહેલેથી ચાલી રહ્યુ છે. બહાર નીકળી રહ્યા છે..." +msgstr "" -#: ../src/gnote.cpp:365 +#: ../src/gnote.cpp:359 msgid "and Tomboy original authors." msgstr "અને Tomboy મૂળ લેખકો." -#: ../src/gnote.cpp:371 +#: ../src/gnote.cpp:365 msgid "translator-credits" msgstr "શ્ર્વેતા કોઠારી " -#: ../src/gnote.cpp:380 +#: ../src/gnote.cpp:374 +#| msgid "" +#| "Copyright © 2010-2013 Aurimas Cernius\n" +#| "Copyright © 2009-2011 Debarshi Ray\n" +#| "Copyright © 2009 Hubert Figuiere\n" +#| "Copyright © 2004-2009 the Tomboy original authors." msgid "" "Copyright © 2010-2014 Aurimas Cernius\n" "Copyright © 2009-2011 Debarshi Ray\n" @@ -1356,80 +1380,75 @@ "Copyright © 2009 Hubert Figuiere\n" "Copyright © 2004-2009 the Tomboy original authors." -#: ../src/gnote.cpp:384 +#: ../src/gnote.cpp:378 msgid "A simple and easy to use desktop note-taking application." msgstr "ડેસ્કટોપ નોંધ-લેવાનાં કાર્યક્રમને વાપરવાનું સાદુ અને સરળ છે." -#: ../src/gnote.cpp:395 +#: ../src/gnote.cpp:389 msgid "Homepage" msgstr "ઘરપાનું" -#: ../src/gnote.cpp:570 +#: ../src/gnote.cpp:563 msgid "Run Gnote in background." msgstr "પાશ્ર્વભાગમાં Gnote ચલાવો" -#: ../src/gnote.cpp:571 -#| msgid "Run Gnote as a GNOME panel applet." -msgid "Run Gnote as GNOME Shell search provider." -msgstr "GNOME શેલ શોધ પ્રદાતા તરીકે Gnote ને ચલાવો." - -#: ../src/gnote.cpp:572 +#: ../src/gnote.cpp:564 msgid "Specify the path of the directory containing the notes." msgstr "નોંધોને સમાવતી ડિરેક્ટરીનાં પાથને સ્પષ્ટ કરો." -#: ../src/gnote.cpp:572 +#: ../src/gnote.cpp:564 msgid "path" msgstr "પાથ" -#: ../src/gnote.cpp:573 +#: ../src/gnote.cpp:565 msgid "Open the search all notes window with the search text." msgstr "શોધ લખાણ સાથે બધી નોંધો વિન્ડોને શોધવા ખોલો." -#: ../src/gnote.cpp:573 ../src/gnote.cpp:578 +#: ../src/gnote.cpp:565 ../src/gnote.cpp:570 msgid "text" msgstr "લખાણ" -#: ../src/gnote.cpp:574 +#: ../src/gnote.cpp:566 msgid "Print version information." msgstr "આવૃત્તિ જાણકારીને છાપો." -#: ../src/gnote.cpp:575 +#: ../src/gnote.cpp:567 msgid "Create and display a new note, with a optional title." msgstr "વૈકલ્પિક શીર્ષક સાથે નવી નોંધને બનાવો અને દર્શાવો." -#: ../src/gnote.cpp:575 +#: ../src/gnote.cpp:567 msgid "title" msgstr "શીર્ષક" -#: ../src/gnote.cpp:576 +#: ../src/gnote.cpp:568 msgid "Display the existing note matching title." msgstr "હાલની નોંધને બંધબેસતા શીર્ષકને દર્શાવો." -#: ../src/gnote.cpp:576 +#: ../src/gnote.cpp:568 msgid "title/url" msgstr "શીર્ષક/url" -#: ../src/gnote.cpp:577 +#: ../src/gnote.cpp:569 msgid "Display the 'Start Here' note." msgstr "'અહિંયા શરૂ કરો' નોંધને દર્શાવો." -#: ../src/gnote.cpp:578 +#: ../src/gnote.cpp:570 msgid "Search and highlight text in the opened note." msgstr "ખોલેલ નોંધમાં લખાણને શોધો અને પ્રકાશિત કરો." -#: ../src/gnote.cpp:582 +#: ../src/gnote.cpp:574 msgid "A note taking application" msgstr "નોંધ કાર્યક્રમને લઇ રહ્યા છે" -#: ../src/gnote.cpp:582 +#: ../src/gnote.cpp:574 msgid "Gnote options at launch" msgstr "શરૂઆતથી Gnote વિકલ્પો" -#: ../src/gnote.cpp:659 +#: ../src/gnote.cpp:651 msgid "Could not connect to remote instance." -msgstr "દૂરસ્થ સાથે જોડાવાનું શક્ય નથી." +msgstr "" -#: ../src/gnote.cpp:775 +#: ../src/gnote.cpp:767 msgid "Version %1%" msgstr "આવૃત્તિ %1%" @@ -1441,13 +1460,14 @@ #: ../src/noteaddin.cpp:108 ../src/noteaddin.cpp:122 ../src/noteaddin.cpp:135 msgid "Plugin is disposing already" -msgstr "પ્લગઇન પહેલેથી નિકાલ થયેલ છે" +msgstr "" #: ../src/noteaddin.cpp:139 msgid "Window is not embedded" -msgstr "વિન્ડો એમ્બેડ થયેલ છે" +msgstr "" #: ../src/notebooks/createnotebookdialog.cpp:41 +#| msgid "Create a new notebook" msgid "Create Notebook" msgstr "નોંધબુકને બનાવો" @@ -1529,33 +1549,36 @@ msgstr "બધુ" #: ../src/notebooks/specialnotebooks.cpp:75 +#, fuzzy #| msgid "Unfiled Notes" msgid "Unfiled" -msgstr "અરજી ન થયેલ" +msgstr "અરજી ન થયેલ નોંધો" #: ../src/notebooks/specialnotebooks.cpp:106 msgid "Important" msgstr "મહત્વનું" #: ../src/notebooks/specialnotebooks.cpp:133 +#| msgid "Active Notes" msgid "Active" msgstr "સક્રિય" -#: ../src/notebuffer.cpp:1505 +#: ../src/notebuffer.cpp:1498 msgid " tag mismatch" -msgstr " ટૅગ બંધબેસતુ નથી" +msgstr "" -#: ../src/notebuffer.cpp:1584 +#: ../src/notebuffer.cpp:1577 #, c-format msgid "Exception: %s" msgstr "અપવાદ: %s" #. TRANSLATORS: %1% will be replaced by note title #: ../src/note.cpp:59 +#, fuzzy #| msgid "Really delete %1% note?" #| msgid_plural "Really delete %1% notes?" msgid "Really delete \"%1%\"?" -msgstr "ખરેખર %1% કાઢી નાંખો?" +msgstr "ખરેખર %1% નોંધને કાઢી નાંખો?" #. TRANSLATORS: %1% is number of notes #: ../src/note.cpp:63 @@ -1586,23 +1609,23 @@ #: ../src/note.cpp:382 ../src/notebase.cpp:200 #, c-format msgid "Exception while saving note: %s" -msgstr "અપવાદ જ્યારે નોંધને સંગ્રહી રહ્યા હોય: %s" +msgstr "" #: ../src/note.cpp:474 -#, c-format +#, fuzzy, c-format #| msgid "Error saving icon" msgid "Error while saving: %s" -msgstr "જયારે સંગ્રહી રહ્યા હોય ત્યારે ભૂલ: %s" +msgstr "ચિહ્નને સંગ્રહ કરવા દરમ્યાન ભૂલ" #: ../src/note.cpp:699 msgid "Setting text content for closed notes not supported" -msgstr "બંધ થયેલ નોંધો માટે લખાણ સમાવિષ્ટનું સુયોજન આધારભૂત નથી" +msgstr "" #. write failure, but not critical #: ../src/notebase.cpp:444 #, c-format msgid "Failed to update note format: %s" -msgstr "નોંધ બંધારણને સુધારવાનું નિષ્ફળ: %s" +msgstr "" #: ../src/notebase.cpp:568 #, c-format @@ -1686,16 +1709,16 @@ msgstr "Gnote માં કડીઓને વાપરી રહ્યા છે" #: ../src/notemanager.cpp:178 -#, c-format +#, fuzzy, c-format #| msgid "Error printing note" msgid "Error creating start notes: %s" -msgstr "શરૂઆતી નોંધને બનાવી રહ્યા હોય ત્યારે ભૂલ: %s" +msgstr "નોંધને છાપતી વખતે ભૂલ" #. TRANSLATORS: first %s is file, second is error #: ../src/notemanager.cpp:196 #, c-format msgid "Error parsing note XML, skipping \"%s\": %s" -msgstr "નોંધ XML ને પદચ્છેદન કરી રહ્યા હોય ત્યારે ભૂલ, \"%s\" ને છોડી રહ્યા છે: %s" +msgstr "" #: ../src/notemanagerbase.cpp:105 ../src/preferencesdialog.cpp:332 msgid "New Note Template" @@ -1738,14 +1761,19 @@ msgstr "કદી કડીઓનુ નામ બદલો નહિં (_l)" #: ../src/noterenamedialog.cpp:152 +#| msgid "" +#| "Rename links in other notes from \"%1\" " +#| "to\"%2\"?\n" +#| "\n" +#| "If you do not rename the links, they will no longer link to anything." msgid "" "Rename links in other notes from \"%1\" to " "\"%2\"?\n" "\n" "If you do not rename the links, they will no longer link to anything." msgstr "" -"શું \"%1\" થી \"" -"%2\" માં બીજી નોંધોમાં કડીઓનું નામ બદલવા માંગો છો?\n" +"શું \"%1\" થી \"%2\" માં " +"બીજી નોંધોમાં કડીઓનું નામ બદલવા માંગો છો?\n" "\n" "જો તમે કડીઓનું નામ બદલવા માંગતા ન હોય તો, તેઓ કંઇપણમાં કડી લાંબા સમય સુધી રહેશે નહિં." @@ -1779,7 +1807,7 @@ #: ../src/notewindow.cpp:422 msgid "Toggle notes presence in Important Notes notebook" -msgstr "ટૉગલ નોંધ એ મહત્વની નોંધ નોંધબુકમાં હાજર છે" +msgstr "" #: ../src/notewindow.cpp:430 ../src/searchnoteswidget.cpp:144 #: ../src/searchnoteswidget.cpp:147 @@ -1819,6 +1847,7 @@ msgstr "નોંધને બનાવી શકાતુ નથી" #: ../src/notewindow.cpp:827 +#| msgid "Link" msgid "_Link" msgstr "કડી (_L)" @@ -1863,6 +1892,7 @@ msgstr "સામાન્ય" #: ../src/preferencesdialog.cpp:122 +#| msgid "Link" msgid "Links" msgstr "કડીઓ" @@ -1882,22 +1912,24 @@ #: ../src/preferencesdialog.cpp:208 #, c-format msgid "Plugin %s is absent" -msgstr "પ્લગઇન %s ગેરહાજર છે" +msgstr "" #. Status icon #: ../src/preferencesdialog.cpp:247 +#| msgid "Use Status _Icon" msgid "Use status _icon" msgstr "પરિસ્થિતિ ચિહ્નને વાપરો (_i)" #: ../src/preferencesdialog.cpp:248 msgid "Show icon in tray, which is the central place of control." -msgstr "ટ્રેમાં ચિહ્નને બતાવો, કે જે નિયંત્રણનું કેન્દ્રીય સ્થાન છે." +msgstr "" #. Open in new window #: ../src/preferencesdialog.cpp:255 +#, fuzzy #| msgid "Always show this _window" msgid "Always _open notes in new window" -msgstr "હંમેશા નવી વિન્ડોમાં નોંધોને ખોલો (_o)" +msgstr "હંમેશા આ વિન્ડોને બતાવો (_w)" #: ../src/preferencesdialog.cpp:268 msgid "_Spell check while typing" @@ -1916,7 +1948,7 @@ #: ../src/preferencesdialog.cpp:280 msgid "Start new bulleted list by starting new line with character \"-\"." -msgstr "અક્ષર \"-\" સાથે નવાં વાક્યને શરૂ કરીને નવી બુલેટ થયેલ યાદીને શરૂ કરો." +msgstr "" #: ../src/preferencesdialog.cpp:289 msgid "Use custom _font" @@ -1953,16 +1985,16 @@ #. internal links #: ../src/preferencesdialog.cpp:395 msgid "_Automatically link to notes" -msgstr "આપમેળે નોંધને કડી કરો (_A)" +msgstr "" #: ../src/preferencesdialog.cpp:396 msgid "Enable this option to create a link when text matches note title." -msgstr "કડીને બનાવવા માટે આ વિકલ્પને સક્રિય કરો જ્યારે લખાણ નોંધ શીર્ષક સાથે બંધબેસે." +msgstr "" #. URLs #: ../src/preferencesdialog.cpp:402 msgid "Create links for _URLs" -msgstr "URLs માટે કડીઓને બનાવો (_U)" +msgstr "" #: ../src/preferencesdialog.cpp:403 #, fuzzy @@ -1970,8 +2002,8 @@ #| "Enable this option to highlight words ThatLookLikeThis. Clicking the word " #| "will create a note with that name." msgid "" -"Enable this option to create links for URLs. Clicking will open URL with " -"apropriate program." +"Enable this option to create a link for URLs. Clicking will open that URL " +"with apropriate program." msgstr "" "શબ્દો ThatLookLikeThis ને પ્રકાશિત કરવા માટે આ વિકલ્પને સક્રિય કરો. શબ્દ પર ક્લિક " "કરવા દરમ્યાન પેલા નામ સાથે નોંધને બનાવશે." @@ -1991,6 +2023,7 @@ #. Hotkeys... #: ../src/preferencesdialog.cpp:441 +#| msgid "Listen for _Hotkeys" msgid "Listen for _hotkeys" msgstr "ટૂંકી કીઓ માટે સાંભળો (_h)" @@ -2018,11 +2051,10 @@ msgid "Create _new note" msgstr "નવી નોંધ ને બનાવો (_n)" -#. Open Search window keybinding... +#. Open Search All Notes window keybinding... #: ../src/preferencesdialog.cpp:513 -#| msgid "Open Search Dialog" -msgid "Open Search _Window" -msgstr "શોધ વિન્ડોને ખોલો (_W)" +msgid "Open \"Search _All Notes\"" +msgstr "\"બધી નોંધોને શોધો\" ને ખોલો (_A)" #: ../src/preferencesdialog.cpp:553 msgid "Ser_vice:" @@ -2044,9 +2076,10 @@ msgstr "ઉન્નત (_A)..." #: ../src/preferencesdialog.cpp:707 +#, fuzzy #| msgid "The following add-ins are installed" msgid "The following plugins are installed:" -msgstr "નીચેનાં પ્લગઇન સ્થાપિત થયેલ છે:" +msgstr "નીચેનાં ઉમેરાઓ સ્થાપિત કરેલ છે" #. TODO: In a future version, add in an "Install Add-ins..." button #. TODO: In a future version, add in a "Repositories..." button @@ -2083,14 +2116,17 @@ #. label.Xalign = 0; #: ../src/preferencesdialog.cpp:1162 +#| msgid "Always ask me what to do." msgid "Always ask me what to do" msgstr "શું કરવુ છે તે હંમેશા મને પૂછો" #: ../src/preferencesdialog.cpp:1166 +#| msgid "Rename my local note." msgid "Rename my local note" msgstr "મારી સ્થાનિક નોંધનુ નામ બદલો" #: ../src/preferencesdialog.cpp:1170 +#| msgid "Replace my local note with the server's update." msgid "Replace my local note with the server's update" msgstr "સર્વર સુધારા સાથે મારી સ્થાનિક નોંધને બદલો" @@ -2180,7 +2216,7 @@ #: ../src/remotecontrolproxy.cpp:57 #, c-format msgid "Failed to load D-Bus interface %s: %s" -msgstr "D-Bus ઇન્ટરફેસ %s ને લાવવાનું નિષ્ફળ: %s" +msgstr "" #: ../src/searchnoteswidget.cpp:137 msgid "_Open" @@ -2191,6 +2227,7 @@ msgstr "નવી વિન્ડોમાં ખોલો (_W)" #: ../src/searchnoteswidget.cpp:150 +#| msgid "User_name:" msgid "Re_name..." msgstr "નામ બદલો (_n)..." @@ -2234,6 +2271,7 @@ msgstr[1] "%1% બંધબેસવુ" #: ../src/searchnoteswidget.cpp:1311 +#| msgid "_New Note" msgid "_New" msgstr "નવું (_N)" @@ -2242,6 +2280,7 @@ msgstr "ટેમ્પલેટ નોંધને ખોલો (_O)" #: ../src/searchnoteswidget.cpp:1351 +#| msgid "_New notebook..." msgid "_New..." msgstr "નવું (_N)..." @@ -2249,21 +2288,21 @@ #: ../src/searchnoteswidget.cpp:1511 #, c-format msgid "Failed to parse setting %s (Value: %s):" -msgstr "સુયોજન %s (કિંમત: %s) ને પદચ્છેદન કરવામાં નિષ્ફળતા:" +msgstr "" #: ../src/searchnoteswidget.cpp:1488 msgid "Expected format 'column:order'" -msgstr "ઇચ્છિત બંધારણ 'column:order'" +msgstr "" #: ../src/searchnoteswidget.cpp:1501 #, c-format msgid "Unrecognized column %s" -msgstr "બિનઓળખાયેલ સ્તંભ %s" +msgstr "" #: ../src/searchnoteswidget.cpp:1512 #, c-format msgid "Unrecognized order %s" -msgstr "બિનઓળખાયેલ ક્રમ %s" +msgstr "" #: ../src/sharp/addinstreemodel.cpp:109 msgid "Name" @@ -2294,15 +2333,15 @@ msgstr "અજ્ઞાત" #: ../src/sharp/modulemanager.cpp:62 -#, c-format +#, fuzzy, c-format #| msgid "Error saving icon" msgid "Error loading %s" -msgstr "%s ને લાવી રહ્યા હોય ત્યારે ભૂલ" +msgstr "ચિહ્નને સંગ્રહ કરવા દરમ્યાન ભૂલ" #: ../src/sharp/modulemanager.cpp:69 #, c-format msgid "Error getting symbol dynamic_module_instanciate: %s" -msgstr "સંકેત dynamic_module_instanciate ને મેળવી રહ્યા હોય ત્યારે ભૂલ: %s" +msgstr "" #: ../src/sharp/xmlreader.cpp:195 #, c-format @@ -2311,7 +2350,7 @@ #: ../src/sharp/xmlreader.cpp:195 msgid "unknown parse error" -msgstr "અજ્ઞાત પદચ્છેદન ભૂલ" +msgstr "" #: ../src/sharp/xmlwriter.cpp:40 msgid "%1% failed" @@ -2319,7 +2358,7 @@ #: ../src/sharp/xsltransform.cpp:67 msgid "NULL stylesheet, please fill a bug" -msgstr "NULL સ્ટાઇલશીટ, મહેરબાની કરીને ભૂલ અદા કરો" +msgstr "" #: ../src/synchronization/filesystemsyncserver.cpp:369 #, c-format @@ -2329,10 +2368,10 @@ msgstr "" #: ../src/synchronization/filesystemsyncserver.cpp:609 -#, c-format +#, fuzzy, c-format #| msgid "Error connecting to the synchronization service. Please try again." msgid "Error deleting the old synchronization lock \"%s\": %s" -msgstr "જૂનું સુમેળ તાળુ \"%s\" ને કાઢી રહ્યા હોય ત્યારે ભૂલ: %s" +msgstr "સુમેળ સર્વર સાથે જોડાઇ રહ્યા હોય ત્યારે ભૂલ. મહેરબાની કરીને ફરી પ્રયત્ન કરો." #: ../src/synchronization/fusesyncserviceaddin.cpp:115 msgid "" @@ -2370,13 +2409,13 @@ #: ../src/synchronization/gnotesyncclient.cpp:165 #, c-format msgid "Unparsable last-sync-date element in %s" -msgstr "%s માં last-sync-date ઘટકનું પદચ્છેદન કરી શક્યા નથી" +msgstr "" #. TRANSLATORS: %s is file #: ../src/synchronization/gnotesyncclient.cpp:175 #, c-format msgid "Unparsable last-sync-rev element in %s" -msgstr "%s માં પછચ્છેદન ન કરી શકાય તેવું last-sync-rev ઘટક" +msgstr "" #: ../src/synchronization/syncdialog.cpp:64 msgid "Note Conflict" @@ -2584,28 +2623,31 @@ #: ../src/synchronization/syncmanager.cpp:575 #, c-format msgid "Report a bug. Cast failed: %s" -msgstr "ભૂલનો અહેવાલ કરો, કાસ્ટ નિષ્ફળ: %s" +msgstr "" #: ../src/synchronization/syncmanager.cpp:148 #, c-format msgid "Error cleaning up addin after synchronization: %s" -msgstr "સુમેળ પછી એડઇનને સાફ કરી રહયા હોય ત્યારે ભૂલ: %s" +msgstr "" #: ../src/synchronization/syncmanager.cpp:173 #, c-format msgid "Exception while creating SyncServer: %s" -msgstr "અપવાદ જ્યારે SyncServer ને બનાવી રહ્યા હોય: %s" +msgstr "" #. top-level try #: ../src/synchronization/syncmanager.cpp:377 -#, c-format +#, fuzzy, c-format #| msgid "" #| "Saving configuration to the GNOME keyring failed with the following " #| "message:\n" #| "\n" #| "%1%" msgid "Synchronization failed with the following exception: %s" -msgstr "નીચેનાં અપવાદ સાથે સુમેળતા નિષ્ફળ: %s" +msgstr "" +"નીચેનાં સંદેશા સાથે GNOME કીરીંગમાં રૂપરેખાંકનને સંગ્રહ કરવાનું નિષ્ફળ:\n" +"\n" +"%1%" #: ../src/synchronization/syncutils.cpp:148 #: ../src/synchronization/syncutils.cpp:180 @@ -2702,6 +2744,8 @@ #. TRANSLATORS: first argument is date, second is time. #: ../src/utils.cpp:237 ../src/utils.cpp:249 +#| msgid "In %1% day, %2%" +#| msgid_plural "In %1% days, %2%" msgid "%1%, %2%" msgstr "%1%, %2%" @@ -2711,6 +2755,7 @@ #. TRANSLATORS: date in other than current year. #: ../src/utils.cpp:246 +#| msgid "%A, %B %d %Y" msgid "%b %d %Y" msgstr "%b %d %Y" @@ -2748,9 +2793,6 @@ msgid "_Open Link" msgstr "કડીને ખોલો (_O)" -#~ msgid "Open \"Search _All Notes\"" -#~ msgstr "\"બધી નોંધોને શોધો\" ને ખોલો (_A)" - #~ msgid "Saved horizontal position of Search window" #~ msgstr "શોધ વિન્ડોની સંગ્રહ થયેલ આડુ સ્થાન" @@ -2908,6 +2950,9 @@ #~ msgid "_Tools" #~ msgstr "સાધનો (_T)" +#~ msgid "Run Gnote as a GNOME panel applet." +#~ msgstr "GNOME પેનલ એપલેટ તરીકે Gnote ને ચલાવો." + #~ msgid "Accessories" #~ msgstr "સહાયક સામગ્રી" diff -Nru gnote-3.14.2/po/hu.po gnote-3.16.0/po/hu.po --- gnote-3.14.2/po/hu.po 2015-01-17 12:53:24.000000000 +0000 +++ gnote-3.16.0/po/hu.po 2015-03-07 18:13:28.000000000 +0000 @@ -7,15 +7,15 @@ # Kalman Kemenczy , 2006. # Balint Laza , 2008. # István Nyitrai , 2009. -# Balázs Úr , 2011, 2012, 2013, 2014. # Lukács Bence , 2012. +# Balázs Úr , 2011, 2012, 2013, 2014, 2015. msgid "" msgstr "" "Project-Id-Version: gnote master\n" "Report-Msgid-Bugs-To: http://bugzilla.gnome.org/enter_bug.cgi?" "product=gnote&keywords=I18N+L10N&component=general\n" -"POT-Creation-Date: 2014-12-21 21:22+0000\n" -"PO-Revision-Date: 2014-12-22 00:38+0100\n" +"POT-Creation-Date: 2015-01-18 09:19+0000\n" +"PO-Revision-Date: 2015-01-18 19:08+0100\n" "Last-Translator: Balázs Úr \n" "Language-Team: Hungarian \n" "Language: hu\n" @@ -340,15 +340,8 @@ msgstr "Állapotikon használata alkalmazásként való indításkor" #: ../data/org.gnome.gnote.gschema.xml.in.h:50 -msgid "" -"Has affect only when started as an application. When set to TRUE, shows a " -"status icon. If set to FALSE, Search All Notes window is used as main " -"application window, closing which makes application to exit." -msgstr "" -"Csak alkalmazásként való indításkor van hatása. Ha igazra van állítva, akkor " -"megjeleníti az állapotikont. Ha hamisra van állítva, akkor a Keresés minden " -"jegyzetben ablak lesz a fő alkalmazásablak, és bezárása bezárja az " -"alkalmazást." +msgid "Deprecated, has no effect" +msgstr "Elavult, nincs hatása" #: ../data/org.gnome.gnote.gschema.xml.in.h:51 msgid "Open notes in new window" @@ -381,117 +374,41 @@ msgstr "Kisalkalmazás menü mutatása" #: ../data/org.gnome.gnote.gschema.xml.in.h:56 -msgid "" -"The global keybinding for showing the Gnote applet's menu. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such " -"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " -"special string \"disabled\", then there will be no keybinding for this " -"action." -msgstr "" -"A Gnote kisalkalmazás menüjének mutatásához rendelt globális gyorsbillentyű. " -"A formátum: „<Control>a” vagy „<Shift><Alt>F1”. A " -"feldolgozás elég liberális, megengedi kis- vagy nagybetűk használatát és " -"rövidítéseket is, mint például: „<Ctl>” és „<Ctrl>”. Ha ezt az " -"opciót „disabled” értékűre állítja, nem lesz billentyű hozzárendelve ehhez a " -"művelethez." +msgid "Deprecated, has no effect." +msgstr "Elavult, nincs hatása." #: ../data/org.gnome.gnote.gschema.xml.in.h:57 msgid "Open Start Here" msgstr "„Kezdje itt!” megnyitása" #: ../data/org.gnome.gnote.gschema.xml.in.h:58 -msgid "" -"The global keybinding for opening the \"Start Here\" note. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such " -"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " -"special string \"disabled\", then there will be no keybinding for this " -"action." -msgstr "" -"A „Kezdje itt!” jegyzet megnyitásához rendelt globális gyorsbillentyű. A " -"formátum: „<Control>a” vagy „<Shift><Alt>F1”. A " -"feldolgozás elég liberális, megengedi kis- vagy nagybetűk használatát és " -"rövidítéseket is, mint például: „<Ctl>” és „<Ctrl>”. Ha ezt az " -"opciót „disabled” értékűre állítja, nem lesz billentyű hozzárendelve ehhez a " -"művelethez." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:59 msgid "Create a new Note" msgstr "Új jegyzet létrehozása" -#: ../data/org.gnome.gnote.gschema.xml.in.h:60 -msgid "" -"The global keybinding for creating and displaying a new Note. The format " -"looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " -"parser is fairly liberal and allows lower or upper case, and also " -"abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the " -"option to the special string \"disabled\", then there will be no keybinding " -"for this action." -msgstr "" -"Az új jegyzet létrehozásához és megnyitásához rendelt globális " -"gyorsbillentyű. A formátum: „<Control>a” vagy „<Shift><Alt>" -"F1”. A feldolgozás elég liberális, megengedi kis- vagy nagybetűk használatát " -"és rövidítéseket is, mint például: „<Ctl>” és „<Ctrl>”. Ha ezt " -"az opciót „disabled” értékűre állítja, nem lesz billentyű hozzárendelve " -"ehhez a művelethez." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:61 +#: ../data/org.gnome.gnote.gschema.xml.in.h:59 msgid "Open Search Dialog" msgstr "Keresési párbeszédablak megnyitása" -#: ../data/org.gnome.gnote.gschema.xml.in.h:62 -msgid "" -"The global keybinding for opening the Note Search dialog. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such " -"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " -"special string \"disabled\", then there will be no keybinding for this " -"action." -msgstr "" -"A Jegyzet keresése párbeszédablak megnyitásához rendelt globális " -"gyorsbillentyű. A formátum: „<Control>a” vagy „<Shift><Alt>" -"F1”. A feldolgozás elég liberális, megengedi kis- vagy nagybetűk használatát " -"és rövidítéseket is, mint például: „<Ctl>” és „<Ctrl>”. Ha ezt " -"az opciót „disabled” értékűre állítja, nem lesz billentyű hozzárendelve " -"ehhez a művelethez." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:63 +#: ../data/org.gnome.gnote.gschema.xml.in.h:60 msgid "Open Recent Changes" msgstr "Legutóbbi változások megnyitása" -#: ../data/org.gnome.gnote.gschema.xml.in.h:64 -msgid "" -"The global keybinding for opening the Recent Changes dialog. The format " -"looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " -"parser is fairly liberal and allows lower or upper case, and also " -"abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the " -"option to the special string \"disabled\", then there will be no keybinding " -"for this action." -msgstr "" -"A Legutóbbi változások párbeszédablak megnyitásához rendelt globális " -"gyorsbillentyű. A formátum: „<Control>a” vagy „<Shift><Alt>" -"F1”. A feldolgozás elég liberális, megengedi kis- vagy nagybetűk használatát " -"és rövidítéseket is, mint például: „<Ctl>” és „<Ctrl>”. Ha ezt " -"az opciót „disabled” értékűre állítja, nem lesz billentyű hozzárendelve " -"ehhez a művelethez." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:65 +#: ../data/org.gnome.gnote.gschema.xml.in.h:61 msgid "HTML Export Last Directory" msgstr "Utolsó HTML-be exportálás könyvtára" -#: ../data/org.gnome.gnote.gschema.xml.in.h:66 +#: ../data/org.gnome.gnote.gschema.xml.in.h:62 msgid "" "The last directory a note was exported to using the Export To HTML plugin." msgstr "" "A HTML-be exportálás bővítménnyel jegyzet exportálására legutóbb használt " "könyvtár." -#: ../data/org.gnome.gnote.gschema.xml.in.h:67 +#: ../data/org.gnome.gnote.gschema.xml.in.h:63 msgid "HTML Export Linked Notes" msgstr "Hivatkozott jegyzetek exportálása HTML-be" -#: ../data/org.gnome.gnote.gschema.xml.in.h:68 +#: ../data/org.gnome.gnote.gschema.xml.in.h:64 msgid "" "The last setting for the 'Export linked notes' checkbox in the Export to " "HTML plugin." @@ -499,11 +416,11 @@ "A „Hivatkozott jegyzetek exportálása” jelölőnégyzet utolsó állapota a HTML-" "be exportálás bővítményen." -#: ../data/org.gnome.gnote.gschema.xml.in.h:69 +#: ../data/org.gnome.gnote.gschema.xml.in.h:65 msgid "HTML Export All Linked Notes" msgstr "Hivatkozott jegyzetek exportálása HTML-be" -#: ../data/org.gnome.gnote.gschema.xml.in.h:70 +#: ../data/org.gnome.gnote.gschema.xml.in.h:66 msgid "" "The last setting for the 'Include all other linked notes' checkbox in the " "Export to HTML plugin. This setting is used in conjunction with the 'HTML " @@ -515,14 +432,11 @@ "exportálása HTML-be” beállítással együtt használandó annak megadására, hogy " "HTML-be exportáláskor a rekurzívan megtalált jegyzeteket fel kell-e venni." -#: ../data/org.gnome.gnote.gschema.xml.in.h:71 +#: ../data/org.gnome.gnote.gschema.xml.in.h:67 msgid "Synchronization Client ID" msgstr "Szinkronizációs kliens azonosítója" -#: ../data/org.gnome.gnote.gschema.xml.in.h:72 -#| msgid "" -#| "Unique identifier for this Gnote client, used when communicating with a " -#| "sychronization server." +#: ../data/org.gnome.gnote.gschema.xml.in.h:68 msgid "" "Unique identifier for this Gnote client, used when communicating with a " "synchronization server." @@ -530,11 +444,11 @@ "Ezen Gnote kliens szinkronizációs kiszolgálóval való kommunikációban " "használt egyedi azonosítója." -#: ../data/org.gnome.gnote.gschema.xml.in.h:73 +#: ../data/org.gnome.gnote.gschema.xml.in.h:69 msgid "Synchronization Local Server Path" msgstr "Helyi szinkronizációs kiszolgáló útvonala" -#: ../data/org.gnome.gnote.gschema.xml.in.h:74 +#: ../data/org.gnome.gnote.gschema.xml.in.h:70 msgid "" "Path to the synchronization server when using the filesystem synchronization " "service addin." @@ -542,11 +456,11 @@ "A fájlrendszer-szinkronizációs szolgáltatásbővítményhez használandó " "szinkronizációs kiszolgáló útvonala." -#: ../data/org.gnome.gnote.gschema.xml.in.h:75 +#: ../data/org.gnome.gnote.gschema.xml.in.h:71 msgid "Selected Synchronization Service Addin" msgstr "Kijelölt szinkronizációs szolgáltatás bővítmény" -#: ../data/org.gnome.gnote.gschema.xml.in.h:76 +#: ../data/org.gnome.gnote.gschema.xml.in.h:72 msgid "" "Unique identifier for the currently configured note synchronization service " "addin." @@ -554,11 +468,11 @@ "A jelenleg beállított jegyzetszinkronizációs szolgáltatás bővítmény egyedi " "azonosítója." -#: ../data/org.gnome.gnote.gschema.xml.in.h:77 +#: ../data/org.gnome.gnote.gschema.xml.in.h:73 msgid "Note Synchronization Conflict Saved Behavior" msgstr "Jegyzetszinkronizálási ütközés mentett viselkedése" -#: ../data/org.gnome.gnote.gschema.xml.in.h:78 +#: ../data/org.gnome.gnote.gschema.xml.in.h:74 msgid "" "Integer value indicating if there is a preference to always perform a " "specific behavior when a conflict is detected, instead of prompting the " @@ -571,11 +485,11 @@ "felsorolásra kerülnek leképezésre. A 0 esetén a felhasználó ütközések esetén " "értesítést kér, így azokat külön-külön kezelheti." -#: ../data/org.gnome.gnote.gschema.xml.in.h:79 +#: ../data/org.gnome.gnote.gschema.xml.in.h:75 msgid "Automatic Background Synchronization Timeout" msgstr "Automatikus háttér-szinkronizálás időkorlátja" -#: ../data/org.gnome.gnote.gschema.xml.in.h:80 +#: ../data/org.gnome.gnote.gschema.xml.in.h:76 msgid "" "Integer value indicating how frequently to perform a background sync of your " "notes (when sync is configured). Any value less than 1 indicates that " @@ -587,11 +501,11 @@ "szinkronizálás kikapcsolt állapotát jelzi. A legkisebb elfogadható érték az " "5. Az érték percekben értendő." -#: ../data/org.gnome.gnote.gschema.xml.in.h:81 +#: ../data/org.gnome.gnote.gschema.xml.in.h:77 msgid "Accept SSL Certificates" msgstr "SSL tanúsítványok elfogadása" -#: ../data/org.gnome.gnote.gschema.xml.in.h:82 +#: ../data/org.gnome.gnote.gschema.xml.in.h:78 msgid "" "Use wdfs option \"-ac\" to accept SSL certificates without prompting the " "user." @@ -599,37 +513,37 @@ "A „-ac” wdfs kapcsoló használata SSL tanúsítványok elfogadására a " "felhasználó megkérdezése nélkül." -#: ../data/org.gnome.gnote.gschema.xml.in.h:83 +#: ../data/org.gnome.gnote.gschema.xml.in.h:79 msgid "Share URL" msgstr "Megosztási URL" -#: ../data/org.gnome.gnote.gschema.xml.in.h:84 +#: ../data/org.gnome.gnote.gschema.xml.in.h:80 msgid "WebDAV share URL where notes are synchronized to." msgstr "WebDAV megosztás, ahova a jegyzetek szinkronizálásra kerülnek." -#: ../data/org.gnome.gnote.gschema.xml.in.h:85 +#: ../data/org.gnome.gnote.gschema.xml.in.h:81 msgid "Share username" msgstr "Megosztás felhasználóneve" -#: ../data/org.gnome.gnote.gschema.xml.in.h:86 +#: ../data/org.gnome.gnote.gschema.xml.in.h:82 msgid "Username to access WebDAV share." msgstr "Felhasználónév a WebDAV megosztás eléréséhez." -#: ../data/org.gnome.gnote.gschema.xml.in.h:87 +#: ../data/org.gnome.gnote.gschema.xml.in.h:83 msgid "Timestamp format" msgstr "Időbélyeg formátuma" -#: ../data/org.gnome.gnote.gschema.xml.in.h:88 +#: ../data/org.gnome.gnote.gschema.xml.in.h:84 msgid "" "The date format that is used for the timestamp. It follows the format of " "strftime(3)." msgstr "Az időbélyeghez használt dátumformátum." -#: ../data/org.gnome.gnote.gschema.xml.in.h:89 +#: ../data/org.gnome.gnote.gschema.xml.in.h:85 msgid "Time between checks" msgstr "Ellenőrzések közötti idő" -#: ../data/org.gnome.gnote.gschema.xml.in.h:90 +#: ../data/org.gnome.gnote.gschema.xml.in.h:86 msgid "" "Time interval between note directory checks (in seconds). Min value is 5." msgstr "" @@ -637,7 +551,6 @@ "érték 5." #: ../src/actionmanager.cpp:84 ../src/actionmanager.cpp:171 -#: ../src/tray.cpp:465 msgid "_Quit" msgstr "_Kilépés" @@ -646,7 +559,6 @@ msgstr "Kilépés a Gnote-ból" #: ../src/actionmanager.cpp:89 ../src/actionmanager.cpp:168 -#: ../src/tray.cpp:448 msgid "_Preferences" msgstr "_Beállítások" @@ -674,19 +586,19 @@ msgid "TrayIcon" msgstr "Tálcaikon" -#: ../src/actionmanager.cpp:107 ../src/tray.cpp:225 +#: ../src/actionmanager.cpp:107 msgid "Create _New Note" msgstr "Ú_j jegyzet" -#: ../src/actionmanager.cpp:107 ../src/tray.cpp:227 +#: ../src/actionmanager.cpp:107 msgid "Create a new note" msgstr "Új jegyzet létrehozása" -#: ../src/actionmanager.cpp:112 ../src/tray.cpp:234 +#: ../src/actionmanager.cpp:112 msgid "_Search All Notes" msgstr "Keresés _minden jegyzetben" -#: ../src/actionmanager.cpp:112 ../src/tray.cpp:236 +#: ../src/actionmanager.cpp:112 msgid "Open the Search All Notes window" msgstr "A Keresés minden jegyzetben ablak megnyitása" @@ -698,7 +610,7 @@ msgid "New _Window" msgstr "Új _ablak" -#: ../src/actionmanager.cpp:169 ../src/tray.cpp:453 +#: ../src/actionmanager.cpp:169 msgid "_Help" msgstr "_Súgó" @@ -1044,10 +956,6 @@ msgstr "" "NoteDirectoryWatcher: Frissítés megszakítva, hiba a(z) %s feldolgozásakor: %s" -#: ../src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp:35 -msgid "_Directory check interval:" -msgstr "_Könyvtár-ellenőrzés gyakorisága:" - #: ../src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in.in.h:1 msgid "Note Directory Watcher" msgstr "Jegyzetkönyvtár-figyelő" @@ -1060,6 +968,10 @@ msgid "Aurimas Černius and Tomboy original authors" msgstr "Aurimas Černius és a Tomboy eredeti szerzői" +#: ../src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp:35 +msgid "_Directory check interval:" +msgstr "_Könyvtár-ellenőrzés gyakorisága:" + #: ../src/addins/noteoftheday/noteoftheday.cpp:33 msgid "Today: Template" msgstr "Ma: Sablon" @@ -1171,8 +1083,8 @@ msgid "Pierre-Yves Luyten" msgstr "Pierre-Yves Luyten" -#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:1 #: ../src/addins/specialnotes/specialnotesapplicationaddin.cpp:38 +#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:1 msgid "Special Notes" msgstr "Speciális jegyzetek" @@ -1390,15 +1302,15 @@ msgid "Exception thrown when creating note: %s" msgstr "Kivétel történt a jegyzet létrehozásakor: %s" -#: ../src/gnote.cpp:200 +#: ../src/gnote.cpp:185 msgid "Gnote is already running. Exiting..." msgstr "A Gnote már fut, kilépés." -#: ../src/gnote.cpp:365 +#: ../src/gnote.cpp:289 msgid "and Tomboy original authors." msgstr "és a Tomboy eredeti szerzői." -#: ../src/gnote.cpp:371 +#: ../src/gnote.cpp:295 msgid "translator-credits" msgstr "" "Kelemen Gábor \n" @@ -1408,91 +1320,96 @@ "István Nyitrai \n" "Balázs Úr " -#: ../src/gnote.cpp:380 +#: ../src/gnote.cpp:304 +#| msgid "" +#| "Copyright © 2010-2014 Aurimas Cernius\n" +#| "Copyright © 2009-2011 Debarshi Ray\n" +#| "Copyright © 2009 Hubert Figuiere\n" +#| "Copyright © 2004-2009 the Tomboy original authors." msgid "" -"Copyright © 2010-2014 Aurimas Cernius\n" +"Copyright © 2010-2015 Aurimas Cernius\n" "Copyright © 2009-2011 Debarshi Ray\n" "Copyright © 2009 Hubert Figuiere\n" "Copyright © 2004-2009 the Tomboy original authors." msgstr "" -"Copyright © 2010-2014 Aurimas Cernius\n" +"Copyright © 2010-2015 Aurimas Cernius\n" "Copyright © 2009-2011 Debarshi Ray\n" "Copyright © 2009 Hubert Figuiere\n" "Copyright © 2004-2009 a Tomboy eredeti szerzői." -#: ../src/gnote.cpp:384 +#: ../src/gnote.cpp:308 msgid "A simple and easy to use desktop note-taking application." msgstr "Egyszerű és könnyen használható asztali jegyzetkezelő alkalmazás." -#: ../src/gnote.cpp:395 +#: ../src/gnote.cpp:319 msgid "Homepage" msgstr "Honlap" -#: ../src/gnote.cpp:570 +#: ../src/gnote.cpp:494 msgid "Run Gnote in background." msgstr "A Gnote futtatása a háttérben." -#: ../src/gnote.cpp:571 +#: ../src/gnote.cpp:495 msgid "Run Gnote as GNOME Shell search provider." msgstr "A Gnote futtatása GNOME parancsértelmező keresőszolgáltatóként." -#: ../src/gnote.cpp:572 +#: ../src/gnote.cpp:496 msgid "Specify the path of the directory containing the notes." msgstr "Adja meg a jegyzeteket tartalmazó könyvtár útvonalát." -#: ../src/gnote.cpp:572 +#: ../src/gnote.cpp:496 msgid "path" msgstr "útvonal" -#: ../src/gnote.cpp:573 +#: ../src/gnote.cpp:497 msgid "Open the search all notes window with the search text." msgstr "A Keresés minden jegyzetben ablak megnyitása a keresőkifejezéssel." -#: ../src/gnote.cpp:573 ../src/gnote.cpp:578 +#: ../src/gnote.cpp:497 ../src/gnote.cpp:502 msgid "text" msgstr "szöveg" -#: ../src/gnote.cpp:574 +#: ../src/gnote.cpp:498 msgid "Print version information." msgstr "Verzióinformációk kiírása." -#: ../src/gnote.cpp:575 +#: ../src/gnote.cpp:499 msgid "Create and display a new note, with a optional title." msgstr "Új jegyzet létrehozása és megjelenítése, elhagyható címmel." -#: ../src/gnote.cpp:575 +#: ../src/gnote.cpp:499 msgid "title" msgstr "cím" -#: ../src/gnote.cpp:576 +#: ../src/gnote.cpp:500 msgid "Display the existing note matching title." msgstr "Az illeszkedő című meglévő jegyzet megjelenítése." -#: ../src/gnote.cpp:576 +#: ../src/gnote.cpp:500 msgid "title/url" msgstr "cím/url" -#: ../src/gnote.cpp:577 +#: ../src/gnote.cpp:501 msgid "Display the 'Start Here' note." msgstr "A „Kezdje itt” jegyzet megjelenítése." -#: ../src/gnote.cpp:578 +#: ../src/gnote.cpp:502 msgid "Search and highlight text in the opened note." msgstr "Szöveg keresése és kiemelése megnyitott jegyzetben." -#: ../src/gnote.cpp:582 +#: ../src/gnote.cpp:506 msgid "A note taking application" msgstr "Jegyzetkezelő alkalmazás" -#: ../src/gnote.cpp:582 +#: ../src/gnote.cpp:506 msgid "Gnote options at launch" msgstr "A Gnote indítási kapcsolói" -#: ../src/gnote.cpp:659 +#: ../src/gnote.cpp:583 msgid "Could not connect to remote instance." msgstr "Nem lehet kapcsolódni a távoli példányhoz." -#: ../src/gnote.cpp:775 +#: ../src/gnote.cpp:699 msgid "Version %1%" msgstr "%1% verzió" @@ -1510,6 +1427,23 @@ msgid "Window is not embedded" msgstr "Az ablak nincs beágyazva" +#. Probably IOException or UnauthorizedAccessException? +#: ../src/notebase.cpp:200 ../src/note.cpp:382 +#, c-format +msgid "Exception while saving note: %s" +msgstr "Kivétel a jegyzet mentésekor: %s" + +#. write failure, but not critical +#: ../src/notebase.cpp:444 +#, c-format +msgid "Failed to update note format: %s" +msgstr "A jegyzet formátumának frissítése sikertelen: %s" + +#: ../src/notebase.cpp:568 +#, c-format +msgid "Filesystem error: %s" +msgstr "Fájlrendszerhiba: %s" + #: ../src/notebooks/createnotebookdialog.cpp:41 msgid "Create Notebook" msgstr "Jegyzettömb létrehozása" @@ -1643,12 +1577,6 @@ "lemezterület és rendelkezik jogosultságokkal a ~/.local/share/gnote könyvtár " "írásához. A hiba részletei a ~/.gnote.log fájlban találhatók." -#. Probably IOException or UnauthorizedAccessException? -#: ../src/note.cpp:382 ../src/notebase.cpp:200 -#, c-format -msgid "Exception while saving note: %s" -msgstr "Kivétel a jegyzet mentésekor: %s" - #: ../src/note.cpp:474 #, c-format msgid "Error while saving: %s" @@ -1658,16 +1586,13 @@ msgid "Setting text content for closed notes not supported" msgstr "A szövegtartalom beállítása nem támogatott a zárolt jegyzetekhez" -#. write failure, but not critical -#: ../src/notebase.cpp:444 -#, c-format -msgid "Failed to update note format: %s" -msgstr "A jegyzet formátumának frissítése sikertelen: %s" +#: ../src/notemanagerbase.cpp:105 ../src/preferencesdialog.cpp:320 +msgid "New Note Template" +msgstr "Új jegyzet sablon" -#: ../src/notebase.cpp:568 -#, c-format -msgid "Filesystem error: %s" -msgstr "Fájlrendszerhiba: %s" +#: ../src/notemanagerbase.cpp:359 +msgid "Describe your new note here." +msgstr "Ide írhatja a jegyzet tartalmát." #: ../src/notemanager.cpp:133 msgid "" @@ -1759,14 +1684,6 @@ msgid "Error parsing note XML, skipping \"%s\": %s" msgstr "Hiba a jegyzet XML feldolgozásakor, „%s” kihagyása: %s" -#: ../src/notemanagerbase.cpp:105 ../src/preferencesdialog.cpp:332 -msgid "New Note Template" -msgstr "Új jegyzet sablon" - -#: ../src/notemanagerbase.cpp:359 -msgid "Describe your new note here." -msgstr "Ide írhatja a jegyzet tartalmát." - #: ../src/noterenamedialog.cpp:123 msgid "Rename Note Links?" msgstr "Átnevezi a jegyzet hivatkozásait?" @@ -1878,47 +1795,47 @@ msgid "Save _Title" msgstr "_Cím mentése" -#: ../src/notewindow.cpp:562 ../src/notewindow.cpp:1084 +#: ../src/notewindow.cpp:562 ../src/notewindow.cpp:1085 msgid "Cannot create note" msgstr "Nem hozható létre jegyzet" -#: ../src/notewindow.cpp:827 +#: ../src/notewindow.cpp:828 msgid "_Link" msgstr "_Hivatkozás" -#: ../src/notewindow.cpp:828 +#: ../src/notewindow.cpp:829 msgid "_Bold" msgstr "_Félkövér" -#: ../src/notewindow.cpp:829 +#: ../src/notewindow.cpp:830 msgid "_Italic" msgstr "_Dőlt" -#: ../src/notewindow.cpp:830 +#: ../src/notewindow.cpp:831 msgid "_Strikeout" msgstr "Á_thúzott" -#: ../src/notewindow.cpp:832 +#: ../src/notewindow.cpp:833 msgid "_Highlight" msgstr "_Kiemelés" -#: ../src/notewindow.cpp:834 +#: ../src/notewindow.cpp:835 msgid "_Normal" msgstr "N_ormál" -#: ../src/notewindow.cpp:836 +#: ../src/notewindow.cpp:837 msgid "Hu_ge" msgstr "Óriá_si" -#: ../src/notewindow.cpp:838 +#: ../src/notewindow.cpp:839 msgid "_Large" msgstr "_Nagy" -#: ../src/notewindow.cpp:840 +#: ../src/notewindow.cpp:841 msgid "S_mall" msgstr "Ki_csi" -#: ../src/notewindow.cpp:842 +#: ../src/notewindow.cpp:843 msgid "Bullets" msgstr "Felsorolás" @@ -1930,43 +1847,30 @@ msgid "Links" msgstr "Hivatkozások" -#: ../src/preferencesdialog.cpp:125 -msgid "Hotkeys" -msgstr "Gyorsbillentyűk" - #. TRANSLATORS: Addin category. -#: ../src/preferencesdialog.cpp:129 ../src/sharp/addinstreemodel.cpp:164 +#: ../src/preferencesdialog.cpp:125 ../src/sharp/addinstreemodel.cpp:164 msgid "Synchronization" msgstr "Szinkronizálás" -#: ../src/preferencesdialog.cpp:131 +#: ../src/preferencesdialog.cpp:127 msgid "Plugins" msgstr "Bővítmények" -#: ../src/preferencesdialog.cpp:208 +#: ../src/preferencesdialog.cpp:204 #, c-format msgid "Plugin %s is absent" msgstr "%s bővítmény hiányzik" -#. Status icon -#: ../src/preferencesdialog.cpp:247 -msgid "Use status _icon" -msgstr "Áll_apotikon használata" - -#: ../src/preferencesdialog.cpp:248 -msgid "Show icon in tray, which is the central place of control." -msgstr "Ikon megjelenítése a tálcán, amely a felügyelet központi helye." - #. Open in new window -#: ../src/preferencesdialog.cpp:255 +#: ../src/preferencesdialog.cpp:243 msgid "Always _open notes in new window" msgstr "Min_dig új ablakban jelenjenek meg a jegyzetek" -#: ../src/preferencesdialog.cpp:268 +#: ../src/preferencesdialog.cpp:256 msgid "_Spell check while typing" msgstr "_Helyesírás-ellenőrzés gépelés közben" -#: ../src/preferencesdialog.cpp:269 +#: ../src/preferencesdialog.cpp:257 msgid "" "Misspellings will be underlined in red, with correct spelling suggestions " "shown in the context menu." @@ -1975,35 +1879,35 @@ "felbukkanó menüben jelennek meg." #. Auto bulleted list -#: ../src/preferencesdialog.cpp:279 +#: ../src/preferencesdialog.cpp:267 msgid "Enable auto-_bulleted lists" msgstr "A_utomatikusan felsorolásjelezett listák engedélyezése" -#: ../src/preferencesdialog.cpp:280 +#: ../src/preferencesdialog.cpp:268 msgid "Start new bulleted list by starting new line with character \"-\"." msgstr "Kezdjen új felsorolásos listát az új sort „-” karakterrel kezdve." -#: ../src/preferencesdialog.cpp:289 +#: ../src/preferencesdialog.cpp:277 msgid "Use custom _font" msgstr "_Egyéni betűkészlet használata" -#: ../src/preferencesdialog.cpp:307 +#: ../src/preferencesdialog.cpp:295 msgid "When renaming a linked note: " msgstr "Hivatkozott jegyzet átnevezésekor: " -#: ../src/preferencesdialog.cpp:311 +#: ../src/preferencesdialog.cpp:299 msgid "Ask me what to do" msgstr "Mindig kérdezzen" -#: ../src/preferencesdialog.cpp:312 +#: ../src/preferencesdialog.cpp:300 msgid "Never rename links" msgstr "Soha ne nevezze át a hivatkozásokat" -#: ../src/preferencesdialog.cpp:313 +#: ../src/preferencesdialog.cpp:301 msgid "Always rename links" msgstr "Mindig nevezze át a hivatkozásokat" -#: ../src/preferencesdialog.cpp:333 +#: ../src/preferencesdialog.cpp:321 msgid "" "Use the new note template to specify the text that should be used when " "creating a new note." @@ -2011,30 +1915,27 @@ "Az új jegyzet sablon segítségével megadható az új jegyzet létrehozásakor " "használandó szöveg." -#: ../src/preferencesdialog.cpp:338 +#: ../src/preferencesdialog.cpp:326 msgid "Open New Note Template" msgstr "Új jegyzet sablon megnyitása" #. internal links -#: ../src/preferencesdialog.cpp:395 +#: ../src/preferencesdialog.cpp:383 msgid "_Automatically link to notes" msgstr "Automatikus _hivatkozás a jegyzetekre" -#: ../src/preferencesdialog.cpp:396 +#: ../src/preferencesdialog.cpp:384 msgid "Enable this option to create a link when text matches note title." msgstr "" "Kapcsolja be hivatkozás létrehozásához, amikor a szöveg megegyezik egy " "jegyzet nevével." #. URLs -#: ../src/preferencesdialog.cpp:402 +#: ../src/preferencesdialog.cpp:390 msgid "Create links for _URLs" msgstr "Hivatkozások létrehozása _URL-ekhez" -#: ../src/preferencesdialog.cpp:403 -#| msgid "" -#| "Enable this option to create links for URLs. Clicking will open URL with " -#| "apropriate program." +#: ../src/preferencesdialog.cpp:391 msgid "" "Enable this option to create links for URLs. Clicking will open URL with " "appropriate program." @@ -2043,11 +1944,11 @@ "kattintás az URL-re megnyitja azt a megfelelő programmal." #. WikiWords... -#: ../src/preferencesdialog.cpp:410 +#: ../src/preferencesdialog.cpp:398 msgid "Highlight _WikiWords" msgstr "_Wiki-szavak kiemelése" -#: ../src/preferencesdialog.cpp:411 +#: ../src/preferencesdialog.cpp:399 msgid "" "Enable this option to highlight words ThatLookLikeThis. Clicking the " "word will create a note with that name." @@ -2055,90 +1956,55 @@ "Engedélyezze ezt az opciót az IlyenAlakú szavak kiemeléséhez. Egy " "kattintás a szóra új jegyzetet hoz létre, ezzel a névvel." -#. Hotkeys... -#: ../src/preferencesdialog.cpp:441 -msgid "Listen for _hotkeys" -msgstr "_Gyorsbillentyűk figyelése" - -#: ../src/preferencesdialog.cpp:442 -msgid "" -"Hotkeys allow you to quickly access your notes from anywhere with a " -"keypress. Example Hotkeys: <Control><Shift>F11, <" -"Alt>N" -msgstr "" -"A gyorsbillentyűk segítségével bárhonnan gyorsan elérheti jegyzeteit egy " -"gombnyomással. Példa gyorsbillentyűk: <Control><Shift>F11, <Alt>N" - -#. Show notes menu keybinding... -#: ../src/preferencesdialog.cpp:464 -msgid "Show notes _menu" -msgstr "Jegyzetek menü _mutatása" - -#. Open Start Here keybinding... -#: ../src/preferencesdialog.cpp:481 -msgid "Open \"_Start Here\"" -msgstr "„_Kezdje itt!” megnyitása" - -#. Create new note keybinding... -#: ../src/preferencesdialog.cpp:497 -msgid "Create _new note" -msgstr "Ú_j jegyzet létrehozása" - -#. Open Search window keybinding... -#: ../src/preferencesdialog.cpp:513 -msgid "Open Search _Window" -msgstr "Keresési _ablak megnyitása" - -#: ../src/preferencesdialog.cpp:553 +#: ../src/preferencesdialog.cpp:431 msgid "Ser_vice:" msgstr "S_zolgáltatás:" -#: ../src/preferencesdialog.cpp:609 ../src/preferencesdialog.cpp:1239 +#: ../src/preferencesdialog.cpp:487 ../src/preferencesdialog.cpp:1117 msgid "Not configurable" msgstr "Nem konfigurálható" -#: ../src/preferencesdialog.cpp:636 +#: ../src/preferencesdialog.cpp:514 msgid "Automatical background s_ync interval (minutes)" msgstr "_Automatikus háttér-szinkronizálás gyakorisága (perc)" #. "Advanced..." button to bring up extra sync config dialog -#: ../src/preferencesdialog.cpp:660 +#: ../src/preferencesdialog.cpp:538 msgid "_Advanced..." msgstr "Spe_ciális…" -#: ../src/preferencesdialog.cpp:707 +#: ../src/preferencesdialog.cpp:585 msgid "The following plugins are installed:" msgstr "A következő bővítmények vannak telepítve:" #. TODO: In a future version, add in an "Install Add-ins..." button #. TODO: In a future version, add in a "Repositories..." button -#: ../src/preferencesdialog.cpp:742 +#: ../src/preferencesdialog.cpp:620 msgid "_Enable" msgstr "_Engedélyezés" -#: ../src/preferencesdialog.cpp:748 +#: ../src/preferencesdialog.cpp:626 msgid "_Disable" msgstr "_Tiltás" -#: ../src/preferencesdialog.cpp:906 +#: ../src/preferencesdialog.cpp:784 msgid "Not Implemented" msgstr "Nincs megvalósítva" -#: ../src/preferencesdialog.cpp:922 +#: ../src/preferencesdialog.cpp:800 msgid "%1% Preferences" msgstr "%1% beállításai" -#: ../src/preferencesdialog.cpp:1057 +#: ../src/preferencesdialog.cpp:935 msgid "Choose Note Font" msgstr "Jegyzet betűkészletének kiválasztása" #. Create dialog -#: ../src/preferencesdialog.cpp:1155 +#: ../src/preferencesdialog.cpp:1033 msgid "Other Synchronization Options" msgstr "A szinkronizálás további beállításai" -#: ../src/preferencesdialog.cpp:1158 +#: ../src/preferencesdialog.cpp:1036 msgid "" "When a conflict is detected between a local note and a note on the " "configured synchronization server:" @@ -2147,23 +2013,23 @@ "között ütközés van:" #. label.Xalign = 0; -#: ../src/preferencesdialog.cpp:1162 +#: ../src/preferencesdialog.cpp:1040 msgid "Always ask me what to do" msgstr "Mindig kérdezzen" -#: ../src/preferencesdialog.cpp:1166 +#: ../src/preferencesdialog.cpp:1044 msgid "Rename my local note" msgstr "Nevezze át a helyi jegyzetet" -#: ../src/preferencesdialog.cpp:1170 +#: ../src/preferencesdialog.cpp:1048 msgid "Replace my local note with the server's update" msgstr "Cserélje a helyi jegyzetet a kiszolgálón találhatóra" -#: ../src/preferencesdialog.cpp:1272 +#: ../src/preferencesdialog.cpp:1150 msgid "Are you sure?" msgstr "Biztos benne?" -#: ../src/preferencesdialog.cpp:1273 +#: ../src/preferencesdialog.cpp:1151 msgid "" "Clearing your synchronization settings is not recommended. You may be " "forced to synchronize all of your notes again when you save new settings." @@ -2171,11 +2037,11 @@ "A szinkronizálás beállításainak törlése nem ajánlott. Új beállítások " "mentésekor szükség lehet a jegyzetek újraszinkronizálására." -#: ../src/preferencesdialog.cpp:1283 +#: ../src/preferencesdialog.cpp:1161 msgid "Resetting Synchronization Settings" msgstr "Szinkronizálás beállításainak visszaállítása" -#: ../src/preferencesdialog.cpp:1284 +#: ../src/preferencesdialog.cpp:1162 msgid "" "You have disabled the configured synchronization service. Your " "synchronization settings will now be cleared. You may be forced to " @@ -2185,11 +2051,11 @@ "beállításai törlésre kerülnek. Új beállítások mentésekor szükség lehet a " "jegyzetek újraszinkronizálására." -#: ../src/preferencesdialog.cpp:1350 +#: ../src/preferencesdialog.cpp:1228 msgid "Connection successful" msgstr "A kapcsolódás sikeres" -#: ../src/preferencesdialog.cpp:1351 +#: ../src/preferencesdialog.cpp:1229 msgid "" "Gnote is ready to synchronize your notes. Would you like to synchronize them " "now?" @@ -2197,7 +2063,7 @@ "A Gnote készen áll a jegyzetei szinkronizálására. Kívánja azokat most " "szinkronizálni?" -#: ../src/preferencesdialog.cpp:1375 +#: ../src/preferencesdialog.cpp:1253 msgid "" "Please check your information and try again. The log file %1% may contain " "more information about the error." @@ -2205,19 +2071,19 @@ "Ellenőrizze az információkat, és próbálkozzon újra. A(z) %1% naplófájl " "további információkat tartalmazhat a hibáról." -#: ../src/preferencesdialog.cpp:1380 +#: ../src/preferencesdialog.cpp:1258 msgid "Error connecting" msgstr "Hiba a csatlakozáskor" -#: ../src/preferencesdialog.cpp:1443 +#: ../src/preferencesdialog.cpp:1321 msgid "Version:" msgstr "Verzió:" -#: ../src/preferencesdialog.cpp:1446 +#: ../src/preferencesdialog.cpp:1324 msgid "Author:" msgstr "Szerző:" -#: ../src/preferencesdialog.cpp:1451 +#: ../src/preferencesdialog.cpp:1329 msgid "Copyright:" msgstr "Copyright:" @@ -2432,7 +2298,6 @@ msgstr "A FUSE nem engedélyezhető." #: ../src/synchronization/fusesyncserviceaddin.cpp:246 -#| msgid "An error ocurred while connecting to the specified server" msgid "An error occurred while connecting to the specified server" msgstr "Hiba történt a megadott kiszolgálóhoz kapcsolódás közben" @@ -2709,18 +2574,6 @@ "modult. Vegye fel a „modprobe fuse” sort az /etc/init.d/boot.local vagy a " "„fuse” sort az /etc/modules fájlba." -#: ../src/tray.cpp:54 -msgid "Take notes" -msgstr "Jegyzetek készítése" - -#: ../src/tray.cpp:167 -msgid " (new)" -msgstr " (új)" - -#: ../src/tray.cpp:458 -msgid "_About Gnote" -msgstr "_Névjegy" - #: ../src/utils.cpp:144 msgid "" "The \"Gnote Manual\" could not be found. Please verify that your " @@ -2814,6 +2667,133 @@ msgid "_Open Link" msgstr "_Hivatkozás megnyitása" +#~ msgid "" +#~ "Has affect only when started as an application. When set to TRUE, shows a " +#~ "status icon. If set to FALSE, Search All Notes window is used as main " +#~ "application window, closing which makes application to exit." +#~ msgstr "" +#~ "Csak alkalmazásként való indításkor van hatása. Ha igazra van állítva, " +#~ "akkor megjeleníti az állapotikont. Ha hamisra van állítva, akkor a " +#~ "Keresés minden jegyzetben ablak lesz a fő alkalmazásablak, és bezárása " +#~ "bezárja az alkalmazást." + +#~ msgid "" +#~ "The global keybinding for showing the Gnote applet's menu. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "A Gnote kisalkalmazás menüjének mutatásához rendelt globális " +#~ "gyorsbillentyű. A formátum: „<Control>a” vagy „<Shift><" +#~ "Alt>F1”. A feldolgozás elég liberális, megengedi kis- vagy nagybetűk " +#~ "használatát és rövidítéseket is, mint például: „<Ctl>” és „<" +#~ "Ctrl>”. Ha ezt az opciót „disabled” értékűre állítja, nem lesz " +#~ "billentyű hozzárendelve ehhez a művelethez." + +#~ msgid "" +#~ "The global keybinding for opening the \"Start Here\" note. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "A „Kezdje itt!” jegyzet megnyitásához rendelt globális gyorsbillentyű. A " +#~ "formátum: „<Control>a” vagy „<Shift><Alt>F1”. A " +#~ "feldolgozás elég liberális, megengedi kis- vagy nagybetűk használatát és " +#~ "rövidítéseket is, mint például: „<Ctl>” és „<Ctrl>”. Ha ezt " +#~ "az opciót „disabled” értékűre állítja, nem lesz billentyű hozzárendelve " +#~ "ehhez a művelethez." + +#~ msgid "" +#~ "The global keybinding for creating and displaying a new Note. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Az új jegyzet létrehozásához és megnyitásához rendelt globális " +#~ "gyorsbillentyű. A formátum: „<Control>a” vagy „<Shift><" +#~ "Alt>F1”. A feldolgozás elég liberális, megengedi kis- vagy nagybetűk " +#~ "használatát és rövidítéseket is, mint például: „<Ctl>” és „<" +#~ "Ctrl>”. Ha ezt az opciót „disabled” értékűre állítja, nem lesz " +#~ "billentyű hozzárendelve ehhez a művelethez." + +#~ msgid "" +#~ "The global keybinding for opening the Note Search dialog. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "A Jegyzet keresése párbeszédablak megnyitásához rendelt globális " +#~ "gyorsbillentyű. A formátum: „<Control>a” vagy „<Shift><" +#~ "Alt>F1”. A feldolgozás elég liberális, megengedi kis- vagy nagybetűk " +#~ "használatát és rövidítéseket is, mint például: „<Ctl>” és „<" +#~ "Ctrl>”. Ha ezt az opciót „disabled” értékűre állítja, nem lesz " +#~ "billentyű hozzárendelve ehhez a művelethez." + +#~ msgid "" +#~ "The global keybinding for opening the Recent Changes dialog. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "A Legutóbbi változások párbeszédablak megnyitásához rendelt globális " +#~ "gyorsbillentyű. A formátum: „<Control>a” vagy „<Shift><" +#~ "Alt>F1”. A feldolgozás elég liberális, megengedi kis- vagy nagybetűk " +#~ "használatát és rövidítéseket is, mint például: „<Ctl>” és „<" +#~ "Ctrl>”. Ha ezt az opciót „disabled” értékűre állítja, nem lesz " +#~ "billentyű hozzárendelve ehhez a művelethez." + +#~ msgid "Hotkeys" +#~ msgstr "Gyorsbillentyűk" + +#~ msgid "Use status _icon" +#~ msgstr "Áll_apotikon használata" + +#~ msgid "Show icon in tray, which is the central place of control." +#~ msgstr "Ikon megjelenítése a tálcán, amely a felügyelet központi helye." + +#~ msgid "Listen for _hotkeys" +#~ msgstr "_Gyorsbillentyűk figyelése" + +#~ msgid "" +#~ "Hotkeys allow you to quickly access your notes from anywhere with a " +#~ "keypress. Example Hotkeys: <Control><Shift>F11, <" +#~ "Alt>N" +#~ msgstr "" +#~ "A gyorsbillentyűk segítségével bárhonnan gyorsan elérheti jegyzeteit egy " +#~ "gombnyomással. Példa gyorsbillentyűk: <Control><Shift>F11, <Alt>N" + +#~ msgid "Show notes _menu" +#~ msgstr "Jegyzetek menü _mutatása" + +#~ msgid "Open \"_Start Here\"" +#~ msgstr "„_Kezdje itt!” megnyitása" + +#~ msgid "Create _new note" +#~ msgstr "Ú_j jegyzet létrehozása" + +#~ msgid "Open Search _Window" +#~ msgstr "Keresési _ablak megnyitása" + +#~ msgid "Take notes" +#~ msgstr "Jegyzetek készítése" + +#~ msgid " (new)" +#~ msgstr " (új)" + +#~ msgid "_About Gnote" +#~ msgstr "_Névjegy" + #~ msgid "Pin" #~ msgstr "Rögzítés" diff -Nru gnote-3.14.2/po/id.po gnote-3.16.0/po/id.po --- gnote-3.14.2/po/id.po 2015-01-17 12:53:24.000000000 +0000 +++ gnote-3.16.0/po/id.po 2015-03-07 18:13:28.000000000 +0000 @@ -4,11 +4,11 @@ # Andika Triwidada , 2009, 2010, 2011, 2012, 2014. msgid "" msgstr "" -"Project-Id-Version: gnote gnome-3-14\n" +"Project-Id-Version: gnote master\n" "Report-Msgid-Bugs-To: http://bugzilla.gnome.org/enter_bug.cgi?" "product=gnote&keywords=I18N+L10N&component=general\n" -"POT-Creation-Date: 2014-12-21 12:57+0000\n" -"PO-Revision-Date: 2014-12-21 20:39+0700\n" +"POT-Creation-Date: 2014-09-16 08:22+0000\n" +"PO-Revision-Date: 2014-09-16 18:14+0700\n" "Last-Translator: Andika Triwidada \n" "Language-Team: Indonesian \n" "Language: id\n" @@ -16,7 +16,7 @@ "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" "Plural-Forms: nplurals=1; plural=0;\n" -"X-Generator: Poedit 1.7.1\n" +"X-Generator: Poedit 1.6.9\n" #: ../data/appdata/gnote.appdata.xml.in.h:1 msgid "" @@ -25,9 +25,9 @@ "links, group together in notebooks and some extra features for everyday use." msgstr "" "Gnote adalah aplikasi penyimpan catatan sederhana untuk lingkungan desktop " -"GNOME. Ini memungkinkan Anda menangkap ide Anda, menautkan bersama memakai taut " -"bergaya WikiWiki, mengelompokkan dalam buku catatan, dan beberapa fitur ekstra " -"bagi penggunaan sehari-hari." +"GNOME. Ini memungkinkan Anda menangkap ide Anda, menautkan bersama memakai " +"taut bergaya WikiWiki, mengelompokkan dalam buku catatan, dan beberapa fitur " +"ekstra bagi penggunaan sehari-hari." #: ../data/appdata/gnote.appdata.xml.in.h:2 msgid "" @@ -72,10 +72,11 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:4 msgid "" -"Enable this option to automatically create a link, when text matches note title." +"Enable this option to automatically create a link, when text matches note " +"title." msgstr "" -"Fungsikan opsi ini untuk secara otomatis membuat suatu taut, ketika teks cocok " -"dengan judul catatan." +"Fungsikan opsi ini untuk secara otomatis membuat suatu taut, ketika teks " +"cocok dengan judul catatan." #: ../data/org.gnome.gnote.gschema.xml.in.h:5 msgid "Create links for URLs in notes" @@ -91,11 +92,11 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:8 msgid "" -"Enable this option to highlight words ThatLookLikeThis. Clicking the word will " -"create a note with that name." +"Enable this option to highlight words ThatLookLikeThis. Clicking the word " +"will create a note with that name." msgstr "" -"Fungsikan opsi ini untuk menandai kata BerpenampilanSepertiIni. Mengklik kata " -"tersebut akan membuat satu catatan dengan nama tersebut." +"Fungsikan opsi ini untuk menandai kata BerpenampilanSepertiIni. Mengklik " +"kata tersebut akan membuat satu catatan dengan nama tersebut." #: ../data/org.gnome.gnote.gschema.xml.in.h:9 msgid "Enable Auto bulleted lists" @@ -103,11 +104,11 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:10 msgid "" -"Enable this option if you want bulleted lists to be automatic when you place - " -"or * at the beginning of a line." +"Enable this option if you want bulleted lists to be automatic when you place " +"- or * at the beginning of a line." msgstr "" -"Fungsikan pilihan ini bila Anda ingin daftar butir dibuat sendiri ketika Anda " -"menempatkan - atau * di awal suatu baris." +"Fungsikan pilihan ini bila Anda ingin daftar butir dibuat sendiri ketika " +"Anda menempatkan - atau * di awal suatu baris." #: ../data/org.gnome.gnote.gschema.xml.in.h:11 msgid "Enable Middle-Click Paste On Icon" @@ -118,8 +119,8 @@ "Enable this option if you want to be able to middle-click the Gnote icon to " "paste timestamped content into the Start Here note." msgstr "" -"Fungsikan pilihan ini bila Anda ingin dapat mengklik tengah ikon Tomboy untuk " -"menempel isi dengan penanda waktu ke dalam catatan Mulai Di Sini." +"Fungsikan pilihan ini bila Anda ingin dapat mengklik tengah ikon Tomboy " +"untuk menempel isi dengan penanda waktu ke dalam catatan Mulai Di Sini." #: ../data/org.gnome.gnote.gschema.xml.in.h:13 msgid "Enable custom font" @@ -139,8 +140,8 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:16 msgid "" -"If enable-custom-font is true, the font name set here will be used as the font " -"when displaying notes." +"If enable-custom-font is true, the font name set here will be used as the " +"font when displaying notes." msgstr "" "Bila enable-custom-font diisi true, nama fonta yang diisikan di sini akan " "dipakai sebagai fonta untuk menayangkan catatan." @@ -152,8 +153,8 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:18 msgid "" "If true, the desktop-global keybindings set in /org/gnome/gnote/global-" -"keybindings will be enabled, allowing for useful Gnote actions to be available " -"from any application." +"keybindings will be enabled, allowing for useful Gnote actions to be " +"available from any application." msgstr "" "Bila true, keybinding desktop-global yand ditata di /org/gnome/gnote/global-" "keybindings akan diaktifkan, menyebabkan berbagai aksi Gnote yang berguna " @@ -166,11 +167,12 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:20 msgid "" "The note URI of the note that should be considered the \"Start Here\" note, " -"which is always placed at the bottom of the Gnote note menu and also accessible " -"by hotkey." +"which is always placed at the bottom of the Gnote note menu and also " +"accessible by hotkey." msgstr "" -"URI catatan yang dijadikan catatan \"Mulai Di Sini\", yang selalu ditempatkan " -"di dasar menu catatan Tomboy dan juga dapat diakses melalui tombol singkat." +"URI catatan yang dijadikan catatan \"Mulai Di Sini\", yang selalu " +"ditempatkan di dasar menu catatan Tomboy dan juga dapat diakses melalui " +"tombol singkat." #: ../data/org.gnome.gnote.gschema.xml.in.h:21 msgid "Minimum number of notes to show in menu" @@ -178,10 +180,11 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:22 msgid "" -"Integer determining the minimum number of notes to show in the Gnote note menu." +"Integer determining the minimum number of notes to show in the Gnote note " +"menu." msgstr "" -"Bilangan bulat yang menentukan cacah minimum catatan yang ditampilkan di menu " -"catatan Gnote." +"Bilangan bulat yang menentukan cacah minimum catatan yang ditampilkan di " +"menu catatan Gnote." #: ../data/org.gnome.gnote.gschema.xml.in.h:23 msgid "List of pinned notes" @@ -189,11 +192,11 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:24 msgid "" -"Whitespace-separated list of note URIs for notes that should always appear in " -"the Gnote note menu." +"Whitespace-separated list of note URIs for notes that should always appear " +"in the Gnote note menu." msgstr "" -"Daftar yang dipisah dengan whitespace dari URI catatan bagi catatan yang mesti " -"selalu tampil di menu catatan Tomboy." +"Daftar yang dipisah dengan whitespace dari URI catatan bagi catatan yang " +"mesti selalu tampil di menu catatan Tomboy." #: ../data/org.gnome.gnote.gschema.xml.in.h:25 msgid "Is main window maximized" @@ -251,8 +254,8 @@ "Time (in milliseconds) Gnote should wait for a response when using FUSE to " "mount a sync share." msgstr "" -"Waktu (dalam milidetik) Gnote mesti menunggu jawaban ketika memakai FUSE untuk " -"mengkait suatu share selaras." +"Waktu (dalam milidetik) Gnote mesti menunggu jawaban ketika memakai FUSE " +"untuk mengkait suatu share selaras." #: ../data/org.gnome.gnote.gschema.xml.in.h:37 msgid "SSHFS Remote Synchronization Folder" @@ -277,7 +280,8 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:42 msgid "User name to use when connecting to the synchronization server via SSH." msgstr "" -"Nama pengguna yang dipakai ketika menyambung ke server penyelarasan melalui SSH." +"Nama pengguna yang dipakai ketika menyambung ke server penyelarasan melalui " +"SSH." #: ../data/org.gnome.gnote.gschema.xml.in.h:43 msgid "SSHFS Synchronization Server Port" @@ -293,21 +297,21 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:46 msgid "" -"Integer value indicating if there is a preference to always perform a specific " -"link updating behavior when a note is renamed, instead of prompting the user. " -"The values map to an internal enumeration. 0 indicates that the user wishes to " -"be prompted when renaming a note may impact links that exist in other notes. 1 " -"indicates that links should automatically be removed. 2 indicates that link " -"text should be updated to the new note name so that it will continue linking to " -"the renamed note." +"Integer value indicating if there is a preference to always perform a " +"specific link updating behavior when a note is renamed, instead of prompting " +"the user. The values map to an internal enumeration. 0 indicates that the " +"user wishes to be prompted when renaming a note may impact links that exist " +"in other notes. 1 indicates that links should automatically be removed. 2 " +"indicates that link text should be updated to the new note name so that it " +"will continue linking to the renamed note." msgstr "" "Nilai bulat yang menandakan bila ada preferensi untuk selalu melakukan suatu " "tindakan spesifik ketika suatu catatan diubah nama, alih-alih bertanya ke " -"pengguna. Nilai ini merujuk ke enumerasi internal. 0 menandakan bahwa pengguna " -"ingin ditanyai ketika mengubah nama suatu catatan dapat mempengaruhi tautan " -"yang ada pada catatan lain. 1 menandakan bahwa tautan mesti otomatis dibuang. 2 " -"menandakan bahwa teks tautan mesti diperbarui ke nama catatan baru sehingga " -"masih terus menaut ke catatan yang diubah nama." +"pengguna. Nilai ini merujuk ke enumerasi internal. 0 menandakan bahwa " +"pengguna ingin ditanyai ketika mengubah nama suatu catatan dapat " +"mempengaruhi tautan yang ada pada catatan lain. 1 menandakan bahwa tautan " +"mesti otomatis dibuang. 2 menandakan bahwa teks tautan mesti diperbarui ke " +"nama catatan baru sehingga masih terus menaut ke catatan yang diubah nama." #: ../data/org.gnome.gnote.gschema.xml.in.h:47 msgid "Enable closing notes with escape" @@ -330,8 +334,8 @@ "application window, closing which makes application to exit." msgstr "" "Berpengaruh hanya ketika dimulai sebagai aplikasi. Bila ditata TRUE, " -"menampilkan ikon status. Bila ditata FALSE, jendela Cari Semua Catatan dipakai " -"sebagai jendela aplikasi utama, menutupnya membuat aplikasi keluar." +"menampilkan ikon status. Bila ditata FALSE, jendela Cari Semua Catatan " +"dipakai sebagai jendela aplikasi utama, menutupnya membuat aplikasi keluar." #: ../data/org.gnome.gnote.gschema.xml.in.h:51 msgid "Open notes in new window" @@ -339,9 +343,11 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:52 msgid "" -"Open notes in new window instead of replacing active content of the same window" +"Open notes in new window instead of replacing active content of the same " +"window" msgstr "" -"Buka catatan di jendela baru, bukan mengganti isi aktif dari jendela yang sama" +"Buka catatan di jendela baru, bukan mengganti isi aktif dari jendela yang " +"sama" #: ../data/org.gnome.gnote.gschema.xml.in.h:53 msgid "Save note window size and autosize note window to it" @@ -351,8 +357,8 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:54 msgid "" -"Saves note window size and automatically resizes main window to this size, when " -"note is opened." +"Saves note window size and automatically resizes main window to this size, " +"when note is opened." msgstr "" "Menyimpan ukuran jendela catatan dan secara otomatis mengubah ukuran jendela " "utama ke ukuran ini ketika catatan dibuka." @@ -365,15 +371,16 @@ msgid "" "The global keybinding for showing the Gnote applet's menu. The format looks " "like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such as " -"\"<Ctl>\" and \"<Ctrl>\". If you set the option to the special " -"string \"disabled\", then there will be no keybinding for this action." +"fairly liberal and allows lower or upper case, and also abbreviations such " +"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " +"special string \"disabled\", then there will be no keybinding for this " +"action." msgstr "" "Keybinding global untuk menampilkan menu aplet Gnote Bentuknya seperti \"<" "Control>a\" atau \"<Shift><Alt>F1\". Pengurai cukup bebas dan " -"mengijinkan huruf besar atau kecil, dan juga singkatan seperti \"<Ctl>\" " -"dan \"<Ctrl>\". Bila Anda menata pilihan ke kata khusus \"disabled\", " -"maka tidak akan ada keybinding untuk aksi ini." +"mengijinkan huruf besar atau kecil, dan juga singkatan seperti \"<Ctl>" +"\" dan \"<Ctrl>\". Bila Anda menata pilihan ke kata khusus \"disabled" +"\", maka tidak akan ada keybinding untuk aksi ini." #: ../data/org.gnome.gnote.gschema.xml.in.h:57 msgid "Open Start Here" @@ -383,15 +390,16 @@ msgid "" "The global keybinding for opening the \"Start Here\" note. The format looks " "like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such as " -"\"<Ctl>\" and \"<Ctrl>\". If you set the option to the special " -"string \"disabled\", then there will be no keybinding for this action." +"fairly liberal and allows lower or upper case, and also abbreviations such " +"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " +"special string \"disabled\", then there will be no keybinding for this " +"action." msgstr "" "Keybinding global untuk membuka catatan \"Mulai Di Sini\". Bentuknya seperti " -"\"<Control>a\" atau \"<Shift><Alt>F1\". Pengurai cukup bebas " -"dan mengijinkan huruf besar atau kecil, dan juga singkatan seperti \"<Ctl>" -"\" dan \"<Ctrl>\". Bila Anda menata pilihan ke kata khusus \"disabled\", " -"maka tidak akan ada keybinding untuk aksi ini." +"\"<Control>a\" atau \"<Shift><Alt>F1\". Pengurai cukup " +"bebas dan mengijinkan huruf besar atau kecil, dan juga singkatan seperti " +"\"<Ctl>\" dan \"<Ctrl>\". Bila Anda menata pilihan ke kata " +"khusus \"disabled\", maka tidak akan ada keybinding untuk aksi ini." #: ../data/org.gnome.gnote.gschema.xml.in.h:59 msgid "Create a new Note" @@ -399,17 +407,19 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:60 msgid "" -"The global keybinding for creating and displaying a new Note. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such as " -"\"<Ctl>\" and \"<Ctrl>\". If you set the option to the special " -"string \"disabled\", then there will be no keybinding for this action." -msgstr "" -"Keybinding global untuk membuat dan menampilkan suatu Catatan baru. Bentuknya " -"seperti \"<Control>a\" atau \"<Shift><Alt>F1\". Pengurai " -"cukup bebas dan mengijinkan huruf besar atau kecil, dan juga singkatan seperti " -"\"<Ctl>\" dan \"<Ctrl>\". Bila Anda menata pilihan ke kata khusus " -"\"disabled\", maka tidak akan ada keybinding untuk aksi ini." +"The global keybinding for creating and displaying a new Note. The format " +"looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +"parser is fairly liberal and allows lower or upper case, and also " +"abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the " +"option to the special string \"disabled\", then there will be no keybinding " +"for this action." +msgstr "" +"Keybinding global untuk membuat dan menampilkan suatu Catatan baru. " +"Bentuknya seperti \"<Control>a\" atau \"<Shift><Alt>F1\". " +"Pengurai cukup bebas dan mengijinkan huruf besar atau kecil, dan juga " +"singkatan seperti \"<Ctl>\" dan \"<Ctrl>\". Bila Anda menata " +"pilihan ke kata khusus \"disabled\", maka tidak akan ada keybinding untuk " +"aksi ini." #: ../data/org.gnome.gnote.gschema.xml.in.h:61 msgid "Open Search Dialog" @@ -417,17 +427,18 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:62 msgid "" -"The global keybinding for opening the Note Search dialog. The format looks like " -"\"<Control>a\" or \"<Shift><Alt>F1\". The parser is fairly " -"liberal and allows lower or upper case, and also abbreviations such as \"<" -"Ctl>\" and \"<Ctrl>\". If you set the option to the special string " -"\"disabled\", then there will be no keybinding for this action." +"The global keybinding for opening the Note Search dialog. The format looks " +"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " +"fairly liberal and allows lower or upper case, and also abbreviations such " +"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " +"special string \"disabled\", then there will be no keybinding for this " +"action." msgstr "" "Keybinding global untuk membuka dialog Cari Catatan. Bentuknya seperti \"<" "Control>a\" atau \"<Shift><Alt>F1\". Pengurai cukup bebas dan " -"mengijinkan huruf besar atau kecil, dan juga singkatan seperti \"<Ctl>\" " -"dan \"<Ctrl>\". Bila Anda menata pilihan ke kata khusus \"disabled\", " -"maka tidak akan ada keybinding untuk aksi ini." +"mengijinkan huruf besar atau kecil, dan juga singkatan seperti \"<Ctl>" +"\" dan \"<Ctrl>\". Bila Anda menata pilihan ke kata khusus \"disabled" +"\", maka tidak akan ada keybinding untuk aksi ini." #: ../data/org.gnome.gnote.gschema.xml.in.h:63 msgid "Open Recent Changes" @@ -435,24 +446,26 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:64 msgid "" -"The global keybinding for opening the Recent Changes dialog. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such as " -"\"<Ctl>\" and \"<Ctrl>\". If you set the option to the special " -"string \"disabled\", then there will be no keybinding for this action." +"The global keybinding for opening the Recent Changes dialog. The format " +"looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +"parser is fairly liberal and allows lower or upper case, and also " +"abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the " +"option to the special string \"disabled\", then there will be no keybinding " +"for this action." msgstr "" "Keybinding global untuk membuka dialog Perubahan Terkini. Bentuknya seperti " -"\"<Control>a\" atau \"<Shift><Alt>F1\". Pengurai cukup bebas " -"dan mengijinkan huruf besar atau kecil, dan juga singkatan seperti \"<Ctl>" -"\" dan \"<Ctrl>\". Bila Anda menata pilihan ke kata khusus \"disabled\", " -"maka tidak akan ada keybinding untuk aksi ini." +"\"<Control>a\" atau \"<Shift><Alt>F1\". Pengurai cukup " +"bebas dan mengijinkan huruf besar atau kecil, dan juga singkatan seperti " +"\"<Ctl>\" dan \"<Ctrl>\". Bila Anda menata pilihan ke kata " +"khusus \"disabled\", maka tidak akan ada keybinding untuk aksi ini." #: ../data/org.gnome.gnote.gschema.xml.in.h:65 msgid "HTML Export Last Directory" msgstr "Direktori Terakhir Ekspor HTML" #: ../data/org.gnome.gnote.gschema.xml.in.h:66 -msgid "The last directory a note was exported to using the Export To HTML plugin." +msgid "" +"The last directory a note was exported to using the Export To HTML plugin." msgstr "" "Direktori terakhir tempat ekspor catatan yang memakai plugin Ekspor Ke HTML." @@ -462,8 +475,8 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:68 msgid "" -"The last setting for the 'Export linked notes' checkbox in the Export to HTML " -"plugin." +"The last setting for the 'Export linked notes' checkbox in the Export to " +"HTML plugin." msgstr "" "Tatanan terakhir bagi checkbox 'Ekspor catatan tertaut' di plugin Ekspor ke " "HTML." @@ -479,10 +492,10 @@ "Export Linked Notes' setting and is used to specify whether all notes (found " "recursively) should be included during an export to HTML." msgstr "" -"Tatanan terakhir bagi checkbox 'sertakan semua catatan tertaut lain' di plugin " -"Ekspor ke HTML. Tatanan ini dipakai berkaitan dengan tatanan 'Ekspor Catatan " -"Tertaut ke HTML' dan dipakai untuk menyatakan apakah semua catatan (ditemukan " -"secara rekursif) mesti disertakan selama ekspor ke HTML." +"Tatanan terakhir bagi checkbox 'sertakan semua catatan tertaut lain' di " +"plugin Ekspor ke HTML. Tatanan ini dipakai berkaitan dengan tatanan 'Ekspor " +"Catatan Tertaut ke HTML' dan dipakai untuk menyatakan apakah semua catatan " +"(ditemukan secara rekursif) mesti disertakan selama ekspor ke HTML." #: ../data/org.gnome.gnote.gschema.xml.in.h:71 msgid "Synchronization Client ID" @@ -491,10 +504,10 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:72 msgid "" "Unique identifier for this Gnote client, used when communicating with a " -"synchronization server." +"sychronization server." msgstr "" -"Identifier unik bagi klien Gnote ini, dipakai ketika berkomunikasi dengan suatu " -"server penyelarasan." +"Identifier unik bagi klien Gnote ini, dipakai ketika berkomunikasi dengan " +"suatu server penyelarasan." #: ../data/org.gnome.gnote.gschema.xml.in.h:73 msgid "Synchronization Local Server Path" @@ -516,7 +529,8 @@ msgid "" "Unique identifier for the currently configured note synchronization service " "addin." -msgstr "Identifier unik bagi addin layanan penyelarasan catatan yang kini ditata." +msgstr "" +"Identifier unik bagi addin layanan penyelarasan catatan yang kini ditata." #: ../data/org.gnome.gnote.gschema.xml.in.h:77 msgid "Note Synchronization Conflict Saved Behavior" @@ -524,17 +538,17 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:78 msgid "" -"Integer value indicating if there is a preference to always perform a specific " -"behavior when a conflict is detected, instead of prompting the user. The values " -"map to an internal enumeration. 0 indicates that the user wishes to be prompted " -"when a conflict occurs, so that they may handle each conflict situation on a " -"case-by-case basis." +"Integer value indicating if there is a preference to always perform a " +"specific behavior when a conflict is detected, instead of prompting the " +"user. The values map to an internal enumeration. 0 indicates that the user " +"wishes to be prompted when a conflict occurs, so that they may handle each " +"conflict situation on a case-by-case basis." msgstr "" "Nilai bulat yang menandakan bila ada preferensi untuk selalu melakukan suatu " "tindakan spesifik ketika pertentangan terdeteksi, alih-alih bertanya ke " -"pengguna. Nilai ini merujuk ke enumerasi internal. 0 menandakan bahwa pengguna " -"ingin ditanyai ketika pertentangan terjadi, sehingga mereka mungkin bisa " -"menangani setiap keadaan pertentangan secara kasus per kasus." +"pengguna. Nilai ini merujuk ke enumerasi internal. 0 menandakan bahwa " +"pengguna ingin ditanyai ketika pertentangan terjadi, sehingga mereka mungkin " +"bisa menangani setiap keadaan pertentangan secara kasus per kasus." #: ../data/org.gnome.gnote.gschema.xml.in.h:79 msgid "Automatic Background Synchronization Timeout" @@ -543,13 +557,14 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:80 msgid "" "Integer value indicating how frequently to perform a background sync of your " -"notes (when sync is configured). Any value less than 1 indicates that autosync " -"is disabled. The lowest acceptable positive value is 5. Value is in minutes." +"notes (when sync is configured). Any value less than 1 indicates that " +"autosync is disabled. The lowest acceptable positive value is 5. Value is in " +"minutes." msgstr "" "Nilai integer yang menyatakan seberapa sering melakukan penyelarasan latar " -"belakang dari catatan Anda (ketika penyelarasan dikonfigurasi). Sebarang nilai " -"kurang dari 1 menyatakan bahwa autosync dimatikan. Nilai positif terkecil yang " -"dapat diterima adalah 5. Nilai dalam menit." +"belakang dari catatan Anda (ketika penyelarasan dikonfigurasi). Sebarang " +"nilai kurang dari 1 menyatakan bahwa autosync dimatikan. Nilai positif " +"terkecil yang dapat diterima adalah 5. Nilai dalam menit." #: ../data/org.gnome.gnote.gschema.xml.in.h:81 msgid "Accept SSL Certificates" @@ -557,7 +572,8 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:82 msgid "" -"Use wdfs option \"-ac\" to accept SSL certificates without prompting the user." +"Use wdfs option \"-ac\" to accept SSL certificates without prompting the " +"user." msgstr "" "Gunakan opsi wdfs \"-ac\" untuk menerima sertifikat SSL tanpa bertanya ke " "pengguna." @@ -594,12 +610,14 @@ msgstr "Waktu antara pemeriksaan" #: ../data/org.gnome.gnote.gschema.xml.in.h:90 -msgid "Time interval between note directory checks (in seconds). Min value is 5." +msgid "" +"Time interval between note directory checks (in seconds). Min value is 5." msgstr "" "Selang waktu antara pemeriksaan direktori catatan (dalam detik). Nilai min " "adalah 5." -#: ../src/actionmanager.cpp:84 ../src/actionmanager.cpp:171 ../src/tray.cpp:465 +#: ../src/actionmanager.cpp:84 ../src/actionmanager.cpp:171 +#: ../src/tray.cpp:465 msgid "_Quit" msgstr "_Keluar" @@ -607,7 +625,8 @@ msgid "Quit Gnote" msgstr "Keluar Gnote" -#: ../src/actionmanager.cpp:89 ../src/actionmanager.cpp:168 ../src/tray.cpp:448 +#: ../src/actionmanager.cpp:89 ../src/actionmanager.cpp:168 +#: ../src/tray.cpp:448 msgid "_Preferences" msgstr "_Preferensi" @@ -743,11 +762,12 @@ #: ../src/addins/bugzilla/bugzilla.desktop.in.in.h:2 msgid "" "Allows you to drag a Bugzilla URL from your browser directly into a Gnote " -"note. The bug number is inserted as a link with a little bug icon next to it." +"note. The bug number is inserted as a link with a little bug icon next to " +"it." msgstr "" "Memungkinkan Anda menyeret suatu URL Bugzilla dari peramban Anda langsung ke " -"suatu catatan Gnote. Nomor kutu disisipkan sebagai suatu taut dengan ikon kutu " -"kecil di sebelahnya." +"suatu catatan Gnote. Nomor kutu disisipkan sebagai suatu taut dengan ikon " +"kutu kecil di sebelahnya." #: ../src/addins/bugzilla/bugzilla.desktop.in.in.h:3 #: ../src/addins/exporttohtml/exporttohtml.desktop.in.in.h:3 @@ -789,8 +809,8 @@ #: ../src/addins/bugzilla/bugzillapreferences.cpp:279 msgid "You must specify a valid Bugzilla host name to use with this icon." msgstr "" -"Anda mesti menyatakan nama host Bugzilla yang valid untuk dipakai dengan ikon " -"ini." +"Anda mesti menyatakan nama host Bugzilla yang valid untuk dipakai dengan " +"ikon ini." #: ../src/addins/bugzilla/bugzillapreferences.cpp:298 msgid "Error saving icon" @@ -912,7 +932,8 @@ msgstr "Ruas path folder kosong." #: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:141 -msgid "Specified folder path does not exist, and Gnote was unable to create it." +msgid "" +"Specified folder path does not exist, and Gnote was unable to create it." msgstr "Path folder yang diberikan tak ada, dan Gnote tak bisa membuatnya." #: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:217 @@ -974,7 +995,8 @@ #: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:236 #, c-format msgid "NoteDirectoryWatcher: Update aborted, error reading %s: %s" -msgstr "NoteDirectoryWatcher: Pemutakhiran digugurkan, galat saat membaca %s: %s" +msgstr "" +"NoteDirectoryWatcher: Pemutakhiran digugurkan, galat saat membaca %s: %s" #. TRANSLATORS: %s is file #: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:263 @@ -998,7 +1020,8 @@ #: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:290 #, c-format msgid "NoteDirectoryWatcher: Update aborted, error parsing %s: %s" -msgstr "NoteDirectoryWatcher: Pemutakhiran digugurkan, galat saat mengurai %s: %s" +msgstr "" +"NoteDirectoryWatcher: Pemutakhiran digugurkan, galat saat mengurai %s: %s" #: ../src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp:35 msgid "_Directory check interval:" @@ -1066,8 +1089,8 @@ #: ../src/addins/noteoftheday/noteofthedaypreferences.cpp:35 msgid "" -"Change the Today: Template note to customize the " -"text that new Today notes have." +"Change the Today: Template note to customize " +"the text that new Today notes have." msgstr "" "Ubah catatan Hari Ini: Templat untuk menggubah " "teks yang dipunyai oleh catatan Hari Ini yang baru." @@ -1303,8 +1326,8 @@ "There was an error connecting to the server. This may be caused by using an " "incorrect user name and/or password." msgstr "" -"Ada galat saat menyambung ke server. Ini mungkin disebabkan oleh nama pengguna " -"dan/atau sandi yang salah." +"Ada galat saat menyambung ke server. Ini mungkin disebabkan oleh nama " +"pengguna dan/atau sandi yang salah." #: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:173 msgid "URL, username, or password field is empty." @@ -1317,7 +1340,8 @@ #. Preferences.Set ("/apps/tomboy/sync_wdfs_username", username ?? string.Empty); #: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:262 msgid "" -"Saving configuration to the GNOME keyring failed with the following message:\n" +"Saving configuration to the GNOME keyring failed with the following " +"message:\n" "\n" "%1%" msgstr "" @@ -1551,11 +1575,11 @@ msgid "Active" msgstr "Aktif" -#: ../src/notebuffer.cpp:1505 +#: ../src/notebuffer.cpp:1498 msgid " tag mismatch" msgstr "tag tak cocok" -#: ../src/notebuffer.cpp:1584 +#: ../src/notebuffer.cpp:1577 #, c-format msgid "Exception: %s" msgstr "Eksepsi: %s" @@ -1582,12 +1606,12 @@ #: ../src/note.cpp:107 msgid "" "An error occurred while saving your notes. Please check that you have " -"sufficient disk space, and that you have appropriate rights on ~/.local/share/" -"gnote. Error details can be found in ~/.gnote.log." +"sufficient disk space, and that you have appropriate rights on ~/.local/" +"share/gnote. Error details can be found in ~/.gnote.log." msgstr "" -"Galat terjadi saat menyimpan catatan Anda. Silakan periksa bahwa Anda memiliki " -"cukup ruang disk, dan Anda memiliki hak yang sesuai pada ~/.local/share/gnote. " -"Rincian galat dapat ditemukan di ~/.gnote.log." +"Galat terjadi saat menyimpan catatan Anda. Silakan periksa bahwa Anda " +"memiliki cukup ruang disk, dan Anda memiliki hak yang sesuai pada ~/.local/" +"share/gnote. Rincian galat dapat ditemukan di ~/.gnote.log." #. Probably IOException or UnauthorizedAccessException? #: ../src/note.cpp:382 ../src/notebase.cpp:200 @@ -1617,23 +1641,24 @@ #: ../src/notemanager.cpp:133 msgid "" -"Start Here\n" +"Start " +"Here\n" "\n" "Welcome to Gnote!\n" "\n" "Use this \"Start Here\" note to begin organizing your ideas and thoughts.\n" "\n" -"You can create new notes to hold your ideas by selecting the \"Create New Note" -"\" item from the Gnote menu in your GNOME Panel. Your note will be saved " +"You can create new notes to hold your ideas by selecting the \"Create New " +"Note\" item from the Gnote menu in your GNOME Panel. Your note will be saved " "automatically.\n" "\n" "Then organize the notes you create by linking related notes and ideas " "together!\n" "\n" "We've created a note called Using Links in Gnote. Notice how each time we type Using Links in Gnote it automatically gets underlined? Click on the link to open the " -"note." +"internal>. Notice how each time we type Using Links in " +"Gnote it automatically gets underlined? Click on the link " +"to open the note." msgstr "" "Mulai Di " "Sini\n" @@ -1643,25 +1668,26 @@ "Gunakan catatan \"Mulai Di Sini\" ini untuk mulai menata ide dan pemikiran " "Anda.\n" "\n" -"Anda dapat membuat catatan baru untuk menyimpan ide Anda dengan memilih \"Buat " -"Catatan Baru\" dari menu Gnote pada Panel GNOME. Catatan Anda akan otomatis " -"disimpan.\n" +"Anda dapat membuat catatan baru untuk menyimpan ide Anda dengan memilih " +"\"Buat Catatan Baru\" dari menu Gnote pada Panel GNOME. Catatan Anda akan " +"otomatis disimpan.\n" "\n" "Lalu tata catatan yang Anda buat dengan menautkan catatan dan ide terkait " "bersama-sama!\n" "\n" "Kami telah membuat suatu catatan bernama Memakai Tautan di " -"Gnote. Perhatikan bagaimana setiap kali kita mengetikkan Memakai Tautan di Gnote dia secara otomatis digaris-" -"bawahi? Klik pada tautan untuk membuka catatan." +"Gnote. Perhatikan bagaimana setiap kali kita mengetikkan " +"Memakai Tautan di Gnote dia secara otomatis " +"digaris-bawahi? Klik pada tautan untuk membuka catatan." #: ../src/notemanager.cpp:152 msgid "" "Using Links in Gnote\n" "\n" -"Notes in Gnote can be linked together by highlighting text in the current note " -"and clicking the Link button above in the toolbar. Doing so will " -"create a new note and also underline the note's title in the current note.\n" +"Notes in Gnote can be linked together by highlighting text in the current " +"note and clicking the Link button above in the toolbar. Doing " +"so will create a new note and also underline the note's title in the current " +"note.\n" "\n" "Changing the title of a note will update links present in other notes. This " "prevents broken links from occurring when a note is renamed.\n" @@ -1676,12 +1702,12 @@ "itu akan membuat suatu catatan baru dan juga menggaris-bawahi judul catatan " "pada catatan kini.\n" "\n" -"Mengubah judul dari suatu catatan akan memperbarui tautan yang ada di catatan-" -"catatan lain. Hal ini mencegah terjadinya taut rusak ketika sebuah catatan " -"diubah namanya.\n" +"Mengubah judul dari suatu catatan akan memperbarui tautan yang ada di " +"catatan-catatan lain. Hal ini mencegah terjadinya taut rusak ketika sebuah " +"catatan diubah namanya.\n" "\n" -"Bila Anda mengetikkan nama dari catatan lain pada catatan kini, dia juga akan " -"ditautkan secara otomatis untuk Anda." +"Bila Anda mengetikkan nama dari catatan lain pada catatan kini, dia juga " +"akan ditautkan secara otomatis untuk Anda." #. Attempt to find an existing Start Here note #: ../src/notemanager.cpp:167 ../src/notemanager.cpp:208 @@ -1750,8 +1776,8 @@ "\n" "If you do not rename the links, they will no longer link to anything." msgstr "" -"Ubah nama tautan di catatan-catatan lain dari \"%1\" menjadi \"%2\"?\n" +"Ubah nama tautan di catatan-catatan lain dari \"" +"%1\" menjadi \"%2\"?\n" "\n" "Bila Anda tidak mengubah nama tautan, mereka tak akan merujuk kemanapun lagi." @@ -1801,8 +1827,8 @@ "This note is a template note. It determines the default content of regular " "notes, and will not show up in the note menu or search window." msgstr "" -"Catatan ini adalah catatan templat. Ini menentukan isi baku dari catatan biasa, " -"dan tak akan muncul di menu catatan atau jendela pencarian." +"Catatan ini adalah catatan templat. Ini menentukan isi baku dari catatan " +"biasa, dan tak akan muncul di menu catatan atau jendela pencarian." #: ../src/notewindow.cpp:449 msgid "Convert to regular note" @@ -1910,8 +1936,8 @@ #: ../src/preferencesdialog.cpp:269 msgid "" -"Misspellings will be underlined in red, with correct spelling suggestions shown " -"in the context menu." +"Misspellings will be underlined in red, with correct spelling suggestions " +"shown in the context menu." msgstr "" "Salah eja akan digaris-bawahi warna merah, dengan saran pengejaan yang benar " "ditampilkan di menu konteks." @@ -1948,8 +1974,8 @@ #: ../src/preferencesdialog.cpp:333 msgid "" -"Use the new note template to specify the text that should be used when creating " -"a new note." +"Use the new note template to specify the text that should be used when " +"creating a new note." msgstr "" "Gunakan templat catatan baru untuk menyatakan teks yang mesti dipakai ketika " "membuat suatu catatan baru." @@ -1977,7 +2003,7 @@ #: ../src/preferencesdialog.cpp:403 msgid "" "Enable this option to create links for URLs. Clicking will open URL with " -"appropriate program." +"apropriate program." msgstr "" "Fungsikan opsi ini untuk membuat taut bagi URL. Mengklik akan membuka URL " "dengan program yang sesuai." @@ -1992,8 +2018,8 @@ "Enable this option to highlight words ThatLookLikeThis. Clicking the " "word will create a note with that name." msgstr "" -"Fungsikan opsi ini untuk menandai kata BerpenampilanSepertiIni. Mengklik " -"kata tersebut akan membuat satu catatan dengan nama tersebut." +"Fungsikan opsi ini untuk menandai kata BerpenampilanSepertiIni. " +"Mengklik kata tersebut akan membuat satu catatan dengan nama tersebut." #. Hotkeys... #: ../src/preferencesdialog.cpp:441 @@ -2002,12 +2028,13 @@ #: ../src/preferencesdialog.cpp:442 msgid "" -"Hotkeys allow you to quickly access your notes from anywhere with a keypress. " -"Example Hotkeys: <Control><Shift>F11, <Alt>N" -msgstr "" -"Kunci pintas memungkinkan Anda mengakses secara cepat catatan Anda dari manapun " -"dengan menekan tombol. Contoh Kunci Pintas: <Control><Shift>F11, <Alt>N" +"Hotkeys allow you to quickly access your notes from anywhere with a " +"keypress. Example Hotkeys: <Control><Shift>F11, <" +"Alt>N" +msgstr "" +"Kunci pintas memungkinkan Anda mengakses secara cepat catatan Anda dari " +"manapun dengan menekan tombol. Contoh Kunci Pintas: <Control><" +"Shift>F11, <Alt>N" #. Show notes menu keybinding... #: ../src/preferencesdialog.cpp:464 @@ -2079,8 +2106,8 @@ #: ../src/preferencesdialog.cpp:1158 msgid "" -"When a conflict is detected between a local note and a note on the configured " -"synchronization server:" +"When a conflict is detected between a local note and a note on the " +"configured synchronization server:" msgstr "" "Ketika konflik terdeteksi antara suatu catatan lokal dan catatan pada server " "penyelarasan yang terkonfigurasi:" @@ -2104,8 +2131,8 @@ #: ../src/preferencesdialog.cpp:1273 msgid "" -"Clearing your synchronization settings is not recommended. You may be forced " -"to synchronize all of your notes again when you save new settings." +"Clearing your synchronization settings is not recommended. You may be " +"forced to synchronize all of your notes again when you save new settings." msgstr "" "Tak disarankan untuk membersihkan pengaturan penyelarasan Anda. Anda mungkin " "dipaksa untuk menyelaraskan semua catatan Anda lagi ketika Anda menyimpan " @@ -2117,9 +2144,9 @@ #: ../src/preferencesdialog.cpp:1284 msgid "" -"You have disabled the configured synchronization service. Your synchronization " -"settings will now be cleared. You may be forced to synchronize all of your " -"notes again when you save new settings." +"You have disabled the configured synchronization service. Your " +"synchronization settings will now be cleared. You may be forced to " +"synchronize all of your notes again when you save new settings." msgstr "" "Anda telah mematikan layanan penyelarasan yang dikonfigurasi. Pengaturan " "penyelarasan Anda kini akan dibersihkan. Anda mungkin dipaksa untuk " @@ -2134,12 +2161,13 @@ "Gnote is ready to synchronize your notes. Would you like to synchronize them " "now?" msgstr "" -"Gnote siap menyelaraskan catatan Anda. Apakah Anda ingin menyelaraskan sekarang?" +"Gnote siap menyelaraskan catatan Anda. Apakah Anda ingin menyelaraskan " +"sekarang?" #: ../src/preferencesdialog.cpp:1375 msgid "" -"Please check your information and try again. The log file %1% may contain more " -"information about the error." +"Please check your information and try again. The log file %1% may contain " +"more information about the error." msgstr "" "Silakan periksa informasi Anda dan coba lagi. Berkas log %1% mungkin memuat " "lebih banyak informasi tentang galat." @@ -2329,11 +2357,11 @@ #: ../src/synchronization/filesystemsyncserver.cpp:369 #, c-format msgid "" -"Exception during server cleanup while committing. Server integrity is OK, but " -"there may be some excess files floating around. Here's the error: %s\n" +"Exception during server cleanup while committing. Server integrity is OK, " +"but there may be some excess files floating around. Here's the error: %s\n" msgstr "" -"Eksepsi ketika pembersihan server ketika mengkomit. Integritas server OK, tapi " -"mungkin ada beberapa berkas sisa terserak. Inilah galatnya: %s\n" +"Eksepsi ketika pembersihan server ketika mengkomit. Integritas server OK, " +"tapi mungkin ada beberapa berkas sisa terserak. Inilah galatnya: %s\n" #: ../src/synchronization/filesystemsyncserver.cpp:609 #, c-format @@ -2342,11 +2370,11 @@ #: ../src/synchronization/fusesyncserviceaddin.cpp:115 msgid "" -"This synchronization addin is not supported on your computer. Please make sure " -"you have FUSE and %1% correctly installed and configured" +"This synchronization addin is not supported on your computer. Please make " +"sure you have FUSE and %1% correctly installed and configured" msgstr "" -"Addin penyelarasan ini tak didukung pada komputer Anda. Harap pastikan bahwa " -"FUSE dan %1% terpasang dan terkonfigurasi dengan benar." +"Addin penyelarasan ini tak didukung pada komputer Anda. Harap pastikan " +"bahwa FUSE dan %1% terpasang dan terkonfigurasi dengan benar." #: ../src/synchronization/fusesyncserviceaddin.cpp:158 msgid "Could not read testfile." @@ -2369,7 +2397,7 @@ msgstr "FUSE tak dapat difungsikan." #: ../src/synchronization/fusesyncserviceaddin.cpp:246 -msgid "An error occurred while connecting to the specified server" +msgid "An error ocurred while connecting to the specified server" msgstr "Terjadi galat ketika menyambung ke server yang dinyatakan" #. TRANSLATORS: %s is file @@ -2416,8 +2444,8 @@ #: ../src/synchronization/syncdialog.cpp:139 msgid "" -"The server version of \"%1%\" conflicts with your local note. What do you want " -"to do with your local note?" +"The server version of \"%1%\" conflicts with your local note. What do you " +"want to do with your local note?" msgstr "" "Versi server \"%1%\" konflik dengan catatan lokal Anda. Apa yang ingin Anda " "lakukan terhadap catatan lokal Anda?" @@ -2473,11 +2501,11 @@ #: ../src/synchronization/syncdialog.cpp:517 msgid "" -"One of your other computers is currently synchronizing. Please wait 2 minutes " -"and try again." +"One of your other computers is currently synchronizing. Please wait 2 " +"minutes and try again." msgstr "" -"Satu dari komputer lain Anda kini sedang menyelaraskan. Silakan tunggu 2 menit " -"dan coba lagi." +"Satu dari komputer lain Anda kini sedang menyelaraskan. Silakan tunggu 2 " +"menit dan coba lagi." #: ../src/synchronization/syncdialog.cpp:521 msgid "Preparing to download updates from server..." @@ -2501,7 +2529,8 @@ #: ../src/synchronization/syncdialog.cpp:532 msgid "Could not synchronize notes. Check the details below and try again." -msgstr "Tak bisa menyelaraskan catatan. Periksa rincian di bawah dan coba lagi." +msgstr "" +"Tak bisa menyelaraskan catatan. Periksa rincian di bawah dan coba lagi." #: ../src/synchronization/syncdialog.cpp:538 msgid "Synchronization Complete" @@ -2530,7 +2559,8 @@ #: ../src/synchronization/syncdialog.cpp:548 msgid "You canceled the synchronization. You may close the window now." -msgstr "Anda membatalkan penyelarasan. Anda boleh menutup jendela ini sekarang." +msgstr "" +"Anda membatalkan penyelarasan. Anda boleh menutup jendela ini sekarang." #: ../src/synchronization/syncdialog.cpp:552 msgid "Synchronization Not Configured" @@ -2615,11 +2645,11 @@ #: ../src/synchronization/syncutils.cpp:149 #: ../src/synchronization/syncutils.cpp:181 msgid "" -"The FUSE module could not be loaded. Please check that it is installed properly " -"and try again." +"The FUSE module could not be loaded. Please check that it is installed " +"properly and try again." msgstr "" -"Modul FUSE tak bisa dimuat. Harap periksa bahwa itu telah dipasang dengan benar " -"dan coba lagi." +"Modul FUSE tak bisa dimuat. Harap periksa bahwa itu telah dipasang dengan " +"benar dan coba lagi." #: ../src/synchronization/syncutils.cpp:157 msgid "Enable FUSE?" @@ -2631,8 +2661,9 @@ msgid "" "The synchronization you've chosen requires the FUSE module to be loaded.\n" "\n" -"To avoid getting this prompt in the future, you should load FUSE at startup. " -"Add \"modprobe fuse\" to /etc/init.d/boot.local or \"fuse\" to /etc/modules." +"To avoid getting this prompt in the future, you should load FUSE at " +"startup. Add \"modprobe fuse\" to /etc/init.d/boot.local or \"fuse\" to /" +"etc/modules." msgstr "" "Penyelarasan yang telah Anda pilih memerlukan pemuatan modul FUSE.\n" "\n" @@ -2654,8 +2685,8 @@ #: ../src/utils.cpp:144 msgid "" -"The \"Gnote Manual\" could not be found. Please verify that your installation " -"has been completed successfully." +"The \"Gnote Manual\" could not be found. Please verify that your " +"installation has been completed successfully." msgstr "" "\"Manual Gnote\" tak ditemukan. Silahkan periksa bahwa instalasi Anda telah " "lengkap dan sukses." @@ -2720,11 +2751,11 @@ #: ../src/watchers.cpp:231 msgid "" -"A note with the title %1% already exists. Please choose another name for " -"this note before continuing." +"A note with the title %1% already exists. Please choose another name " +"for this note before continuing." msgstr "" -"Catatan dengan judul %1% telah ada. Silakan pilih nama lain bagi catatan " -"ini sebelum melanjutkan." +"Catatan dengan judul %1% telah ada. Silakan pilih nama lain bagi " +"catatan ini sebelum melanjutkan." #: ../src/watchers.cpp:246 msgid "Note title taken" diff -Nru gnote-3.14.2/po/LINGUAS gnote-3.16.0/po/LINGUAS --- gnote-3.14.2/po/LINGUAS 2014-08-05 20:26:03.000000000 +0000 +++ gnote-3.16.0/po/LINGUAS 2015-03-26 20:50:43.000000000 +0000 @@ -3,6 +3,7 @@ as bg bn_IN +bs ca ca@valencia cs @@ -36,6 +37,7 @@ pt_BR ro ru +sk sl sr sr@latin diff -Nru gnote-3.14.2/po/lt.po gnote-3.16.0/po/lt.po --- gnote-3.14.2/po/lt.po 2015-01-17 14:55:53.000000000 +0000 +++ gnote-3.16.0/po/lt.po 2015-03-07 18:13:28.000000000 +0000 @@ -12,8 +12,8 @@ "Project-Id-Version: gnote.master\n" "Report-Msgid-Bugs-To: http://bugzilla.gnome.org/enter_bug.cgi?" "product=gnote&keywords=I18N+L10N&component=general\n" -"POT-Creation-Date: 2015-01-17 13:09+0000\n" -"PO-Revision-Date: 2015-01-17 16:55+0200\n" +"POT-Creation-Date: 2015-02-09 09:26+0000\n" +"PO-Revision-Date: 2015-02-09 22:29+0200\n" "Last-Translator: Aurimas Černius \n" "Language-Team: Lietuvių \n" "Language: lt\n" @@ -329,15 +329,8 @@ msgstr "Naudoti būsenos piktogramą paleidus kaip programą" #: ../data/org.gnome.gnote.gschema.xml.in.h:50 -msgid "" -"Has affect only when started as an application. When set to TRUE, shows a " -"status icon. If set to FALSE, Search All Notes window is used as main " -"application window, closing which makes application to exit." -msgstr "" -"Turi poveikį tik paleidus kaip programą. Kai nustatyta TEIGIAMA, rodo " -"būsenos piktogramą. Jei nustatyta NEIGIAMA, langas „Ieškoti visuose " -"rašteliuose“ naudojamas kaip pagrindinis programos langas, kurį užvėrus " -"programa baigia darbą." +msgid "Deprecated, has no effect." +msgstr "Pasenęs, neturi poveikio." #: ../data/org.gnome.gnote.gschema.xml.in.h:51 msgid "Open notes in new window" @@ -367,117 +360,37 @@ msgstr "Rodyti įtaiso meniu" #: ../data/org.gnome.gnote.gschema.xml.in.h:56 -msgid "" -"The global keybinding for showing the Gnote applet's menu. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such " -"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " -"special string \"disabled\", then there will be no keybinding for this " -"action." -msgstr "" -"Globalus klavišų susiejimas Gnote įtaiso meniu parodymui. Formato pavyzdys: " -"„<Control>a“ ar „<Shift><Alt>F1“. Analizatorius yra gan " -"liberalus ir leidžia didžiąsias ir mažąsias raides, taip pat tokius " -"sutrumpinimus kaip „<Ctl>“ ir „<Ctrl>“. Jeigu nustatysite " -"parinktį į specialią eilutę „disabled“, šiam veiksmui nebus priskirtas joks " -"klavišų susiejimas." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:57 msgid "Open Start Here" msgstr "Atverti „pradėti čia“" -#: ../data/org.gnome.gnote.gschema.xml.in.h:58 -msgid "" -"The global keybinding for opening the \"Start Here\" note. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such " -"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " -"special string \"disabled\", then there will be no keybinding for this " -"action." -msgstr "" -"Globalus klavišų susiejimas „Pradėti čia“ raštelio atvėrimui. Formato " -"pavyzdys: „<Control>a“ ar „<Shift><Alt>F1“. Analizatorius " -"yra gan liberalus ir leidžia didžiąsias ir mažąsias raides, taip pat tokius " -"sutrumpinimus kaip „<Ctl>“ ir „<Ctrl>“. Jeigu nustatysite " -"parinktį į specialią eilutę „disabled“, šiam veiksmui nebus priskirtas joks " -"klavišų susiejimas." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:59 +#: ../data/org.gnome.gnote.gschema.xml.in.h:57 msgid "Create a new Note" msgstr "Sukurti naują raštelį" -#: ../data/org.gnome.gnote.gschema.xml.in.h:60 -msgid "" -"The global keybinding for creating and displaying a new Note. The format " -"looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " -"parser is fairly liberal and allows lower or upper case, and also " -"abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the " -"option to the special string \"disabled\", then there will be no keybinding " -"for this action." -msgstr "" -"Globalus klavišų susiejimas naujo raštelio kūrimui ir rodymui. Formato " -"pavyzdys: „<Control>a“ ar „<Shift><Alt>F1“. Analizatorius " -"yra gan liberalus ir leidžia didžiąsias ir mažąsias raides, taip pat tokius " -"sutrumpinimus kaip „<Ctl>“ ir „<Ctrl>“. Jeigu nustatysite " -"parinktį į specialią eilutę „disabled“, šiam veiksmui nebus priskirtas joks " -"klavišų susiejimas." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:61 +#: ../data/org.gnome.gnote.gschema.xml.in.h:58 msgid "Open Search Dialog" msgstr "Atverti paieškos dialogą" -#: ../data/org.gnome.gnote.gschema.xml.in.h:62 -msgid "" -"The global keybinding for opening the Note Search dialog. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such " -"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " -"special string \"disabled\", then there will be no keybinding for this " -"action." -msgstr "" -"Globalus klavišų susiejimas raštelių paieškos lango atvėrimui. Formato " -"pavyzdys: „<Control>a“ ar „<Shift><Alt>F1“. Analizatorius " -"yra gan liberalus ir leidžia didžiąsias ir mažąsias raides, taip pat tokius " -"sutrumpinimus kaip „<Ctl>“ ir „<Ctrl>“. Jeigu nustatysite " -"parinktį į specialią eilutę „disabled“, šiam veiksmui nebus priskirtas joks " -"klavišų susiejimas." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:63 +#: ../data/org.gnome.gnote.gschema.xml.in.h:59 msgid "Open Recent Changes" msgstr "Atverti paskutiniuosius pakeitimus" -#: ../data/org.gnome.gnote.gschema.xml.in.h:64 -msgid "" -"The global keybinding for opening the Recent Changes dialog. The format " -"looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " -"parser is fairly liberal and allows lower or upper case, and also " -"abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the " -"option to the special string \"disabled\", then there will be no keybinding " -"for this action." -msgstr "" -"Globalus klavišų susiejimas paskutinių pakeitimų lango atvėrimui. Formato " -"pavyzdys: „<Control>a“ ar „<Shift><Alt>F1“. Analizatorius " -"yra gan liberalus ir leidžia didžiąsias ir mažąsias raides, taip pat tokius " -"sutrumpinimus kaip „<Ctl>“ ir „<Ctrl>“. Jeigu nustatysite " -"parinktį į specialią eilutę „disabled“, šiam veiksmui nebus priskirtas joks " -"klavišų susiejimas." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:65 +#: ../data/org.gnome.gnote.gschema.xml.in.h:60 msgid "HTML Export Last Directory" msgstr "Paskutinis eksportavimo į HTML aplankas" -#: ../data/org.gnome.gnote.gschema.xml.in.h:66 +#: ../data/org.gnome.gnote.gschema.xml.in.h:61 msgid "" "The last directory a note was exported to using the Export To HTML plugin." msgstr "" "Paskutinis aplankas, į kurį buvo eksportuotas raštelis, naudojant " "„Eksportuoti į HTML“ įskiepį." -#: ../data/org.gnome.gnote.gschema.xml.in.h:67 +#: ../data/org.gnome.gnote.gschema.xml.in.h:62 msgid "HTML Export Linked Notes" msgstr "Eksportuoti į HTML susietus raštelius" -#: ../data/org.gnome.gnote.gschema.xml.in.h:68 +#: ../data/org.gnome.gnote.gschema.xml.in.h:63 msgid "" "The last setting for the 'Export linked notes' checkbox in the Export to " "HTML plugin." @@ -485,11 +398,11 @@ "Paskutinis „Eksportuoti susietus raštelius“ žymimosios akutės pažymėjimas " "„Eksportuoti į HTML“ įskiepyje." -#: ../data/org.gnome.gnote.gschema.xml.in.h:69 +#: ../data/org.gnome.gnote.gschema.xml.in.h:64 msgid "HTML Export All Linked Notes" msgstr "Eksportuoti į HTML visus susietus raštelius" -#: ../data/org.gnome.gnote.gschema.xml.in.h:70 +#: ../data/org.gnome.gnote.gschema.xml.in.h:65 msgid "" "The last setting for the 'Include all other linked notes' checkbox in the " "Export to HTML plugin. This setting is used in conjunction with the 'HTML " @@ -502,11 +415,11 @@ "norint nustatyti, ar visi rašteliai (rasti rekursyviai) turėtų būti įtraukti " "eksportuojant į HTML." -#: ../data/org.gnome.gnote.gschema.xml.in.h:71 +#: ../data/org.gnome.gnote.gschema.xml.in.h:66 msgid "Synchronization Client ID" msgstr "Sinchronizavimo kliento ID" -#: ../data/org.gnome.gnote.gschema.xml.in.h:72 +#: ../data/org.gnome.gnote.gschema.xml.in.h:67 #| msgid "" #| "Unique identifier for this Gnote client, used when communicating with a " #| "sychronization server." @@ -517,11 +430,11 @@ "Unikalus šio Gnote kliento identifikatorius, naudojamas bendraujant su " "sinchronizavimo serveriu." -#: ../data/org.gnome.gnote.gschema.xml.in.h:73 +#: ../data/org.gnome.gnote.gschema.xml.in.h:68 msgid "Synchronization Local Server Path" msgstr "Sinchronizavimo vietinio serverio kelias" -#: ../data/org.gnome.gnote.gschema.xml.in.h:74 +#: ../data/org.gnome.gnote.gschema.xml.in.h:69 msgid "" "Path to the synchronization server when using the filesystem synchronization " "service addin." @@ -529,11 +442,11 @@ "Kelias iki sinchronizavimo serverio, kai naudojamas failų sistemos " "sinchronizavimo tarnybos priedas." -#: ../data/org.gnome.gnote.gschema.xml.in.h:75 +#: ../data/org.gnome.gnote.gschema.xml.in.h:70 msgid "Selected Synchronization Service Addin" msgstr "Pasirinktas sinchronizavimo tarnybos priedas" -#: ../data/org.gnome.gnote.gschema.xml.in.h:76 +#: ../data/org.gnome.gnote.gschema.xml.in.h:71 msgid "" "Unique identifier for the currently configured note synchronization service " "addin." @@ -541,11 +454,11 @@ "Unikalus dabar sukonfigūruoto raštelių sinchronizavimo tarnybos priedo " "identifikatorius." -#: ../data/org.gnome.gnote.gschema.xml.in.h:77 +#: ../data/org.gnome.gnote.gschema.xml.in.h:72 msgid "Note Synchronization Conflict Saved Behavior" msgstr "Raštelių sinchronizavimo konflikto išsaugotas veikimas" -#: ../data/org.gnome.gnote.gschema.xml.in.h:78 +#: ../data/org.gnome.gnote.gschema.xml.in.h:73 msgid "" "Integer value indicating if there is a preference to always perform a " "specific behavior when a conflict is detected, instead of prompting the " @@ -559,11 +472,11 @@ "paklaustas, kai atsitinka konfliktas, kad jis galėtų susidoroti su kiekvienu " "konfliktu atsižvelgdamas į konkrečią situaciją." -#: ../data/org.gnome.gnote.gschema.xml.in.h:79 +#: ../data/org.gnome.gnote.gschema.xml.in.h:74 msgid "Automatic Background Synchronization Timeout" msgstr "Automatinio foninio sinchronizavimo laikotarpis" -#: ../data/org.gnome.gnote.gschema.xml.in.h:80 +#: ../data/org.gnome.gnote.gschema.xml.in.h:75 msgid "" "Integer value indicating how frequently to perform a background sync of your " "notes (when sync is configured). Any value less than 1 indicates that " @@ -575,11 +488,11 @@ "už 1 nurodo, kad automatinė sinchronizacija yra išjungta. Mažiausia tinkama " "teigiama vertė yra 5. Vertė yra minutėmis." -#: ../data/org.gnome.gnote.gschema.xml.in.h:81 +#: ../data/org.gnome.gnote.gschema.xml.in.h:76 msgid "Accept SSL Certificates" msgstr "Priimti SSL liudijimus" -#: ../data/org.gnome.gnote.gschema.xml.in.h:82 +#: ../data/org.gnome.gnote.gschema.xml.in.h:77 msgid "" "Use wdfs option \"-ac\" to accept SSL certificates without prompting the " "user." @@ -587,37 +500,37 @@ "Naudokite wdfs parinktį „-ac“, jei norite priimti SSL liudijimus neklausiant " "naudotojo." -#: ../data/org.gnome.gnote.gschema.xml.in.h:83 +#: ../data/org.gnome.gnote.gschema.xml.in.h:78 msgid "Share URL" msgstr "Viešinio URL" -#: ../data/org.gnome.gnote.gschema.xml.in.h:84 +#: ../data/org.gnome.gnote.gschema.xml.in.h:79 msgid "WebDAV share URL where notes are synchronized to." msgstr "WebDAV viešinio URL, kur bus sinchronizuojami rašteliai." -#: ../data/org.gnome.gnote.gschema.xml.in.h:85 +#: ../data/org.gnome.gnote.gschema.xml.in.h:80 msgid "Share username" msgstr "Viešinio naudotojo vardas" -#: ../data/org.gnome.gnote.gschema.xml.in.h:86 +#: ../data/org.gnome.gnote.gschema.xml.in.h:81 msgid "Username to access WebDAV share." msgstr "Naudotojo vardas WebDAV viešiniui pasiekti." -#: ../data/org.gnome.gnote.gschema.xml.in.h:87 +#: ../data/org.gnome.gnote.gschema.xml.in.h:82 msgid "Timestamp format" msgstr "Laiko žymės formatas" -#: ../data/org.gnome.gnote.gschema.xml.in.h:88 +#: ../data/org.gnome.gnote.gschema.xml.in.h:83 msgid "" "The date format that is used for the timestamp. It follows the format of " "strftime(3)." msgstr "Datos ir laiko formatas. Įvedamas strftime(3) formatu." -#: ../data/org.gnome.gnote.gschema.xml.in.h:89 +#: ../data/org.gnome.gnote.gschema.xml.in.h:84 msgid "Time between checks" msgstr "Laiko tarpas tarp tikrinimų" -#: ../data/org.gnome.gnote.gschema.xml.in.h:90 +#: ../data/org.gnome.gnote.gschema.xml.in.h:85 msgid "" "Time interval between note directory checks (in seconds). Min value is 5." msgstr "" @@ -625,7 +538,6 @@ "yra 5." #: ../src/actionmanager.cpp:84 ../src/actionmanager.cpp:171 -#: ../src/tray.cpp:465 msgid "_Quit" msgstr "Iš_eiti" @@ -634,7 +546,6 @@ msgstr "Išjungti Gnote" #: ../src/actionmanager.cpp:89 ../src/actionmanager.cpp:168 -#: ../src/tray.cpp:448 msgid "_Preferences" msgstr "_Nustatymai" @@ -662,19 +573,19 @@ msgid "TrayIcon" msgstr "Pranešimų skydelio piktograma" -#: ../src/actionmanager.cpp:107 ../src/tray.cpp:225 +#: ../src/actionmanager.cpp:107 msgid "Create _New Note" msgstr "Sukurti _naują raštelį" -#: ../src/actionmanager.cpp:107 ../src/tray.cpp:227 +#: ../src/actionmanager.cpp:107 msgid "Create a new note" msgstr "Sukurti naują raštelį" -#: ../src/actionmanager.cpp:112 ../src/tray.cpp:234 +#: ../src/actionmanager.cpp:112 msgid "_Search All Notes" msgstr "_Ieškoti visuose rašteliuose" -#: ../src/actionmanager.cpp:112 ../src/tray.cpp:236 +#: ../src/actionmanager.cpp:112 msgid "Open the Search All Notes window" msgstr "Atverti langą Ieškoti visuose rašteliuose" @@ -686,7 +597,7 @@ msgid "New _Window" msgstr "Naujas _langas" -#: ../src/actionmanager.cpp:169 ../src/tray.cpp:453 +#: ../src/actionmanager.cpp:169 msgid "_Help" msgstr "_Žinynas" @@ -1027,10 +938,6 @@ msgid "NoteDirectoryWatcher: Update aborted, error parsing %s: %s" msgstr "NoteDirectoryWatcher: atnaujinimas nutrauktas, klaida skaitant %s: %s" -#: ../src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp:35 -msgid "_Directory check interval:" -msgstr "_Aplanko tikrinimo intervalas" - #: ../src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in.in.h:1 msgid "Note Directory Watcher" msgstr "Raštelių katalogo stebėtojas" @@ -1043,6 +950,10 @@ msgid "Aurimas Černius and Tomboy original authors" msgstr "Aurimas Černius ir Tomboy kūrėjai" +#: ../src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp:35 +msgid "_Directory check interval:" +msgstr "_Aplanko tikrinimo intervalas" + #: ../src/addins/noteoftheday/noteoftheday.cpp:33 msgid "Today: Template" msgstr "Šiandien: šablonas" @@ -1154,8 +1065,8 @@ msgid "Pierre-Yves Luyten" msgstr "Pierre-Yves Luyten" -#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:1 #: ../src/addins/specialnotes/specialnotesapplicationaddin.cpp:38 +#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:1 msgid "Special Notes" msgstr "Specialūs rašteliai" @@ -1373,22 +1284,22 @@ msgid "Exception thrown when creating note: %s" msgstr "Kilo išskirtinė situacija kuriant raštelį: %s" -#: ../src/gnote.cpp:200 +#: ../src/gnote.cpp:185 msgid "Gnote is already running. Exiting..." msgstr "Gnote jau paleista. Išeinama..." -#: ../src/gnote.cpp:365 +#: ../src/gnote.cpp:289 msgid "and Tomboy original authors." msgstr "ir Tomboy kūrėjai." -#: ../src/gnote.cpp:371 +#: ../src/gnote.cpp:295 msgid "translator-credits" msgstr "" "Aurimas Černius \n" "Giedrius Slavinskas \n" "Žygimantas Beručka " -#: ../src/gnote.cpp:380 +#: ../src/gnote.cpp:304 #| msgid "" #| "Copyright © 2010-2014 Aurimas Cernius\n" #| "Copyright © 2009-2011 Debarshi Ray\n" @@ -1405,79 +1316,79 @@ "Autorinės teisės priklauso © 2009 Hubert Figuiere\n" "Autorinės teisės priklauso © 2004-2009 Tomboy originalo autoriams." -#: ../src/gnote.cpp:384 +#: ../src/gnote.cpp:308 msgid "A simple and easy to use desktop note-taking application." msgstr "Paprasta ir lengvai naudojama darbalaukio užrašinė." -#: ../src/gnote.cpp:395 +#: ../src/gnote.cpp:319 msgid "Homepage" msgstr "Tinklalapis" -#: ../src/gnote.cpp:570 +#: ../src/gnote.cpp:494 msgid "Run Gnote in background." msgstr "Paleisti Gnote fone." -#: ../src/gnote.cpp:571 +#: ../src/gnote.cpp:495 msgid "Run Gnote as GNOME Shell search provider." msgstr "Vykdyti Gnote kaip GNOME Shell paieškos tiekėją." -#: ../src/gnote.cpp:572 +#: ../src/gnote.cpp:496 msgid "Specify the path of the directory containing the notes." msgstr "Nurodykite kelią iki aplanko su rašteliais." -#: ../src/gnote.cpp:572 +#: ../src/gnote.cpp:496 msgid "path" msgstr "kelias" -#: ../src/gnote.cpp:573 +#: ../src/gnote.cpp:497 msgid "Open the search all notes window with the search text." msgstr "Atverti paieškos visuose rašteliuose langą su ieškomu tekstu." -#: ../src/gnote.cpp:573 ../src/gnote.cpp:578 +#: ../src/gnote.cpp:497 ../src/gnote.cpp:502 msgid "text" msgstr "tekstas" -#: ../src/gnote.cpp:574 +#: ../src/gnote.cpp:498 msgid "Print version information." msgstr "Rodyti versijos informaciją." -#: ../src/gnote.cpp:575 +#: ../src/gnote.cpp:499 msgid "Create and display a new note, with a optional title." msgstr "Sukurti ir parodyti naują raštelį, pavadinimas nebūtinas." -#: ../src/gnote.cpp:575 +#: ../src/gnote.cpp:499 msgid "title" msgstr "pavadinimas" -#: ../src/gnote.cpp:576 +#: ../src/gnote.cpp:500 msgid "Display the existing note matching title." msgstr "Parodyti esamą raštelį su tokiu pavadinimu." -#: ../src/gnote.cpp:576 +#: ../src/gnote.cpp:500 msgid "title/url" msgstr "pavadinimas/url" -#: ../src/gnote.cpp:577 +#: ../src/gnote.cpp:501 msgid "Display the 'Start Here' note." msgstr "Raštelis „Pradėkite čia“" -#: ../src/gnote.cpp:578 +#: ../src/gnote.cpp:502 msgid "Search and highlight text in the opened note." msgstr "Surasti ir paryškinti tekstą atvertame raštelyje." -#: ../src/gnote.cpp:582 +#: ../src/gnote.cpp:506 msgid "A note taking application" msgstr "Raštelių rašymo programa" -#: ../src/gnote.cpp:582 +#: ../src/gnote.cpp:506 msgid "Gnote options at launch" msgstr "Gnote parinktys paleidžiant" -#: ../src/gnote.cpp:659 +#: ../src/gnote.cpp:583 msgid "Could not connect to remote instance." msgstr "Nepavyko prisijungti prie nutolusios programos." -#: ../src/gnote.cpp:775 +#: ../src/gnote.cpp:699 msgid "Version %1%" msgstr "Versija %1%" @@ -1495,6 +1406,23 @@ msgid "Window is not embedded" msgstr "Langas nėra įtaisytas" +#. Probably IOException or UnauthorizedAccessException? +#: ../src/notebase.cpp:200 ../src/note.cpp:382 +#, c-format +msgid "Exception while saving note: %s" +msgstr "Kilo išskirtinė situacija įrašant raštelį: %s" + +#. write failure, but not critical +#: ../src/notebase.cpp:444 +#, c-format +msgid "Failed to update note format: %s" +msgstr "Nepavyko atnaujinti raštelio formato: %s" + +#: ../src/notebase.cpp:568 +#, c-format +msgid "Filesystem error: %s" +msgstr "Failų sistemos klaida: %s" + #: ../src/notebooks/createnotebookdialog.cpp:41 msgid "Create Notebook" msgstr "Sukurti užrašinę" @@ -1552,7 +1480,7 @@ "Rašteliai, priklausantys šiai užrašinei, nebus ištrinti, tačiau jie nebebus " "susieti su šia užrašine. Veiksmas nebegalės būti atšauktas." -#: ../src/notebooks/notebookmenuitem.cpp:35 +#: ../src/notebooks/notebookmenuitem.cpp:34 msgid "No notebook" msgstr "Jokios užrašinės" @@ -1560,15 +1488,16 @@ msgid "New \"%1%\" Note" msgstr "Naujas „%1%“ raštelis" -#: ../src/notebooks/notebooknoteaddin.cpp:81 -msgid "Place this note into a notebook" -msgstr "Įkelkite šį raštelį į užrašinę" - -#: ../src/notebooks/notebooknoteaddin.cpp:191 +#: ../src/notebooks/notebooknoteaddin.cpp:72 msgid "Notebook" msgstr "Užrašinė" -#: ../src/notebooks/notebooknoteaddin.cpp:214 +#: ../src/notebooks/notebooknoteaddin.cpp:73 +msgid "Place this note into a notebook" +msgstr "Įkelkite šį raštelį į užrašinę" + +#. Add new notebook item +#: ../src/notebooks/notebooknoteaddin.cpp:153 msgid "_New notebook..." msgstr "Nauja _užrašinė..." @@ -1628,12 +1557,6 @@ "vietos diske ir ar turite teises keisti aplanką ~/.local/share/gnote. " "Išsamesnę informaciją galima rasti faile ~/.gnote.log." -#. Probably IOException or UnauthorizedAccessException? -#: ../src/note.cpp:382 ../src/notebase.cpp:200 -#, c-format -msgid "Exception while saving note: %s" -msgstr "Kilo išskirtinė situacija įrašant raštelį: %s" - #: ../src/note.cpp:474 #, c-format msgid "Error while saving: %s" @@ -1643,16 +1566,13 @@ msgid "Setting text content for closed notes not supported" msgstr "Tekstinio turinio nustatymas užvertiems rašteliams nepalaikomas" -#. write failure, but not critical -#: ../src/notebase.cpp:444 -#, c-format -msgid "Failed to update note format: %s" -msgstr "Nepavyko atnaujinti raštelio formato: %s" +#: ../src/notemanagerbase.cpp:105 ../src/preferencesdialog.cpp:320 +msgid "New Note Template" +msgstr "Naujo raštelio šablonas" -#: ../src/notebase.cpp:568 -#, c-format -msgid "Filesystem error: %s" -msgstr "Failų sistemos klaida: %s" +#: ../src/notemanagerbase.cpp:359 +msgid "Describe your new note here." +msgstr "Čia aprašykite naują raštelį" #: ../src/notemanager.cpp:133 msgid "" @@ -1743,14 +1663,6 @@ msgid "Error parsing note XML, skipping \"%s\": %s" msgstr "Klaida skaitant raštelio XML, praleidžiamas „%s“: %s" -#: ../src/notemanagerbase.cpp:105 ../src/preferencesdialog.cpp:332 -msgid "New Note Template" -msgstr "Naujo raštelio šablonas" - -#: ../src/notemanagerbase.cpp:359 -msgid "Describe your new note here." -msgstr "Čia aprašykite naują raštelį" - #: ../src/noterenamedialog.cpp:123 msgid "Rename Note Links?" msgstr "Pervadinti saitus į raštelį?" @@ -1912,43 +1824,30 @@ msgid "Links" msgstr "Saitai" -#: ../src/preferencesdialog.cpp:125 -msgid "Hotkeys" -msgstr "Spartieji klavišai" - #. TRANSLATORS: Addin category. -#: ../src/preferencesdialog.cpp:129 ../src/sharp/addinstreemodel.cpp:164 +#: ../src/preferencesdialog.cpp:125 ../src/sharp/addinstreemodel.cpp:164 msgid "Synchronization" msgstr "Sinchronizacija" -#: ../src/preferencesdialog.cpp:131 +#: ../src/preferencesdialog.cpp:127 msgid "Plugins" msgstr "Įskiepiai" -#: ../src/preferencesdialog.cpp:208 +#: ../src/preferencesdialog.cpp:204 #, c-format msgid "Plugin %s is absent" msgstr "Trūksta įskiepio %s" -#. Status icon -#: ../src/preferencesdialog.cpp:247 -msgid "Use status _icon" -msgstr "Naudoti _būsenos piktogramą" - -#: ../src/preferencesdialog.cpp:248 -msgid "Show icon in tray, which is the central place of control." -msgstr "Rodyti dėkle piktogramą, kuri yra pagrindinis valdymo centras." - #. Open in new window -#: ../src/preferencesdialog.cpp:255 +#: ../src/preferencesdialog.cpp:243 msgid "Always _open notes in new window" msgstr "Visada _atverti raštelius naujame lange" -#: ../src/preferencesdialog.cpp:268 +#: ../src/preferencesdialog.cpp:256 msgid "_Spell check while typing" msgstr "_Rašant tekstą tikrinti rašybą" -#: ../src/preferencesdialog.cpp:269 +#: ../src/preferencesdialog.cpp:257 msgid "" "Misspellings will be underlined in red, with correct spelling suggestions " "shown in the context menu." @@ -1957,35 +1856,35 @@ "bus rodomi teisingos rašybos pasiūlymai." #. Auto bulleted list -#: ../src/preferencesdialog.cpp:279 +#: ../src/preferencesdialog.cpp:267 msgid "Enable auto-_bulleted lists" msgstr "Įjungti automatinį _sąrašų formatą" -#: ../src/preferencesdialog.cpp:280 +#: ../src/preferencesdialog.cpp:268 msgid "Start new bulleted list by starting new line with character \"-\"." msgstr "Pradėti naują punktų sąrašą pradedant naują eilutę simboliu „-“." -#: ../src/preferencesdialog.cpp:289 +#: ../src/preferencesdialog.cpp:277 msgid "Use custom _font" msgstr "Naudoti pasirinktinį šri_ftą" -#: ../src/preferencesdialog.cpp:307 +#: ../src/preferencesdialog.cpp:295 msgid "When renaming a linked note: " msgstr "Pervadinant raštelį:" -#: ../src/preferencesdialog.cpp:311 +#: ../src/preferencesdialog.cpp:299 msgid "Ask me what to do" msgstr "Klausti, ką daryti" -#: ../src/preferencesdialog.cpp:312 +#: ../src/preferencesdialog.cpp:300 msgid "Never rename links" msgstr "Niekada nepervadinti saitų" -#: ../src/preferencesdialog.cpp:313 +#: ../src/preferencesdialog.cpp:301 msgid "Always rename links" msgstr "Visada pervadinti saitus" -#: ../src/preferencesdialog.cpp:333 +#: ../src/preferencesdialog.cpp:321 msgid "" "Use the new note template to specify the text that should be used when " "creating a new note." @@ -1993,27 +1892,27 @@ "Nurodykite naujo raštelio šabloną norėdami nurodyti tekstą, kuris turėtų " "būti naudojamas kuriant naujus raštelius." -#: ../src/preferencesdialog.cpp:338 +#: ../src/preferencesdialog.cpp:326 msgid "Open New Note Template" msgstr "Atverti naujo raštelio šabloną" #. internal links -#: ../src/preferencesdialog.cpp:395 +#: ../src/preferencesdialog.cpp:383 msgid "_Automatically link to notes" msgstr "_Automatiškai susaistyti su rašteliais" -#: ../src/preferencesdialog.cpp:396 +#: ../src/preferencesdialog.cpp:384 msgid "Enable this option to create a link when text matches note title." msgstr "" "Įjunkite šį nustatymą saitui sukurti, kai tekstas sutampa su raštelio " "pavadinimu." #. URLs -#: ../src/preferencesdialog.cpp:402 +#: ../src/preferencesdialog.cpp:390 msgid "Create links for _URLs" msgstr "Sukurti saitus _URL" -#: ../src/preferencesdialog.cpp:403 +#: ../src/preferencesdialog.cpp:391 #| msgid "" #| "Enable this option to create links for URLs. Clicking will open URL with " #| "apropriate program." @@ -2025,11 +1924,11 @@ "su atitinkama programa." #. WikiWords... -#: ../src/preferencesdialog.cpp:410 +#: ../src/preferencesdialog.cpp:398 msgid "Highlight _WikiWords" msgstr "Paryškinti _VikiŽodžius" -#: ../src/preferencesdialog.cpp:411 +#: ../src/preferencesdialog.cpp:399 msgid "" "Enable this option to highlight words ThatLookLikeThis. Clicking the " "word will create a note with that name." @@ -2037,90 +1936,55 @@ "Įjunkite šią parinktį norėdami paryškinti žodžius, AtrodančiusŠtaiTaip. Spustelėjus tokį žodį bus sukurtas raštelis tokiu pavadinimu." -#. Hotkeys... -#: ../src/preferencesdialog.cpp:441 -msgid "Listen for _hotkeys" -msgstr "Priimti _sparčiuosius klavišus" - -#: ../src/preferencesdialog.cpp:442 -msgid "" -"Hotkeys allow you to quickly access your notes from anywhere with a " -"keypress. Example Hotkeys: <Control><Shift>F11, <" -"Alt>N" -msgstr "" -"Spartieji klavišai įgalina greitai pasiekti raštelius bet kuriuo metu " -"spustelėjus keletą klavišų. Sparčiųjų klavišų pavyzdžiai: <Control>" -"<Shift>F11, <Alt>N" - -#. Show notes menu keybinding... -#: ../src/preferencesdialog.cpp:464 -msgid "Show notes _menu" -msgstr "Rodyti raštelių _meniu" - -#. Open Start Here keybinding... -#: ../src/preferencesdialog.cpp:481 -msgid "Open \"_Start Here\"" -msgstr "Atverti „Pradėti čia“" - -#. Create new note keybinding... -#: ../src/preferencesdialog.cpp:497 -msgid "Create _new note" -msgstr "Sukurti _naują raštelį" - -#. Open Search window keybinding... -#: ../src/preferencesdialog.cpp:513 -msgid "Open Search _Window" -msgstr "Atverti paieškos _langą" - -#: ../src/preferencesdialog.cpp:553 +#: ../src/preferencesdialog.cpp:431 msgid "Ser_vice:" msgstr "Tar_nyba:" -#: ../src/preferencesdialog.cpp:609 ../src/preferencesdialog.cpp:1239 +#: ../src/preferencesdialog.cpp:487 ../src/preferencesdialog.cpp:1117 msgid "Not configurable" msgstr "Nekonfigūruojama" -#: ../src/preferencesdialog.cpp:636 +#: ../src/preferencesdialog.cpp:514 msgid "Automatical background s_ync interval (minutes)" msgstr "Automatinio foninio sinchronizavimo laikotarpis (minutėmis)" #. "Advanced..." button to bring up extra sync config dialog -#: ../src/preferencesdialog.cpp:660 +#: ../src/preferencesdialog.cpp:538 msgid "_Advanced..." msgstr "_Sudėtingesni..." -#: ../src/preferencesdialog.cpp:707 +#: ../src/preferencesdialog.cpp:585 msgid "The following plugins are installed:" msgstr "Šie įskiepiai yra įdiegti:" #. TODO: In a future version, add in an "Install Add-ins..." button #. TODO: In a future version, add in a "Repositories..." button -#: ../src/preferencesdialog.cpp:742 +#: ../src/preferencesdialog.cpp:620 msgid "_Enable" msgstr "Įj_ungti" -#: ../src/preferencesdialog.cpp:748 +#: ../src/preferencesdialog.cpp:626 msgid "_Disable" msgstr "_Išjungti" -#: ../src/preferencesdialog.cpp:906 +#: ../src/preferencesdialog.cpp:784 msgid "Not Implemented" msgstr "Neįgyvendinta" -#: ../src/preferencesdialog.cpp:922 +#: ../src/preferencesdialog.cpp:800 msgid "%1% Preferences" msgstr "%1% nustatymai" -#: ../src/preferencesdialog.cpp:1057 +#: ../src/preferencesdialog.cpp:935 msgid "Choose Note Font" msgstr "Pasirinkite raštelio šriftą" #. Create dialog -#: ../src/preferencesdialog.cpp:1155 +#: ../src/preferencesdialog.cpp:1033 msgid "Other Synchronization Options" msgstr "Kitos sinchronizacijos parinktys" -#: ../src/preferencesdialog.cpp:1158 +#: ../src/preferencesdialog.cpp:1036 msgid "" "When a conflict is detected between a local note and a note on the " "configured synchronization server:" @@ -2129,23 +1993,23 @@ "sinchronizacijos serveryje:" #. label.Xalign = 0; -#: ../src/preferencesdialog.cpp:1162 +#: ../src/preferencesdialog.cpp:1040 msgid "Always ask me what to do" msgstr "Visada klausti, ką daryti" -#: ../src/preferencesdialog.cpp:1166 +#: ../src/preferencesdialog.cpp:1044 msgid "Rename my local note" msgstr "Pervadinti mano vietinį raštelį" -#: ../src/preferencesdialog.cpp:1170 +#: ../src/preferencesdialog.cpp:1048 msgid "Replace my local note with the server's update" msgstr "Pakeisti mano vietinį raštelį serverio atnaujinimu" -#: ../src/preferencesdialog.cpp:1272 +#: ../src/preferencesdialog.cpp:1150 msgid "Are you sure?" msgstr "Ar esate tikras?" -#: ../src/preferencesdialog.cpp:1273 +#: ../src/preferencesdialog.cpp:1151 msgid "" "Clearing your synchronization settings is not recommended. You may be " "forced to synchronize all of your notes again when you save new settings." @@ -2154,11 +2018,11 @@ "naujo sinchronizuoti visus jūsų raštelius po to, kai įrašysite naujus " "nustatymus." -#: ../src/preferencesdialog.cpp:1283 +#: ../src/preferencesdialog.cpp:1161 msgid "Resetting Synchronization Settings" msgstr "Išvalomi sinchronizacijos nustatymai" -#: ../src/preferencesdialog.cpp:1284 +#: ../src/preferencesdialog.cpp:1162 msgid "" "You have disabled the configured synchronization service. Your " "synchronization settings will now be cleared. You may be forced to " @@ -2168,11 +2032,11 @@ "nustatymai dabar bus išvalyti. Jums gali tekti iš naujo sinchronizuoti " "visus jūsų raštelius po to, kai įrašysite naujus nustatymus." -#: ../src/preferencesdialog.cpp:1350 +#: ../src/preferencesdialog.cpp:1228 msgid "Connection successful" msgstr "Prisijungimas sėkmingas" -#: ../src/preferencesdialog.cpp:1351 +#: ../src/preferencesdialog.cpp:1229 msgid "" "Gnote is ready to synchronize your notes. Would you like to synchronize them " "now?" @@ -2180,7 +2044,7 @@ "Gnote yra pasiruošusi sinchronizuoti jūsų raštelius. Ar norite dabar juos " "sinchronizuoti?" -#: ../src/preferencesdialog.cpp:1375 +#: ../src/preferencesdialog.cpp:1253 msgid "" "Please check your information and try again. The log file %1% may contain " "more information about the error." @@ -2188,19 +2052,19 @@ "Patikrinkite savo informaciją ir bandykite vėl. Žurnalo failas %1% gali " "turėti daugiau informacijos apie klaidą." -#: ../src/preferencesdialog.cpp:1380 +#: ../src/preferencesdialog.cpp:1258 msgid "Error connecting" msgstr "Klaida jungiantis" -#: ../src/preferencesdialog.cpp:1443 +#: ../src/preferencesdialog.cpp:1321 msgid "Version:" msgstr "Versija:" -#: ../src/preferencesdialog.cpp:1446 +#: ../src/preferencesdialog.cpp:1324 msgid "Author:" msgstr "Autorius:" -#: ../src/preferencesdialog.cpp:1451 +#: ../src/preferencesdialog.cpp:1329 msgid "Copyright:" msgstr "Autorinės teisės:" @@ -2692,18 +2556,6 @@ "sistema. Pridėkite „modprobe fuse“ į /etc/init.d/boot.local arba „fuse“ į /" "etc/modules." -#: ../src/tray.cpp:54 -msgid "Take notes" -msgstr "Rašyti raštelius" - -#: ../src/tray.cpp:167 -msgid " (new)" -msgstr " (naujas)" - -#: ../src/tray.cpp:458 -msgid "_About Gnote" -msgstr "_Apie Gnote" - #: ../src/utils.cpp:144 msgid "" "The \"Gnote Manual\" could not be found. Please verify that your " @@ -2796,3 +2648,131 @@ #: ../src/watchers.cpp:680 msgid "_Open Link" msgstr "_Atverti nuorodą" + +#~ msgid "" +#~ "Has affect only when started as an application. When set to TRUE, shows a " +#~ "status icon. If set to FALSE, Search All Notes window is used as main " +#~ "application window, closing which makes application to exit." +#~ msgstr "" +#~ "Turi poveikį tik paleidus kaip programą. Kai nustatyta TEIGIAMA, rodo " +#~ "būsenos piktogramą. Jei nustatyta NEIGIAMA, langas „Ieškoti visuose " +#~ "rašteliuose“ naudojamas kaip pagrindinis programos langas, kurį užvėrus " +#~ "programa baigia darbą." + +#~ msgid "" +#~ "The global keybinding for showing the Gnote applet's menu. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Globalus klavišų susiejimas Gnote įtaiso meniu parodymui. Formato " +#~ "pavyzdys: „<Control>a“ ar „<Shift><Alt>F1“. " +#~ "Analizatorius yra gan liberalus ir leidžia didžiąsias ir mažąsias raides, " +#~ "taip pat tokius sutrumpinimus kaip „<Ctl>“ ir „<Ctrl>“. Jeigu " +#~ "nustatysite parinktį į specialią eilutę „disabled“, šiam veiksmui nebus " +#~ "priskirtas joks klavišų susiejimas." + +#~ msgid "" +#~ "The global keybinding for opening the \"Start Here\" note. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Globalus klavišų susiejimas „Pradėti čia“ raštelio atvėrimui. Formato " +#~ "pavyzdys: „<Control>a“ ar „<Shift><Alt>F1“. " +#~ "Analizatorius yra gan liberalus ir leidžia didžiąsias ir mažąsias raides, " +#~ "taip pat tokius sutrumpinimus kaip „<Ctl>“ ir „<Ctrl>“. Jeigu " +#~ "nustatysite parinktį į specialią eilutę „disabled“, šiam veiksmui nebus " +#~ "priskirtas joks klavišų susiejimas." + +#~ msgid "" +#~ "The global keybinding for creating and displaying a new Note. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Globalus klavišų susiejimas naujo raštelio kūrimui ir rodymui. Formato " +#~ "pavyzdys: „<Control>a“ ar „<Shift><Alt>F1“. " +#~ "Analizatorius yra gan liberalus ir leidžia didžiąsias ir mažąsias raides, " +#~ "taip pat tokius sutrumpinimus kaip „<Ctl>“ ir „<Ctrl>“. Jeigu " +#~ "nustatysite parinktį į specialią eilutę „disabled“, šiam veiksmui nebus " +#~ "priskirtas joks klavišų susiejimas." + +#~ msgid "" +#~ "The global keybinding for opening the Note Search dialog. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Globalus klavišų susiejimas raštelių paieškos lango atvėrimui. Formato " +#~ "pavyzdys: „<Control>a“ ar „<Shift><Alt>F1“. " +#~ "Analizatorius yra gan liberalus ir leidžia didžiąsias ir mažąsias raides, " +#~ "taip pat tokius sutrumpinimus kaip „<Ctl>“ ir „<Ctrl>“. Jeigu " +#~ "nustatysite parinktį į specialią eilutę „disabled“, šiam veiksmui nebus " +#~ "priskirtas joks klavišų susiejimas." + +#~ msgid "" +#~ "The global keybinding for opening the Recent Changes dialog. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Globalus klavišų susiejimas paskutinių pakeitimų lango atvėrimui. Formato " +#~ "pavyzdys: „<Control>a“ ar „<Shift><Alt>F1“. " +#~ "Analizatorius yra gan liberalus ir leidžia didžiąsias ir mažąsias raides, " +#~ "taip pat tokius sutrumpinimus kaip „<Ctl>“ ir „<Ctrl>“. Jeigu " +#~ "nustatysite parinktį į specialią eilutę „disabled“, šiam veiksmui nebus " +#~ "priskirtas joks klavišų susiejimas." + +#~ msgid "Hotkeys" +#~ msgstr "Spartieji klavišai" + +#~ msgid "Use status _icon" +#~ msgstr "Naudoti _būsenos piktogramą" + +#~ msgid "Show icon in tray, which is the central place of control." +#~ msgstr "Rodyti dėkle piktogramą, kuri yra pagrindinis valdymo centras." + +#~ msgid "Listen for _hotkeys" +#~ msgstr "Priimti _sparčiuosius klavišus" + +#~ msgid "" +#~ "Hotkeys allow you to quickly access your notes from anywhere with a " +#~ "keypress. Example Hotkeys: <Control><Shift>F11, <" +#~ "Alt>N" +#~ msgstr "" +#~ "Spartieji klavišai įgalina greitai pasiekti raštelius bet kuriuo metu " +#~ "spustelėjus keletą klavišų. Sparčiųjų klavišų pavyzdžiai: <" +#~ "Control><Shift>F11, <Alt>N" + +#~ msgid "Show notes _menu" +#~ msgstr "Rodyti raštelių _meniu" + +#~ msgid "Open \"_Start Here\"" +#~ msgstr "Atverti „Pradėti čia“" + +#~ msgid "Create _new note" +#~ msgstr "Sukurti _naują raštelį" + +#~| msgid "Open Search Dialog" +#~ msgid "Open Search _Window" +#~ msgstr "Atverti paieškos _langą" + +#~ msgid "Take notes" +#~ msgstr "Rašyti raštelius" + +#~ msgid " (new)" +#~ msgstr " (naujas)" + +#~ msgid "_About Gnote" +#~ msgstr "_Apie Gnote" diff -Nru gnote-3.14.2/po/pl.po gnote-3.16.0/po/pl.po --- gnote-3.14.2/po/pl.po 2015-01-17 12:53:24.000000000 +0000 +++ gnote-3.16.0/po/pl.po 2015-03-07 18:13:28.000000000 +0000 @@ -9,14 +9,14 @@ # Stanisław Małolepszy , 2007. # Wadim Dziedzic , 2007-2008. # Tomasz Dominikowski , 2007-2009. -# Piotr Drąg , 2009-2014. -# Aviary.pl , 2007-2014. +# Piotr Drąg , 2009-2015. +# Aviary.pl , 2007-2015. msgid "" msgstr "" "Project-Id-Version: gnote\n" "Report-Msgid-Bugs-To: \n" -"POT-Creation-Date: 2014-12-21 20:04+0100\n" -"PO-Revision-Date: 2014-12-21 20:05+0100\n" +"POT-Creation-Date: 2015-01-17 18:20+0100\n" +"PO-Revision-Date: 2015-01-17 18:21+0100\n" "Last-Translator: Piotr Drąg \n" "Language-Team: Polish \n" "Language: pl\n" @@ -346,15 +346,8 @@ msgstr "Użycie ikony stanu, jeśli uruchomiono jako program" #: ../data/org.gnome.gnote.gschema.xml.in.h:50 -msgid "" -"Has affect only when started as an application. When set to TRUE, shows a " -"status icon. If set to FALSE, Search All Notes window is used as main " -"application window, closing which makes application to exit." -msgstr "" -"Jest używane tylko, jeśli uruchomiono jako program. Jeśli jest ustawione na " -"\"true\", to wyświetla ikonę stanu. Jeśli ustawiono na \"false\", to okno " -"wyszukiwania notatek jest używane jako główne okno programu, i jego " -"zamknięcie powoduje zakończenie programu." +msgid "Deprecated, has no effect" +msgstr "Przestarzałe, nie powoduje zmian" #: ../data/org.gnome.gnote.gschema.xml.in.h:51 msgid "Open notes in new window" @@ -387,117 +380,41 @@ msgstr "Wyświetlanie menu apletu" #: ../data/org.gnome.gnote.gschema.xml.in.h:56 -msgid "" -"The global keybinding for showing the Gnote applet's menu. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such " -"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " -"special string \"disabled\", then there will be no keybinding for this " -"action." -msgstr "" -"Globalne przypisanie klawisza dla wyświetlenia menu apletu Gnote. Format " -"jest w postaci \"<Control>a\" lub \"<Shift><Alt>F1\". " -"Analizator jest całkiem tolerancyjny i zezwala na małe i duże litery, jak " -"również skróty takie jak \"<Ctl>\" oraz \"<Ctrl>\". Jeżeli opcja " -"zostanie ustawiona na specjalny ciąg \"disabled\" (wyłączone), wtedy nie " -"będzie przypisanego klawisza do tego działania." +msgid "Deprecated, has no effect." +msgstr "Przestarzałe, nie powoduje zmian." #: ../data/org.gnome.gnote.gschema.xml.in.h:57 msgid "Open Start Here" msgstr "Otwarcie \"Start\"" #: ../data/org.gnome.gnote.gschema.xml.in.h:58 -msgid "" -"The global keybinding for opening the \"Start Here\" note. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such " -"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " -"special string \"disabled\", then there will be no keybinding for this " -"action." -msgstr "" -"Globalne przypisanie klawisza dla otwarcia notatki \"Start\". Format jest w " -"postaci \"<Control>a\" lub \"<Shift><Alt>F1\". Analizator " -"jest całkiem tolerancyjny i zezwala na małe i duże litery, jak również " -"skróty takie jak \"<Ctl>\" oraz \"<Ctrl>\". Jeżeli opcja " -"zostanie ustawiona na specjalny ciąg \"disabled\" (wyłączone), wtedy nie " -"będzie przypisanego klawisza do tego działania." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:59 msgid "Create a new Note" msgstr "Utwórz nową notatkę" -#: ../data/org.gnome.gnote.gschema.xml.in.h:60 -msgid "" -"The global keybinding for creating and displaying a new Note. The format " -"looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " -"parser is fairly liberal and allows lower or upper case, and also " -"abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the " -"option to the special string \"disabled\", then there will be no keybinding " -"for this action." -msgstr "" -"Globalne przypisanie klawisza dla tworzenia i wyświetlania nowej notatki. " -"Format jest w postaci \"<Control>a\" lub \"<Shift><Alt>" -"F1\". Analizator jest całkiem tolerancyjny i zezwala na małe i duże litery, " -"jak również skróty takie jak \"<Ctl>\" oraz \"<Ctrl>\". Jeżeli " -"opcja zostanie ustawiona na specjalny ciąg \"disabled\" (wyłączone), wtedy " -"nie będzie przypisanego klawisza do tego działania." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:61 +#: ../data/org.gnome.gnote.gschema.xml.in.h:59 msgid "Open Search Dialog" msgstr "Otwarcie okna wyszukiwania" -#: ../data/org.gnome.gnote.gschema.xml.in.h:62 -msgid "" -"The global keybinding for opening the Note Search dialog. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such " -"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " -"special string \"disabled\", then there will be no keybinding for this " -"action." -msgstr "" -"Globalne przypisanie klawisza dla otwarcia okna wyszukiwania notatki. Format " -"jest w postaci \"<Control>a\" lub \"<Shift><Alt>F1\". " -"Analizator jest całkiem tolerancyjny i zezwala na małe i duże litery, jak " -"również skróty takie jak \"<Ctl>\" oraz \"<Ctrl>\". Jeżeli opcja " -"zostanie ustawiona na specjalny ciąg \"disabled\" (wyłączone), wtedy nie " -"będzie przypisanego klawisza do tego działania." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:63 +#: ../data/org.gnome.gnote.gschema.xml.in.h:60 msgid "Open Recent Changes" msgstr "Otwarcie ostatnich zmian" -#: ../data/org.gnome.gnote.gschema.xml.in.h:64 -msgid "" -"The global keybinding for opening the Recent Changes dialog. The format " -"looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " -"parser is fairly liberal and allows lower or upper case, and also " -"abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the " -"option to the special string \"disabled\", then there will be no keybinding " -"for this action." -msgstr "" -"Globalne przypisanie klawisza dla otwarcia okna ostatnich zmian. Format jest " -"w postaci \"<Control>a\" lub \"<Shift><Alt>F1\". " -"Analizator jest całkiem tolerancyjny i zezwala na małe i duże litery, jak " -"również skróty takie jak \"<Ctl>\" oraz \"<Ctrl>\". Jeżeli opcja " -"zostanie ustawiona na specjalny ciąg \"disabled\" (wyłączone), wtedy nie " -"będzie przypisanego klawisza do tego działania." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:65 +#: ../data/org.gnome.gnote.gschema.xml.in.h:61 msgid "HTML Export Last Directory" msgstr "Ostatni katalog eksportu HTML" -#: ../data/org.gnome.gnote.gschema.xml.in.h:66 +#: ../data/org.gnome.gnote.gschema.xml.in.h:62 msgid "" "The last directory a note was exported to using the Export To HTML plugin." msgstr "" "Ostatni katalog, do którego notatka została wyeksportowana przy użyciu " "wtyczki Eksport do HTML." -#: ../data/org.gnome.gnote.gschema.xml.in.h:67 +#: ../data/org.gnome.gnote.gschema.xml.in.h:63 msgid "HTML Export Linked Notes" msgstr "Eksport HTML dowiązanych notatek" -#: ../data/org.gnome.gnote.gschema.xml.in.h:68 +#: ../data/org.gnome.gnote.gschema.xml.in.h:64 msgid "" "The last setting for the 'Export linked notes' checkbox in the Export to " "HTML plugin." @@ -505,11 +422,11 @@ "Ostatnie ustawienie dla opcji \"Eksport powiązanych notatek\" we wtyczce " "Eksport do HTML." -#: ../data/org.gnome.gnote.gschema.xml.in.h:69 +#: ../data/org.gnome.gnote.gschema.xml.in.h:65 msgid "HTML Export All Linked Notes" msgstr "Eksport HTML wszystkich dowiązanych notatek" -#: ../data/org.gnome.gnote.gschema.xml.in.h:70 +#: ../data/org.gnome.gnote.gschema.xml.in.h:66 msgid "" "The last setting for the 'Include all other linked notes' checkbox in the " "Export to HTML plugin. This setting is used in conjunction with the 'HTML " @@ -521,11 +438,11 @@ "HTML dowiązanych notatek\" aby określić, czy podczas eksportu do HTML mają " "być eksportowane wszystkie rekursywnie powiązane ze sobą notatki." -#: ../data/org.gnome.gnote.gschema.xml.in.h:71 +#: ../data/org.gnome.gnote.gschema.xml.in.h:67 msgid "Synchronization Client ID" msgstr "ID klienta synchronizacji" -#: ../data/org.gnome.gnote.gschema.xml.in.h:72 +#: ../data/org.gnome.gnote.gschema.xml.in.h:68 msgid "" "Unique identifier for this Gnote client, used when communicating with a " "synchronization server." @@ -533,11 +450,11 @@ "Niepowtarzalny identyfikator tego klienta Gnote używany podczas kontaktów z " "serwerem synchronizacji." -#: ../data/org.gnome.gnote.gschema.xml.in.h:73 +#: ../data/org.gnome.gnote.gschema.xml.in.h:69 msgid "Synchronization Local Server Path" msgstr "Ścieżka lokalnego serwera synchronizacji" -#: ../data/org.gnome.gnote.gschema.xml.in.h:74 +#: ../data/org.gnome.gnote.gschema.xml.in.h:70 msgid "" "Path to the synchronization server when using the filesystem synchronization " "service addin." @@ -545,22 +462,22 @@ "Ścieżka do serwera synchronizacji w przypadku korzystania z dodatku " "synchronizacji systemu plików." -#: ../data/org.gnome.gnote.gschema.xml.in.h:75 +#: ../data/org.gnome.gnote.gschema.xml.in.h:71 msgid "Selected Synchronization Service Addin" msgstr "Wybrany dodatek usługi synchronizacji" -#: ../data/org.gnome.gnote.gschema.xml.in.h:76 +#: ../data/org.gnome.gnote.gschema.xml.in.h:72 msgid "" "Unique identifier for the currently configured note synchronization service " "addin." msgstr "" "Niepowtarzalny identyfikator bieżącego dodatku usługi synchronizacji notatek." -#: ../data/org.gnome.gnote.gschema.xml.in.h:77 +#: ../data/org.gnome.gnote.gschema.xml.in.h:73 msgid "Note Synchronization Conflict Saved Behavior" msgstr "Zachowanie po wykryciu konfliktu synchronizacji notatki" -#: ../data/org.gnome.gnote.gschema.xml.in.h:78 +#: ../data/org.gnome.gnote.gschema.xml.in.h:74 msgid "" "Integer value indicating if there is a preference to always perform a " "specific behavior when a conflict is detected, instead of prompting the " @@ -572,11 +489,11 @@ "wykryciu konfliktu (zamiast pytania użytkownika). Wartość 0 oznacza " "proszenie użytkownika o decyzję przy każdym konflikcie." -#: ../data/org.gnome.gnote.gschema.xml.in.h:79 +#: ../data/org.gnome.gnote.gschema.xml.in.h:75 msgid "Automatic Background Synchronization Timeout" msgstr "Automatyczna ograniczenie czasu połączenia w tle" -#: ../data/org.gnome.gnote.gschema.xml.in.h:80 +#: ../data/org.gnome.gnote.gschema.xml.in.h:76 msgid "" "Integer value indicating how frequently to perform a background sync of your " "notes (when sync is configured). Any value less than 1 indicates that " @@ -588,11 +505,11 @@ "wskazują, że automatyczne synchronizowanie jest wyłączone. Najniższą " "akceptowaną dodatnią wartością jest 5. Wartość podawana w minutach." -#: ../data/org.gnome.gnote.gschema.xml.in.h:81 +#: ../data/org.gnome.gnote.gschema.xml.in.h:77 msgid "Accept SSL Certificates" msgstr "Akceptowanie certyfikatów SSL" -#: ../data/org.gnome.gnote.gschema.xml.in.h:82 +#: ../data/org.gnome.gnote.gschema.xml.in.h:78 msgid "" "Use wdfs option \"-ac\" to accept SSL certificates without prompting the " "user." @@ -600,38 +517,38 @@ "Proszę użyć opcji wdfs \"-ac\", aby akceptować certyfikaty SSL, bez pytania " "użytkownika." -#: ../data/org.gnome.gnote.gschema.xml.in.h:83 +#: ../data/org.gnome.gnote.gschema.xml.in.h:79 msgid "Share URL" msgstr "Adres URL udziału" -#: ../data/org.gnome.gnote.gschema.xml.in.h:84 +#: ../data/org.gnome.gnote.gschema.xml.in.h:80 msgid "WebDAV share URL where notes are synchronized to." msgstr "Adres URL udziału WebDAV, z którym synchronizować notatki." -#: ../data/org.gnome.gnote.gschema.xml.in.h:85 +#: ../data/org.gnome.gnote.gschema.xml.in.h:81 msgid "Share username" msgstr "Nazwa użytkownika udziału" -#: ../data/org.gnome.gnote.gschema.xml.in.h:86 +#: ../data/org.gnome.gnote.gschema.xml.in.h:82 msgid "Username to access WebDAV share." msgstr "Nazwa użytkownika udziału WebDAV." -#: ../data/org.gnome.gnote.gschema.xml.in.h:87 +#: ../data/org.gnome.gnote.gschema.xml.in.h:83 msgid "Timestamp format" msgstr "Format znacznika czasu" -#: ../data/org.gnome.gnote.gschema.xml.in.h:88 +#: ../data/org.gnome.gnote.gschema.xml.in.h:84 msgid "" "The date format that is used for the timestamp. It follows the format of " "strftime(3)." msgstr "" "Format daty używany do automatycznego wstawiania. Używa formatu strftime(3)." -#: ../data/org.gnome.gnote.gschema.xml.in.h:89 +#: ../data/org.gnome.gnote.gschema.xml.in.h:85 msgid "Time between checks" msgstr "Czas między sprawdzaniem" -#: ../data/org.gnome.gnote.gschema.xml.in.h:90 +#: ../data/org.gnome.gnote.gschema.xml.in.h:86 msgid "" "Time interval between note directory checks (in seconds). Min value is 5." msgstr "" @@ -639,7 +556,6 @@ "to 5." #: ../src/actionmanager.cpp:84 ../src/actionmanager.cpp:171 -#: ../src/tray.cpp:465 msgid "_Quit" msgstr "Za_kończ" @@ -648,7 +564,6 @@ msgstr "Kończy działanie programu Gnote" #: ../src/actionmanager.cpp:89 ../src/actionmanager.cpp:168 -#: ../src/tray.cpp:448 msgid "_Preferences" msgstr "_Preferencje" @@ -676,19 +591,19 @@ msgid "TrayIcon" msgstr "Ikona obszaru powiadamiania" -#: ../src/actionmanager.cpp:107 ../src/tray.cpp:225 +#: ../src/actionmanager.cpp:107 msgid "Create _New Note" msgstr "Utwórz _nową notatkę" -#: ../src/actionmanager.cpp:107 ../src/tray.cpp:227 +#: ../src/actionmanager.cpp:107 msgid "Create a new note" msgstr "Tworzy nową notatkę" -#: ../src/actionmanager.cpp:112 ../src/tray.cpp:234 +#: ../src/actionmanager.cpp:112 msgid "_Search All Notes" msgstr "_Szukaj w notatkach" -#: ../src/actionmanager.cpp:112 ../src/tray.cpp:236 +#: ../src/actionmanager.cpp:112 msgid "Open the Search All Notes window" msgstr "Otwiera okno przeszukiwania wszystkich notatek" @@ -700,7 +615,7 @@ msgid "New _Window" msgstr "Nowe o_kno" -#: ../src/actionmanager.cpp:169 ../src/tray.cpp:453 +#: ../src/actionmanager.cpp:169 msgid "_Help" msgstr "Pomo_c" @@ -1049,10 +964,6 @@ "NoteDirectoryWatcher: przerwano aktualizację, błąd podczas przetwarzania %s: " "%s" -#: ../src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp:35 -msgid "_Directory check interval:" -msgstr "_Czas między sprawdzaniem katalogu:" - #: ../src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in.in.h:1 msgid "Note Directory Watcher" msgstr "Obserwacja katalogu notatek" @@ -1065,6 +976,10 @@ msgid "Aurimas Černius and Tomboy original authors" msgstr "Aurimas Černius i pierwotni autorzy programu Tomboy" +#: ../src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp:35 +msgid "_Directory check interval:" +msgstr "_Czas między sprawdzaniem katalogu:" + #: ../src/addins/noteoftheday/noteoftheday.cpp:33 msgid "Today: Template" msgstr "Dzisiaj: szablon" @@ -1176,8 +1091,8 @@ msgid "Pierre-Yves Luyten" msgstr "Pierre-Yves Luyten" -#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:1 #: ../src/addins/specialnotes/specialnotesapplicationaddin.cpp:38 +#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:1 msgid "Special Notes" msgstr "Specjalne notatki" @@ -1396,15 +1311,15 @@ msgid "Exception thrown when creating note: %s" msgstr "Wystąpił wyjątek podczas tworzenia notatki: %s" -#: ../src/gnote.cpp:200 +#: ../src/gnote.cpp:185 msgid "Gnote is already running. Exiting..." msgstr "Program Gnote jest już uruchomiony. Kończenie działania..." -#: ../src/gnote.cpp:365 +#: ../src/gnote.cpp:289 msgid "and Tomboy original authors." msgstr "i pierwotni autorzy programu Tomboy." -#: ../src/gnote.cpp:371 +#: ../src/gnote.cpp:295 msgid "translator-credits" msgstr "" "Marek Habersack , 2004\n" @@ -1412,94 +1327,94 @@ "Stanisław Małolepszy , 2007\n" "Wadim Dziedzic , 2007-2008\n" "Tomasz Dominikowski , 2007-2009\n" -"Piotr Drąg , 2009-2014\n" -"Aviary.pl , 2007-2014" +"Piotr Drąg , 2009-2015\n" +"Aviary.pl , 2007-2015" -#: ../src/gnote.cpp:380 +#: ../src/gnote.cpp:304 msgid "" -"Copyright © 2010-2014 Aurimas Cernius\n" +"Copyright © 2010-2015 Aurimas Cernius\n" "Copyright © 2009-2011 Debarshi Ray\n" "Copyright © 2009 Hubert Figuiere\n" "Copyright © 2004-2009 the Tomboy original authors." msgstr "" -"Copyright © 2010-2014 Aurimas Cernius\n" +"Copyright © 2010-2015 Aurimas Cernius\n" "Copyright © 2009-2011 Debarshi Ray\n" "Copyright © 2009 Hubert Figuiere\n" "Copyright © 2004-2009 Pierwotni autorzy programu Tomboy." -#: ../src/gnote.cpp:384 +#: ../src/gnote.cpp:308 msgid "A simple and easy to use desktop note-taking application." msgstr "Prosty i łatwy w użyciu program do sporządzania notatek." -#: ../src/gnote.cpp:395 +#: ../src/gnote.cpp:319 msgid "Homepage" msgstr "Witryna programu" -#: ../src/gnote.cpp:570 +#: ../src/gnote.cpp:494 msgid "Run Gnote in background." msgstr "Uruchamia program Gnote w tle." -#: ../src/gnote.cpp:571 +#: ../src/gnote.cpp:495 msgid "Run Gnote as GNOME Shell search provider." msgstr "Uruchamia program Gnote jako dostawcę wyszukiwania GNOME Shell." -#: ../src/gnote.cpp:572 +#: ../src/gnote.cpp:496 msgid "Specify the path of the directory containing the notes." msgstr "Proszę wprowadzić ścieżkę do katalogu zawierającego notatki." -#: ../src/gnote.cpp:572 +#: ../src/gnote.cpp:496 msgid "path" msgstr "ścieżka" -#: ../src/gnote.cpp:573 +#: ../src/gnote.cpp:497 msgid "Open the search all notes window with the search text." msgstr "Otwiera okno przeszukiwania wszystkich notatek." -#: ../src/gnote.cpp:573 ../src/gnote.cpp:578 +#: ../src/gnote.cpp:497 ../src/gnote.cpp:502 msgid "text" msgstr "tekst" -#: ../src/gnote.cpp:574 +#: ../src/gnote.cpp:498 msgid "Print version information." msgstr "Wyświetla informacje o wersji." -#: ../src/gnote.cpp:575 +#: ../src/gnote.cpp:499 msgid "Create and display a new note, with a optional title." msgstr "Tworzy i wyświetla nową notatkę z opcjonalnym tytułem." -#: ../src/gnote.cpp:575 +#: ../src/gnote.cpp:499 msgid "title" msgstr "tytuł" -#: ../src/gnote.cpp:576 +#: ../src/gnote.cpp:500 msgid "Display the existing note matching title." msgstr "Wyświetla istniejącą notatkę o pasującym tytule." -#: ../src/gnote.cpp:576 +#: ../src/gnote.cpp:500 msgid "title/url" msgstr "tytuł/adres URL" -#: ../src/gnote.cpp:577 +#: ../src/gnote.cpp:501 msgid "Display the 'Start Here' note." msgstr "Wyświetla notatkę \"Start\"." -#: ../src/gnote.cpp:578 +#: ../src/gnote.cpp:502 msgid "Search and highlight text in the opened note." msgstr "Wyszukuje i wyróżnia tekst w otwartej notatce." -#: ../src/gnote.cpp:582 +#: ../src/gnote.cpp:506 msgid "A note taking application" msgstr "Program do sporządzania notatek" -#: ../src/gnote.cpp:582 +#: ../src/gnote.cpp:506 msgid "Gnote options at launch" msgstr "Opcje podczas uruchamiania programu Gnote" -#: ../src/gnote.cpp:659 +#: ../src/gnote.cpp:583 msgid "Could not connect to remote instance." msgstr "Nie można połączyć ze zdalną kopią." -#: ../src/gnote.cpp:775 +#: ../src/gnote.cpp:699 msgid "Version %1%" msgstr "Wersja %1%" @@ -1517,6 +1432,23 @@ msgid "Window is not embedded" msgstr "Okno nie jest osadzone" +#. Probably IOException or UnauthorizedAccessException? +#: ../src/notebase.cpp:200 ../src/note.cpp:382 +#, c-format +msgid "Exception while saving note: %s" +msgstr "Wyjątek podczas zapisywania notatki: %s" + +#. write failure, but not critical +#: ../src/notebase.cpp:444 +#, c-format +msgid "Failed to update note format: %s" +msgstr "Zaktualizowanie formatu notatki się nie powiodło: %s" + +#: ../src/notebase.cpp:568 +#, c-format +msgid "Filesystem error: %s" +msgstr "Błąd systemu plików: %s" + #: ../src/notebooks/createnotebookdialog.cpp:41 msgid "Create Notebook" msgstr "Utworzenie notatnika" @@ -1651,12 +1583,6 @@ "uprawnienia do katalogu ~/.local/share/gnote. Szczegóły błędu można znaleźć " "w pliku ~/.gnote.log." -#. Probably IOException or UnauthorizedAccessException? -#: ../src/note.cpp:382 ../src/notebase.cpp:200 -#, c-format -msgid "Exception while saving note: %s" -msgstr "Wyjątek podczas zapisywania notatki: %s" - #: ../src/note.cpp:474 #, c-format msgid "Error while saving: %s" @@ -1666,16 +1592,13 @@ msgid "Setting text content for closed notes not supported" msgstr "Ustawianie treści tekstu dla zamkniętych notatek nie jest obsługiwane" -#. write failure, but not critical -#: ../src/notebase.cpp:444 -#, c-format -msgid "Failed to update note format: %s" -msgstr "Zaktualizowanie formatu notatki się nie powiodło: %s" +#: ../src/notemanagerbase.cpp:105 ../src/preferencesdialog.cpp:320 +msgid "New Note Template" +msgstr "Szablon nowej notatki" -#: ../src/notebase.cpp:568 -#, c-format -msgid "Filesystem error: %s" -msgstr "Błąd systemu plików: %s" +#: ../src/notemanagerbase.cpp:359 +msgid "Describe your new note here." +msgstr "Treść nowej notatki..." #: ../src/notemanager.cpp:133 msgid "" @@ -1767,14 +1690,6 @@ msgid "Error parsing note XML, skipping \"%s\": %s" msgstr "Błąd podczas przetwarzania kodu XML notatki, pomijanie \"%s\": %s" -#: ../src/notemanagerbase.cpp:105 ../src/preferencesdialog.cpp:332 -msgid "New Note Template" -msgstr "Szablon nowej notatki" - -#: ../src/notemanagerbase.cpp:359 -msgid "Describe your new note here." -msgstr "Treść nowej notatki..." - #: ../src/noterenamedialog.cpp:123 msgid "Rename Note Links?" msgstr "Zmienić nazwy odnośników?" @@ -1884,47 +1799,47 @@ msgid "Save _Title" msgstr "Zapisz _tytuł" -#: ../src/notewindow.cpp:562 ../src/notewindow.cpp:1084 +#: ../src/notewindow.cpp:562 ../src/notewindow.cpp:1085 msgid "Cannot create note" msgstr "Nie można utworzyć notatki" -#: ../src/notewindow.cpp:827 +#: ../src/notewindow.cpp:828 msgid "_Link" msgstr "_Odnośnik" -#: ../src/notewindow.cpp:828 +#: ../src/notewindow.cpp:829 msgid "_Bold" msgstr "_Pogrubienie" -#: ../src/notewindow.cpp:829 +#: ../src/notewindow.cpp:830 msgid "_Italic" msgstr "Kursy_wa" -#: ../src/notewindow.cpp:830 +#: ../src/notewindow.cpp:831 msgid "_Strikeout" msgstr "P_rzekreślenie" -#: ../src/notewindow.cpp:832 +#: ../src/notewindow.cpp:833 msgid "_Highlight" msgstr "Wyróżn_ienie" -#: ../src/notewindow.cpp:834 +#: ../src/notewindow.cpp:835 msgid "_Normal" msgstr "_Zwykły" -#: ../src/notewindow.cpp:836 +#: ../src/notewindow.cpp:837 msgid "Hu_ge" msgstr "_Ogromny" -#: ../src/notewindow.cpp:838 +#: ../src/notewindow.cpp:839 msgid "_Large" msgstr "_Duży" -#: ../src/notewindow.cpp:840 +#: ../src/notewindow.cpp:841 msgid "S_mall" msgstr "_Mały" -#: ../src/notewindow.cpp:842 +#: ../src/notewindow.cpp:843 msgid "Bullets" msgstr "Wypunktowanie" @@ -1936,45 +1851,30 @@ msgid "Links" msgstr "Odnośniki" -#: ../src/preferencesdialog.cpp:125 -msgid "Hotkeys" -msgstr "Klawisze skrótów" - #. TRANSLATORS: Addin category. -#: ../src/preferencesdialog.cpp:129 ../src/sharp/addinstreemodel.cpp:164 +#: ../src/preferencesdialog.cpp:125 ../src/sharp/addinstreemodel.cpp:164 msgid "Synchronization" msgstr "Synchronizacja" -#: ../src/preferencesdialog.cpp:131 +#: ../src/preferencesdialog.cpp:127 msgid "Plugins" msgstr "Wtyczki" -#: ../src/preferencesdialog.cpp:208 +#: ../src/preferencesdialog.cpp:204 #, c-format msgid "Plugin %s is absent" msgstr "Wtyczka %s jest nieobecna" -#. Status icon -#: ../src/preferencesdialog.cpp:247 -msgid "Use status _icon" -msgstr "_Ikona stanu" - -#: ../src/preferencesdialog.cpp:248 -msgid "Show icon in tray, which is the central place of control." -msgstr "" -"Wyświetlanie ikony w obszarze powiadamiania, która jest centralnym punktem " -"kontroli." - #. Open in new window -#: ../src/preferencesdialog.cpp:255 +#: ../src/preferencesdialog.cpp:243 msgid "Always _open notes in new window" msgstr "_Otwieranie notatek w nowym oknie" -#: ../src/preferencesdialog.cpp:268 +#: ../src/preferencesdialog.cpp:256 msgid "_Spell check while typing" msgstr "_Sprawdzanie pisowni podczas pisania" -#: ../src/preferencesdialog.cpp:269 +#: ../src/preferencesdialog.cpp:257 msgid "" "Misspellings will be underlined in red, with correct spelling suggestions " "shown in the context menu." @@ -1983,37 +1883,37 @@ "prawidłowej pisowni będą dostępne w menu pod prawym przyciskiem myszy." #. Auto bulleted list -#: ../src/preferencesdialog.cpp:279 +#: ../src/preferencesdialog.cpp:267 msgid "Enable auto-_bulleted lists" msgstr "A_utomatyczne wypunktowanie list" -#: ../src/preferencesdialog.cpp:280 +#: ../src/preferencesdialog.cpp:268 msgid "Start new bulleted list by starting new line with character \"-\"." msgstr "" "Rozpoczyna nową listę wypunktowaną po rozpoczęciu nowego wiersza znakiem \"-" "\"." -#: ../src/preferencesdialog.cpp:289 +#: ../src/preferencesdialog.cpp:277 msgid "Use custom _font" msgstr "Własna _czcionka" -#: ../src/preferencesdialog.cpp:307 +#: ../src/preferencesdialog.cpp:295 msgid "When renaming a linked note: " msgstr "Podczas zmieniania nazwy notatki, do której prowadzą odnośniki: " -#: ../src/preferencesdialog.cpp:311 +#: ../src/preferencesdialog.cpp:299 msgid "Ask me what to do" msgstr "Pytanie co robić" -#: ../src/preferencesdialog.cpp:312 +#: ../src/preferencesdialog.cpp:300 msgid "Never rename links" msgstr "Bez zmieniania nazw odnośników" -#: ../src/preferencesdialog.cpp:313 +#: ../src/preferencesdialog.cpp:301 msgid "Always rename links" msgstr "Zmienianie nazw odnośników" -#: ../src/preferencesdialog.cpp:333 +#: ../src/preferencesdialog.cpp:321 msgid "" "Use the new note template to specify the text that should be used when " "creating a new note." @@ -2021,27 +1921,27 @@ "Szablon nowej notatki pozwala określić domyślną treść dla nowo utworzonych " "notatek." -#: ../src/preferencesdialog.cpp:338 +#: ../src/preferencesdialog.cpp:326 msgid "Open New Note Template" msgstr "Otwórz szablon nowej notatki" #. internal links -#: ../src/preferencesdialog.cpp:395 +#: ../src/preferencesdialog.cpp:383 msgid "_Automatically link to notes" msgstr "_Automatyczne odnośniki do notatek" -#: ../src/preferencesdialog.cpp:396 +#: ../src/preferencesdialog.cpp:384 msgid "Enable this option to create a link when text matches note title." msgstr "" "Włączenie tej opcji spowoduje tworzenie odnośników, kiedy tekst pasuje do " "tytułu notatki." #. URLs -#: ../src/preferencesdialog.cpp:402 +#: ../src/preferencesdialog.cpp:390 msgid "Create links for _URLs" msgstr "Tworzenie odnośników dla adresów _URL" -#: ../src/preferencesdialog.cpp:403 +#: ../src/preferencesdialog.cpp:391 msgid "" "Enable this option to create links for URLs. Clicking will open URL with " "appropriate program." @@ -2050,11 +1950,11 @@ "Kliknięcie otworzy dany adres za pomocą odpowiedniego programu." #. WikiWords... -#: ../src/preferencesdialog.cpp:410 +#: ../src/preferencesdialog.cpp:398 msgid "Highlight _WikiWords" msgstr "_Wyróżnianie WikiSłów" -#: ../src/preferencesdialog.cpp:411 +#: ../src/preferencesdialog.cpp:399 msgid "" "Enable this option to highlight words ThatLookLikeThis. Clicking the " "word will create a note with that name." @@ -2062,90 +1962,55 @@ "Uaktywnienie tej opcji spowoduje wyróżnianie słów KtóreWyglądająTakJakTo. Kliknięcie takiego słowa utworzy notatkę o takiej właśnie nazwie." -#. Hotkeys... -#: ../src/preferencesdialog.cpp:441 -msgid "Listen for _hotkeys" -msgstr "Nasłuchiwanie _klawiszy skrótów" - -#: ../src/preferencesdialog.cpp:442 -msgid "" -"Hotkeys allow you to quickly access your notes from anywhere with a " -"keypress. Example Hotkeys: <Control><Shift>F11, <" -"Alt>N" -msgstr "" -"Klawisze skrótów pozwalają na szybki dostęp do notatek z dowolnego miejsca. " -"Przykładowe klawisze skrótów: <Control><Shift>F11, <" -"Alt>N" - -#. Show notes menu keybinding... -#: ../src/preferencesdialog.cpp:464 -msgid "Show notes _menu" -msgstr "Wyświetlenie _menu notatek" - -#. Open Start Here keybinding... -#: ../src/preferencesdialog.cpp:481 -msgid "Open \"_Start Here\"" -msgstr "Otwarcie notatki \"_Start\"" - -#. Create new note keybinding... -#: ../src/preferencesdialog.cpp:497 -msgid "Create _new note" -msgstr "Utworzenie _nowej notatki" - -#. Open Search window keybinding... -#: ../src/preferencesdialog.cpp:513 -msgid "Open Search _Window" -msgstr "Otwarcie okna _wyszukiwania" - -#: ../src/preferencesdialog.cpp:553 +#: ../src/preferencesdialog.cpp:431 msgid "Ser_vice:" msgstr "_Usługa:" -#: ../src/preferencesdialog.cpp:609 ../src/preferencesdialog.cpp:1239 +#: ../src/preferencesdialog.cpp:487 ../src/preferencesdialog.cpp:1117 msgid "Not configurable" msgstr "Nie do konfiguracji" -#: ../src/preferencesdialog.cpp:636 +#: ../src/preferencesdialog.cpp:514 msgid "Automatical background s_ync interval (minutes)" msgstr "Czas między automatycznym _synchronizowaniem w tle (minuty)" #. "Advanced..." button to bring up extra sync config dialog -#: ../src/preferencesdialog.cpp:660 +#: ../src/preferencesdialog.cpp:538 msgid "_Advanced..." msgstr "Zaa_wansowane..." -#: ../src/preferencesdialog.cpp:707 +#: ../src/preferencesdialog.cpp:585 msgid "The following plugins are installed:" msgstr "Zainstalowano poniższe wtyczki:" #. TODO: In a future version, add in an "Install Add-ins..." button #. TODO: In a future version, add in a "Repositories..." button -#: ../src/preferencesdialog.cpp:742 +#: ../src/preferencesdialog.cpp:620 msgid "_Enable" msgstr "_Włącz" -#: ../src/preferencesdialog.cpp:748 +#: ../src/preferencesdialog.cpp:626 msgid "_Disable" msgstr "Wyłą_cz" -#: ../src/preferencesdialog.cpp:906 +#: ../src/preferencesdialog.cpp:784 msgid "Not Implemented" msgstr "Niezaimplementowane" -#: ../src/preferencesdialog.cpp:922 +#: ../src/preferencesdialog.cpp:800 msgid "%1% Preferences" msgstr "Preferencje programu %1%" -#: ../src/preferencesdialog.cpp:1057 +#: ../src/preferencesdialog.cpp:935 msgid "Choose Note Font" msgstr "Wybór czcionki notatki" #. Create dialog -#: ../src/preferencesdialog.cpp:1155 +#: ../src/preferencesdialog.cpp:1033 msgid "Other Synchronization Options" msgstr "Inne opcje synchronizacji" -#: ../src/preferencesdialog.cpp:1158 +#: ../src/preferencesdialog.cpp:1036 msgid "" "When a conflict is detected between a local note and a note on the " "configured synchronization server:" @@ -2154,23 +2019,23 @@ "skonfigurowanym serwerze synchronizacji:" #. label.Xalign = 0; -#: ../src/preferencesdialog.cpp:1162 +#: ../src/preferencesdialog.cpp:1040 msgid "Always ask me what to do" msgstr "Pytanie co robić za każdym razem" -#: ../src/preferencesdialog.cpp:1166 +#: ../src/preferencesdialog.cpp:1044 msgid "Rename my local note" msgstr "Zmiana nazwy lokalnej notatki" -#: ../src/preferencesdialog.cpp:1170 +#: ../src/preferencesdialog.cpp:1048 msgid "Replace my local note with the server's update" msgstr "Zastąpienie lokalnej notatki aktualizacją z serwera" -#: ../src/preferencesdialog.cpp:1272 +#: ../src/preferencesdialog.cpp:1150 msgid "Are you sure?" msgstr "Na pewno?" -#: ../src/preferencesdialog.cpp:1273 +#: ../src/preferencesdialog.cpp:1151 msgid "" "Clearing your synchronization settings is not recommended. You may be " "forced to synchronize all of your notes again when you save new settings." @@ -2178,11 +2043,11 @@ "Usunięcie ustawień synchronizacji nie jest zalecane. Może być konieczna " "ponowna synchronizacja wszystkich notatek po zapisaniu nowych ustawień." -#: ../src/preferencesdialog.cpp:1283 +#: ../src/preferencesdialog.cpp:1161 msgid "Resetting Synchronization Settings" msgstr "Przywracanie ustawień synchronizacji" -#: ../src/preferencesdialog.cpp:1284 +#: ../src/preferencesdialog.cpp:1162 msgid "" "You have disabled the configured synchronization service. Your " "synchronization settings will now be cleared. You may be forced to " @@ -2192,11 +2057,11 @@ "synchronizacji zostaną usunięte. Może być konieczna ponowna synchronizacja " "wszystkich notatek po zapisaniu nowych ustawień." -#: ../src/preferencesdialog.cpp:1350 +#: ../src/preferencesdialog.cpp:1228 msgid "Connection successful" msgstr "Pomyślnie połączono" -#: ../src/preferencesdialog.cpp:1351 +#: ../src/preferencesdialog.cpp:1229 msgid "" "Gnote is ready to synchronize your notes. Would you like to synchronize them " "now?" @@ -2204,7 +2069,7 @@ "Program Gnote jest gotowy do synchronizacji notatek. Zsynchronizować je " "teraz?" -#: ../src/preferencesdialog.cpp:1375 +#: ../src/preferencesdialog.cpp:1253 msgid "" "Please check your information and try again. The log file %1% may contain " "more information about the error." @@ -2212,19 +2077,19 @@ "Proszę sprawdzić informacje i spróbować ponownie. Plik dziennika %1% może " "zawierać więcej informacji o błędzie." -#: ../src/preferencesdialog.cpp:1380 +#: ../src/preferencesdialog.cpp:1258 msgid "Error connecting" msgstr "Błąd podczas łączenia" -#: ../src/preferencesdialog.cpp:1443 +#: ../src/preferencesdialog.cpp:1321 msgid "Version:" msgstr "Wersja:" -#: ../src/preferencesdialog.cpp:1446 +#: ../src/preferencesdialog.cpp:1324 msgid "Author:" msgstr "Autor:" -#: ../src/preferencesdialog.cpp:1451 +#: ../src/preferencesdialog.cpp:1329 msgid "Copyright:" msgstr "Copyright:" @@ -2716,18 +2581,6 @@ "systemu. Należy dopisać \"modprobe fuse\" do pliku /etc/init.d/boot.local " "lub \"fuse\" do pliku /etc/modules." -#: ../src/tray.cpp:54 -msgid "Take notes" -msgstr "Robienie notatek" - -#: ../src/tray.cpp:167 -msgid " (new)" -msgstr " (nowa)" - -#: ../src/tray.cpp:458 -msgid "_About Gnote" -msgstr "_O programie Gnote" - #: ../src/utils.cpp:144 msgid "" "The \"Gnote Manual\" could not be found. Please verify that your " diff -Nru gnote-3.14.2/po/POTFILES.in gnote-3.16.0/po/POTFILES.in --- gnote-3.14.2/po/POTFILES.in 2015-01-17 12:53:20.000000000 +0000 +++ gnote-3.16.0/po/POTFILES.in 2015-03-07 18:13:28.000000000 +0000 @@ -22,8 +22,8 @@ src/addins/inserttimestamp/inserttimestampnoteaddin.cpp src/addins/inserttimestamp/inserttimestamppreferences.cpp src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp -src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in.in +src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp src/addins/noteoftheday/noteoftheday.cpp src/addins/noteoftheday/noteoftheday.desktop.in.in src/addins/noteoftheday/noteofthedaypreferences.cpp @@ -33,8 +33,8 @@ src/addins/readonly/readonlynoteaddin.cpp src/addins/replacetitle/replacetitle.desktop.in.in src/addins/replacetitle/replacetitlenoteaddin.cpp -src/addins/specialnotes/specialnotes.desktop.in.in src/addins/specialnotes/specialnotesapplicationaddin.cpp +src/addins/specialnotes/specialnotes.desktop.in.in src/addins/statistics/statisticsapplicationaddin.cpp src/addins/statistics/statistics.desktop.in.in src/addins/statistics/statisticswidget.cpp @@ -54,6 +54,7 @@ src/gnote.cpp src/iconmanager.cpp src/noteaddin.cpp +src/notebase.cpp src/notebooks/createnotebookdialog.cpp src/notebooks/notebookapplicationaddin.cpp src/notebooks/notebook.cpp @@ -64,9 +65,8 @@ src/notebooks/specialnotebooks.cpp src/notebuffer.cpp src/note.cpp -src/notebase.cpp -src/notemanager.cpp src/notemanagerbase.cpp +src/notemanager.cpp src/noterenamedialog.cpp src/notewindow.cpp src/preferencesdialog.cpp @@ -84,6 +84,5 @@ src/synchronization/syncdialog.cpp src/synchronization/syncmanager.cpp src/synchronization/syncutils.cpp -src/tray.cpp src/utils.cpp src/watchers.cpp diff -Nru gnote-3.14.2/po/pt_BR.po gnote-3.16.0/po/pt_BR.po --- gnote-3.14.2/po/pt_BR.po 2015-01-17 12:53:24.000000000 +0000 +++ gnote-3.16.0/po/pt_BR.po 2015-03-07 18:13:28.000000000 +0000 @@ -4,17 +4,17 @@ # Marco de Freitas , 2009. # Taylon Silmer , 2009. # Djavan Fagundes , 2010, 2011, 2012. +# Rafael Ferreira , 2013. # Júnior Pires , 2013. # Enrico Nicoletto , 2013, 2014. -# Rafael Ferreira , 2013, 2014. # msgid "" msgstr "" "Project-Id-Version: gnote master\n" "Report-Msgid-Bugs-To: http://bugzilla.gnome.org/enter_bug.cgi?" "product=gnote&keywords=I18N+L10N&component=general\n" -"POT-Creation-Date: 2014-12-23 21:22+0000\n" -"PO-Revision-Date: 2014-12-24 02:54-0300\n" +"POT-Creation-Date: 2015-03-03 09:33+0000\n" +"PO-Revision-Date: 2015-03-03 12:09-0300\n" "Last-Translator: Rafael Ferreira \n" "Language-Team: Brazilian Portuguese \n" "Language: pt_BR\n" @@ -22,7 +22,7 @@ "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" "Plural-Forms: nplurals=2; plural=(n > 1);\n" -"X-Generator: Poedit 1.7.1\n" +"X-Generator: Poedit 1.7.4\n" #: ../data/appdata/gnote.appdata.xml.in.h:1 msgid "" @@ -30,18 +30,18 @@ "allows you to capture your ideas, link them together using WikiWiki-style " "links, group together in notebooks and some extra features for everyday use." msgstr "" -"Gnote é um aplicativo simples para tomar notas no ambiente de área de trabalho " -"do GNOME. Ele permite que você capture suas ideias, vincule-as usando links no " -"estilo WikiWiki, agrupe-as em catálogos de notas e algumas outras " -"funcionalidades extras de uso diário." +"Gnote é um aplicativo simples para tomar notas no ambiente de área de " +"trabalho do GNOME. Ele permite que você capture suas ideias, vincule-as " +"usando links no estilo WikiWiki, agrupe-as em catálogos de notas e algumas " +"outras funcionalidades extras de uso diário." #: ../data/appdata/gnote.appdata.xml.in.h:2 msgid "" "Gnote also supports synchronization to make it possible to use on multiple " "devices." msgstr "" -"Gnote possui suporte a sincronização para que seja possível usá-lo em múltiplos " -"dispositivos." +"Gnote possui suporte a sincronização para que seja possível usá-lo em " +"múltiplos dispositivos." #: ../data/gnote.desktop.in.in.h:1 ../src/recentchanges.cpp:45 #: ../src/recentchanges.cpp:479 @@ -69,8 +69,8 @@ "If true, misspellings will be underlined in red, and correct spelling " "suggestions shown in the right-click menu." msgstr "" -"Se verdadeiro, erros ortográficos serão sublinhados em vermelho e sugestões de " -"ortografia serão mostradas no menu de contexto." +"Se verdadeiro, erros ortográficos serão sublinhados em vermelho e sugestões " +"de ortografia serão mostradas no menu de contexto." #: ../data/org.gnome.gnote.gschema.xml.in.h:3 msgid "Automatically create links when typing" @@ -78,10 +78,11 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:4 msgid "" -"Enable this option to automatically create a link, when text matches note title." +"Enable this option to automatically create a link, when text matches note " +"title." msgstr "" -"Habilite esta opção para automaticamente criar um link quando o texto coincidir " -"com o título da nota." +"Habilite esta opção para automaticamente criar um link quando o texto " +"coincidir com o título da nota." #: ../data/org.gnome.gnote.gschema.xml.in.h:5 msgid "Create links for URLs in notes" @@ -97,8 +98,8 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:8 msgid "" -"Enable this option to highlight words ThatLookLikeThis. Clicking the word will " -"create a note with that name." +"Enable this option to highlight words ThatLookLikeThis. Clicking the word " +"will create a note with that name." msgstr "" "Habilite esta opção para destacar palavras QueSeParecemComEsta. Clicar na " "palavra criará uma nota com aquele nome." @@ -109,8 +110,8 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:10 msgid "" -"Enable this option if you want bulleted lists to be automatic when you place - " -"or * at the beginning of a line." +"Enable this option if you want bulleted lists to be automatic when you place " +"- or * at the beginning of a line." msgstr "" "Habilite esta opção se você quiser criar listas marcadas automaticamente ao " "colocar um - ou * no inicio de uma linha." @@ -124,8 +125,8 @@ "Enable this option if you want to be able to middle-click the Gnote icon to " "paste timestamped content into the Start Here note." msgstr "" -"Habilite esta opção se você quiser clicar com o botão do meio no ícone do Gnote " -"para colar conteúdo com marca de tempo na nota \"Comece aqui\"." +"Habilite esta opção se você quiser clicar com o botão do meio no ícone do " +"Gnote para colar conteúdo com marca de tempo na nota \"Comece aqui\"." #: ../data/org.gnome.gnote.gschema.xml.in.h:13 msgid "Enable custom font" @@ -145,11 +146,11 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:16 msgid "" -"If enable-custom-font is true, the font name set here will be used as the font " -"when displaying notes." +"If enable-custom-font is true, the font name set here will be used as the " +"font when displaying notes." msgstr "" -"Se enable-custom-font for verdadeiro, o nome de fonte definido aqui será usado " -"como a fonte de exibição das notas." +"Se enable-custom-font for verdadeiro, o nome de fonte definido aqui será " +"usado como a fonte de exibição das notas." #: ../data/org.gnome.gnote.gschema.xml.in.h:17 msgid "Enable global keybindings" @@ -158,12 +159,12 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:18 msgid "" "If true, the desktop-global keybindings set in /org/gnome/gnote/global-" -"keybindings will be enabled, allowing for useful Gnote actions to be available " -"from any application." +"keybindings will be enabled, allowing for useful Gnote actions to be " +"available from any application." msgstr "" -"Se verdadeiro, as teclas de atalho globais do ambiente definidas em /org/gnome/" -"gnote/global-keybindings serão habilitadas, permitindo que ações úteis do Gnote " -"estejam disponíveis a partir de qualquer aplicativo." +"Se verdadeiro, as teclas de atalho globais do ambiente definidas em /org/" +"gnome/gnote/global-keybindings serão habilitadas, permitindo que ações úteis " +"do Gnote estejam disponíveis a partir de qualquer aplicativo." #: ../data/org.gnome.gnote.gschema.xml.in.h:19 msgid "Start Here Note" @@ -172,8 +173,8 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:20 msgid "" "The note URI of the note that should be considered the \"Start Here\" note, " -"which is always placed at the bottom of the Gnote note menu and also accessible " -"by hotkey." +"which is always placed at the bottom of the Gnote note menu and also " +"accessible by hotkey." msgstr "" "O URI da nota que deve ser considerada a nota \"Comece aqui\", que é sempre " "colocada no topo do menu de notas do Gnote e também é acessível via tecla de " @@ -185,7 +186,8 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:22 msgid "" -"Integer determining the minimum number of notes to show in the Gnote note menu." +"Integer determining the minimum number of notes to show in the Gnote note " +"menu." msgstr "" "Inteiro que determina o número mínimo de notas a serem exibidas no menu de " "notas do Gnote." @@ -238,8 +240,8 @@ msgid "" "Determines Search window splitter position in pixels; stored on Gnote exit." msgstr "" -"Determina a posição do separador de janela de pesquisa em pixels; armazenado na " -"saída do Gnote." +"Determina a posição do separador de janela de pesquisa em pixels; armazenado " +"na saída do Gnote." #: ../data/org.gnome.gnote.gschema.xml.in.h:33 msgid "Saved sorting of the Search window." @@ -292,7 +294,8 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:44 msgid "The port to use when connecting to the synchronization server via SSH." -msgstr "A porta selecionada ao se conectar ao servidor de sincronização via SSH." +msgstr "" +"A porta selecionada ao se conectar ao servidor de sincronização via SSH." #: ../data/org.gnome.gnote.gschema.xml.in.h:45 msgid "Link Updating Behavior on Note Rename" @@ -300,21 +303,22 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:46 msgid "" -"Integer value indicating if there is a preference to always perform a specific " -"link updating behavior when a note is renamed, instead of prompting the user. " -"The values map to an internal enumeration. 0 indicates that the user wishes to " -"be prompted when renaming a note may impact links that exist in other notes. 1 " -"indicates that links should automatically be removed. 2 indicates that link " -"text should be updated to the new note name so that it will continue linking to " -"the renamed note." -msgstr "" -"Valor inteiro que indica se há uma preferência por um comportamento específico " -"ao atualizar um comportamento quando uma nota for renomeada, ao invés de " -"perguntar ao usuário. Os valores são mapeados para uma enumeração interna. 0 " -"indica que o usuário deseja ser perguntado quando ocorrer uma nota impactar em " -"vínculos existentes em outras notas. 1 indica que estes vínculos devem ser " -"removidos automaticamente. 2 Indica que o texto do vínculo deve ser atualizado " -"para o novo nome da nota e que irá continuar apontando para a nota renomeada." +"Integer value indicating if there is a preference to always perform a " +"specific link updating behavior when a note is renamed, instead of prompting " +"the user. The values map to an internal enumeration. 0 indicates that the " +"user wishes to be prompted when renaming a note may impact links that exist " +"in other notes. 1 indicates that links should automatically be removed. 2 " +"indicates that link text should be updated to the new note name so that it " +"will continue linking to the renamed note." +msgstr "" +"Valor inteiro que indica se há uma preferência por um comportamento " +"específico ao atualizar um comportamento quando uma nota for renomeada, ao " +"invés de perguntar ao usuário. Os valores são mapeados para uma enumeração " +"interna. 0 indica que o usuário deseja ser perguntado quando ocorrer uma nota " +"impactar em vínculos existentes em outras notas. 1 indica que estes vínculos " +"devem ser removidos automaticamente. 2 Indica que o texto do vínculo deve ser " +"atualizado para o novo nome da nota e que irá continuar apontando para a nota " +"renomeada." #: ../data/org.gnome.gnote.gschema.xml.in.h:47 msgid "Enable closing notes with escape" @@ -330,15 +334,8 @@ msgstr "Usa o ícone de status, quando começar como um aplicativo" #: ../data/org.gnome.gnote.gschema.xml.in.h:50 -msgid "" -"Has affect only when started as an application. When set to TRUE, shows a " -"status icon. If set to FALSE, Search All Notes window is used as main " -"application window, closing which makes application to exit." -msgstr "" -"Tem efeito apenas quando iniciado como um aplicativo. Quando definido como " -"VERDADEIRO, mostra um ícone de status. Se definido como FALSO, pesquisa todas " -"as janela do de notas usadas na janela principal do aplicativo, fechando o que " -"faz a aplicação para sair." +msgid "Deprecated, has no effect." +msgstr "Obsoleto, não possui efeito." #: ../data/org.gnome.gnote.gschema.xml.in.h:51 msgid "Open notes in new window" @@ -346,7 +343,8 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:52 msgid "" -"Open notes in new window instead of replacing active content of the same window" +"Open notes in new window instead of replacing active content of the same " +"window" msgstr "" "Abre notas em uma nova janela em vez de substituir o conteúdo ativo da mesma " "janela." @@ -357,8 +355,8 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:54 msgid "" -"Saves note window size and automatically resizes main window to this size, when " -"note is opened." +"Saves note window size and automatically resizes main window to this size, " +"when note is opened." msgstr "" "Salva o tamanho da janela de nota e redimensiona automaticamente a janela " "principal para este tamanho, quando a nota for aberta." @@ -368,121 +366,49 @@ msgstr "Mostrar menu do miniaplicativo" #: ../data/org.gnome.gnote.gschema.xml.in.h:56 -msgid "" -"The global keybinding for showing the Gnote applet's menu. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such as " -"\"<Ctl>\" and \"<Ctrl>\". If you set the option to the special " -"string \"disabled\", then there will be no keybinding for this action." -msgstr "" -"As teclas de atalho globais para exibir o menu do miniaplicativo Gnote. O " -"formato se parece com \"<Control>a\" ou \"<Shift><Alt>F1\". O " -"analisador é bastante liberal e permite minúsculas, maiúsculas e também " -"abreviações como \"<Ctl>\" e \"<Ctrl>\". Se você definir a opção " -"com a string especial \"disabled\", não haverá combinação de teclas para essa " -"ação." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:57 msgid "Open Start Here" msgstr "Abrir \"Comece aqui\"" -#: ../data/org.gnome.gnote.gschema.xml.in.h:58 -msgid "" -"The global keybinding for opening the \"Start Here\" note. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such as " -"\"<Ctl>\" and \"<Ctrl>\". If you set the option to the special " -"string \"disabled\", then there will be no keybinding for this action." -msgstr "" -"As teclas de atalho globais para abrir a nota \"Comece aqui\". O formato se " -"parece com \"<Control>a\" ou \"<Shift><Alt>F1\". O analisador " -"é bastante liberal e permite minúsculas, maiúsculas e também abreviações como " -"\"<Ctl>\" e \"<Ctrl>\". Se você definir a opção com a string " -"especial \"disabled\", não haverá combinação de teclas para essa ação." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:59 +#: ../data/org.gnome.gnote.gschema.xml.in.h:57 msgid "Create a new Note" msgstr "Criar uma nova nota" -#: ../data/org.gnome.gnote.gschema.xml.in.h:60 -msgid "" -"The global keybinding for creating and displaying a new Note. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such as " -"\"<Ctl>\" and \"<Ctrl>\". If you set the option to the special " -"string \"disabled\", then there will be no keybinding for this action." -msgstr "" -"As teclas de atalho globais para criar e exibir uma nova nota. O formato se " -"parece com \"<Control>a\" ou \"<Shift><Alt>F1\". O analisador " -"é bastante liberal e permite minúsculas, maiúsculas e também abreviações como " -"\"<Ctl>\" e \"<Ctrl>\". Se você definir a opção com a string " -"especial \"disabled\", não haverá combinação de teclas para essa ação." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:61 +#: ../data/org.gnome.gnote.gschema.xml.in.h:58 msgid "Open Search Dialog" msgstr "Abrir janela de pesquisa" -#: ../data/org.gnome.gnote.gschema.xml.in.h:62 -msgid "" -"The global keybinding for opening the Note Search dialog. The format looks like " -"\"<Control>a\" or \"<Shift><Alt>F1\". The parser is fairly " -"liberal and allows lower or upper case, and also abbreviations such as \"<" -"Ctl>\" and \"<Ctrl>\". If you set the option to the special string " -"\"disabled\", then there will be no keybinding for this action." -msgstr "" -"As teclas de atalho globais para abrir a caixa de diálogo de pesquisa de notas. " -"O formato se parece com \"<Control>a\" ou \"<Shift><Alt>F1\". " -"O analisador é bastante liberal e permite minúsculas, maiúsculas e também " -"abreviações como \"<Ctl>\" e \"<Ctrl>\". Se você definir a opção " -"com a string especial \"disabled\", não haverá combinação de teclas para essa " -"ação." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:63 +#: ../data/org.gnome.gnote.gschema.xml.in.h:59 msgid "Open Recent Changes" msgstr "Abrir alterações recentes" -#: ../data/org.gnome.gnote.gschema.xml.in.h:64 -msgid "" -"The global keybinding for opening the Recent Changes dialog. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such as " -"\"<Ctl>\" and \"<Ctrl>\". If you set the option to the special " -"string \"disabled\", then there will be no keybinding for this action." -msgstr "" -"As teclas de atalho globais para abrir o diálogo de alterações recentes. O " -"formato se parece com \"<Control>a\" ou \"<Shift><Alt>F1\". O " -"analisador é bastante liberal e permite minúsculas, maiúsculas e também " -"abreviações como \"<Ctl>\" e \"<Ctrl>\". Se você definir a opção " -"com a string especial \"disabled\", não haverá associação de teclas para esta " -"ação." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:65 +#: ../data/org.gnome.gnote.gschema.xml.in.h:60 msgid "HTML Export Last Directory" msgstr "Exportar o último diretório para HTML" -#: ../data/org.gnome.gnote.gschema.xml.in.h:66 -msgid "The last directory a note was exported to using the Export To HTML plugin." +#: ../data/org.gnome.gnote.gschema.xml.in.h:61 +msgid "" +"The last directory a note was exported to using the Export To HTML plugin." msgstr "" "O último diretório para onde foi exportada uma nota utilizando o plug-in " "Exportar para HTML." -#: ../data/org.gnome.gnote.gschema.xml.in.h:67 +#: ../data/org.gnome.gnote.gschema.xml.in.h:62 msgid "HTML Export Linked Notes" msgstr "Exportar as notas vinculadas para HTML" -#: ../data/org.gnome.gnote.gschema.xml.in.h:68 +#: ../data/org.gnome.gnote.gschema.xml.in.h:63 msgid "" "The last setting for the 'Export linked notes' checkbox in the Export to HTML " "plugin." msgstr "" -"O último estado da caixa de seleção \"Exportar notas vinculadas\" no plug-in de " -"exportação para HTML." +"O último estado da caixa de seleção \"Exportar notas vinculadas\" no plug-in " +"de exportação para HTML." -#: ../data/org.gnome.gnote.gschema.xml.in.h:69 +#: ../data/org.gnome.gnote.gschema.xml.in.h:64 msgid "HTML Export All Linked Notes" msgstr "Exportar todas as notas vinculadas para HTML" -#: ../data/org.gnome.gnote.gschema.xml.in.h:70 +#: ../data/org.gnome.gnote.gschema.xml.in.h:65 msgid "" "The last setting for the 'Include all other linked notes' checkbox in the " "Export to HTML plugin. This setting is used in conjunction with the 'HTML " @@ -491,27 +417,27 @@ msgstr "" "O último estado da caixa de seleção \"Incluir todas as notas vinculadas\" do " "plug-in de exportação para HTML. Essa configuração é usada em conjunto com a " -"opção \"Exportar para HTML as notas vinculadas\" e é usada para especificar se " -"todas as notas (localizadas recursivamente) devem ser incluídas durante a " +"opção \"Exportar para HTML as notas vinculadas\" e é usada para especificar " +"se todas as notas (localizadas recursivamente) devem ser incluídas durante a " "exportação para HTML." -#: ../data/org.gnome.gnote.gschema.xml.in.h:71 +#: ../data/org.gnome.gnote.gschema.xml.in.h:66 msgid "Synchronization Client ID" msgstr "ID do cliente de sincronização" -#: ../data/org.gnome.gnote.gschema.xml.in.h:72 +#: ../data/org.gnome.gnote.gschema.xml.in.h:67 msgid "" "Unique identifier for this Gnote client, used when communicating with a " "synchronization server." msgstr "" -"Um identificador único para este cliente Gnote, usado na comunicação com o " +"Um identificador único para este cliente Gnote, usado na comunicação com um " "servidor de sincronização." -#: ../data/org.gnome.gnote.gschema.xml.in.h:73 +#: ../data/org.gnome.gnote.gschema.xml.in.h:68 msgid "Synchronization Local Server Path" msgstr "Caminho do servidor local de sincronização" -#: ../data/org.gnome.gnote.gschema.xml.in.h:74 +#: ../data/org.gnome.gnote.gschema.xml.in.h:69 msgid "" "Path to the synchronization server when using the filesystem synchronization " "service addin." @@ -519,11 +445,11 @@ "Caminho para o servidor de sincronização a usar quando o plug-in de " "sincronização de sistema de arquivos estiver em uso." -#: ../data/org.gnome.gnote.gschema.xml.in.h:75 +#: ../data/org.gnome.gnote.gschema.xml.in.h:70 msgid "Selected Synchronization Service Addin" msgstr "Plug-in do serviço de sincronização selecionado" -#: ../data/org.gnome.gnote.gschema.xml.in.h:76 +#: ../data/org.gnome.gnote.gschema.xml.in.h:71 msgid "" "Unique identifier for the currently configured note synchronization service " "addin." @@ -531,70 +457,72 @@ "Um identificador único para o plug-in do serviço de sincronização de nota " "configurado atualmente." -#: ../data/org.gnome.gnote.gschema.xml.in.h:77 +#: ../data/org.gnome.gnote.gschema.xml.in.h:72 msgid "Note Synchronization Conflict Saved Behavior" msgstr "Comportamento salvo de conflito de sincronização de nota" -#: ../data/org.gnome.gnote.gschema.xml.in.h:78 +#: ../data/org.gnome.gnote.gschema.xml.in.h:73 msgid "" -"Integer value indicating if there is a preference to always perform a specific " -"behavior when a conflict is detected, instead of prompting the user. The values " -"map to an internal enumeration. 0 indicates that the user wishes to be prompted " -"when a conflict occurs, so that they may handle each conflict situation on a " -"case-by-case basis." -msgstr "" -"Valor inteiro que indica se há uma preferência por um comportamento específico " -"quando um conflito for detectado, em vez de perguntar ao usuário. Os valores " -"são mapeados para uma enumeração interna. 0 indica que o usuário deseja ser " -"perguntado quando ocorrer um conflito, de forma que ele possa lidar caso a caso " -"com as situações de conflito." +"Integer value indicating if there is a preference to always perform a " +"specific behavior when a conflict is detected, instead of prompting the user. " +"The values map to an internal enumeration. 0 indicates that the user wishes " +"to be prompted when a conflict occurs, so that they may handle each conflict " +"situation on a case-by-case basis." +msgstr "" +"Valor inteiro que indica se há uma preferência por um comportamento " +"específico quando um conflito for detectado, em vez de perguntar ao usuário. " +"Os valores são mapeados para uma enumeração interna. 0 indica que o usuário " +"deseja ser perguntado quando ocorrer um conflito, de forma que ele possa " +"lidar caso a caso com as situações de conflito." -#: ../data/org.gnome.gnote.gschema.xml.in.h:79 +#: ../data/org.gnome.gnote.gschema.xml.in.h:74 msgid "Automatic Background Synchronization Timeout" msgstr "Tempo limite de sincronização automática em segundo plano" -#: ../data/org.gnome.gnote.gschema.xml.in.h:80 +#: ../data/org.gnome.gnote.gschema.xml.in.h:75 msgid "" "Integer value indicating how frequently to perform a background sync of your " -"notes (when sync is configured). Any value less than 1 indicates that autosync " -"is disabled. The lowest acceptable positive value is 5. Value is in minutes." +"notes (when sync is configured). Any value less than 1 indicates that " +"autosync is disabled. The lowest acceptable positive value is 5. Value is in " +"minutes." msgstr "" "Valor inteiro que indica qual frequência para executar a sincronização em " "segundo plano das suas notas (quando a sincronização estiver configurada). " "Qualquer valor inferior a 1 indica que a sincronização automática está " "desabilitada. O menor valor positivo aceito é 5. O valor é em minutos." -#: ../data/org.gnome.gnote.gschema.xml.in.h:81 +#: ../data/org.gnome.gnote.gschema.xml.in.h:76 msgid "Accept SSL Certificates" msgstr "Aceitar certificados SSL" -#: ../data/org.gnome.gnote.gschema.xml.in.h:82 +#: ../data/org.gnome.gnote.gschema.xml.in.h:77 msgid "" "Use wdfs option \"-ac\" to accept SSL certificates without prompting the user." msgstr "" -"Usa a opção wdfs \"-ac\" para aceitar certificados SSL sem perguntar ao usuário." +"Usa a opção wdfs \"-ac\" para aceitar certificados SSL sem perguntar ao " +"usuário." -#: ../data/org.gnome.gnote.gschema.xml.in.h:83 +#: ../data/org.gnome.gnote.gschema.xml.in.h:78 msgid "Share URL" msgstr "URL de compartilhamento" -#: ../data/org.gnome.gnote.gschema.xml.in.h:84 +#: ../data/org.gnome.gnote.gschema.xml.in.h:79 msgid "WebDAV share URL where notes are synchronized to." msgstr "URL de compartilhamento WebDav para onde as notas são sincronizadas." -#: ../data/org.gnome.gnote.gschema.xml.in.h:85 +#: ../data/org.gnome.gnote.gschema.xml.in.h:80 msgid "Share username" msgstr "Nome de usuário de compartilhamento" -#: ../data/org.gnome.gnote.gschema.xml.in.h:86 +#: ../data/org.gnome.gnote.gschema.xml.in.h:81 msgid "Username to access WebDAV share." msgstr "Nome do usuário para acessar o compartilhamento WebDav." -#: ../data/org.gnome.gnote.gschema.xml.in.h:87 +#: ../data/org.gnome.gnote.gschema.xml.in.h:82 msgid "Timestamp format" msgstr "Formato de data e hora" -#: ../data/org.gnome.gnote.gschema.xml.in.h:88 +#: ../data/org.gnome.gnote.gschema.xml.in.h:83 msgid "" "The date format that is used for the timestamp. It follows the format of " "strftime(3)." @@ -602,17 +530,18 @@ "O formato de data que é utilizado para a data e hora. Segue o formato do " "strftime(3)." -#: ../data/org.gnome.gnote.gschema.xml.in.h:89 +#: ../data/org.gnome.gnote.gschema.xml.in.h:84 msgid "Time between checks" msgstr "Tempo entre as verificações" -#: ../data/org.gnome.gnote.gschema.xml.in.h:90 -msgid "Time interval between note directory checks (in seconds). Min value is 5." +#: ../data/org.gnome.gnote.gschema.xml.in.h:85 +msgid "" +"Time interval between note directory checks (in seconds). Min value is 5." msgstr "" "Intervalo de tempo entre as verificações do diretório de notas (em segundos). " "Valor mínimo é 5." -#: ../src/actionmanager.cpp:84 ../src/actionmanager.cpp:171 ../src/tray.cpp:465 +#: ../src/actionmanager.cpp:84 ../src/actionmanager.cpp:171 msgid "_Quit" msgstr "Sai_r" @@ -620,7 +549,7 @@ msgid "Quit Gnote" msgstr "Sai do Gnote" -#: ../src/actionmanager.cpp:89 ../src/actionmanager.cpp:168 ../src/tray.cpp:448 +#: ../src/actionmanager.cpp:89 ../src/actionmanager.cpp:168 msgid "_Preferences" msgstr "_Preferências" @@ -648,19 +577,19 @@ msgid "TrayIcon" msgstr "Ícone da área de notificação" -#: ../src/actionmanager.cpp:107 ../src/tray.cpp:225 +#: ../src/actionmanager.cpp:107 msgid "Create _New Note" msgstr "Criar uma _nova nota" -#: ../src/actionmanager.cpp:107 ../src/tray.cpp:227 +#: ../src/actionmanager.cpp:107 msgid "Create a new note" msgstr "Cria uma nova nota" -#: ../src/actionmanager.cpp:112 ../src/tray.cpp:234 +#: ../src/actionmanager.cpp:112 msgid "_Search All Notes" msgstr "_Pesquisar em todas as notas" -#: ../src/actionmanager.cpp:112 ../src/tray.cpp:236 +#: ../src/actionmanager.cpp:112 msgid "Open the Search All Notes window" msgstr "Abre a janela \"Pesquisar em todas as notas\"" @@ -672,7 +601,7 @@ msgid "New _Window" msgstr "Nova _janela" -#: ../src/actionmanager.cpp:169 ../src/tray.cpp:453 +#: ../src/actionmanager.cpp:169 msgid "_Help" msgstr "Aj_uda" @@ -738,7 +667,8 @@ #: ../src/addins/backlinks/backlinks.desktop.in.in.h:2 msgid "See which notes link to the one you're currently viewing." -msgstr "Veja quais notas estão vinculadas à nota que você está vendo atualmente." +msgstr "" +"Veja quais notas estão vinculadas à nota que você está vendo atualmente." #: ../src/addins/backlinks/backlinks.desktop.in.in.h:3 #: ../src/addins/inserttimestamp/inserttimestamp.desktop.in.in.h:3 @@ -758,9 +688,9 @@ "Allows you to drag a Bugzilla URL from your browser directly into a Gnote " "note. The bug number is inserted as a link with a little bug icon next to it." msgstr "" -"Permite que você arraste uma URL do Bugzilla do seu navegador diretamente para " -"uma nota do Gnote. O número do bug é inserido como um link com um pequeno ícone " -"de bug ao lado dele." +"Permite que você arraste uma URL do Bugzilla do seu navegador diretamente " +"para uma nota do Gnote. O número do bug é inserido como um link com um " +"pequeno ícone de bug ao lado dele." #: ../src/addins/bugzilla/bugzilla.desktop.in.in.h:3 #: ../src/addins/exporttohtml/exporttohtml.desktop.in.in.h:3 @@ -775,8 +705,8 @@ "You can use any bugzilla just by dragging links into notes. If you want a " "special icon for certain hosts, add them here." msgstr "" -"Você pode usar qualquer bugzilla apenas arrastando links para dentro das notas. " -"Se você quer um ícone especial para certas máquinas, adicione-os aqui." +"Você pode usar qualquer bugzilla apenas arrastando links para dentro das " +"notas. Se você quer um ícone especial para certas máquinas, adicione-os aqui." #: ../src/addins/bugzilla/bugzillapreferences.cpp:81 msgid "Host Name" @@ -802,8 +732,8 @@ #: ../src/addins/bugzilla/bugzillapreferences.cpp:279 msgid "You must specify a valid Bugzilla host name to use with this icon." msgstr "" -"Você deve especificar um nome de máquina do Bugzilla válido para usar com este " -"ícone." +"Você deve especificar um nome de máquina do Bugzilla válido para usar com " +"este ícone." #: ../src/addins/bugzilla/bugzillapreferences.cpp:298 msgid "Error saving icon" @@ -856,7 +786,7 @@ #: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:100 msgid "Failed to create D-Bus proxy for GTG" -msgstr "Ocorreu falha ao criar proxy D-Bus para o GTG" +msgstr "Falha ao criar proxy D-Bus para o GTG" #: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:116 #, c-format @@ -1016,10 +946,6 @@ msgstr "" "Monitor de diretório de notas: Atualização abortada, erro ao analisar %s: %s" -#: ../src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp:35 -msgid "_Directory check interval:" -msgstr "Intervalo de verificação do _diretório:" - #: ../src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in.in.h:1 msgid "Note Directory Watcher" msgstr "Monitor de diretório de notas" @@ -1032,6 +958,10 @@ msgid "Aurimas Černius and Tomboy original authors" msgstr "Aurimas Černius e os autores originais do Tomboy" +#: ../src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp:35 +msgid "_Directory check interval:" +msgstr "Intervalo de verificação do _diretório:" + #: ../src/addins/noteoftheday/noteoftheday.cpp:33 msgid "Today: Template" msgstr "Hoje: modelo" @@ -1143,8 +1073,8 @@ msgid "Pierre-Yves Luyten" msgstr "Pierre-Yves Luyten" -#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:1 #: ../src/addins/specialnotes/specialnotesapplicationaddin.cpp:38 +#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:1 msgid "Special Notes" msgstr "Notas especiais" @@ -1320,8 +1250,8 @@ "There was an error connecting to the server. This may be caused by using an " "incorrect user name and/or password." msgstr "" -"Houve um erro ao conectar ao servidor. Isso pode ser causado pelo uso incorreto " -"de nome de usuário e/ou senha." +"Houve um erro ao conectar ao servidor. Isso pode ser causado pelo uso " +"incorreto de nome de usuário e/ou senha." #: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:173 msgid "URL, username, or password field is empty." @@ -1360,15 +1290,15 @@ msgid "Exception thrown when creating note: %s" msgstr "Exceção lançada ao criar a nota: %s" -#: ../src/gnote.cpp:200 +#: ../src/gnote.cpp:185 msgid "Gnote is already running. Exiting..." msgstr "Gnote já está em execução. Saindo..." -#: ../src/gnote.cpp:365 +#: ../src/gnote.cpp:289 msgid "and Tomboy original authors." msgstr "e os autores originais do Tomboy." -#: ../src/gnote.cpp:371 +#: ../src/gnote.cpp:295 msgid "translator-credits" msgstr "" "Marco de Freitas , 2009\n" @@ -1377,91 +1307,91 @@ "Rafael Ferreira , 2013\n" "Júnior Pires , 2013." -#: ../src/gnote.cpp:380 +#: ../src/gnote.cpp:304 msgid "" -"Copyright © 2010-2014 Aurimas Cernius\n" +"Copyright © 2010-2015 Aurimas Cernius\n" "Copyright © 2009-2011 Debarshi Ray\n" "Copyright © 2009 Hubert Figuiere\n" "Copyright © 2004-2009 the Tomboy original authors." msgstr "" -"Copyright © 2010-2014 Aurimas Cernius\n" +"Copyright © 2010-2015 Aurimas Cernius\n" "Copyright © 2009-2011 Debarshi Ray\n" "Copyright © 2009 Hubert Figuiere\n" "Copyright © 2004-2009 autores originais do Tomboy." -#: ../src/gnote.cpp:384 +#: ../src/gnote.cpp:308 msgid "A simple and easy to use desktop note-taking application." msgstr "Um aplicativo simples e fácil de usar para tomar notas." -#: ../src/gnote.cpp:395 +#: ../src/gnote.cpp:319 msgid "Homepage" msgstr "Página do projeto" -#: ../src/gnote.cpp:570 +#: ../src/gnote.cpp:494 msgid "Run Gnote in background." msgstr "Executar o Gnote em segundo plano." -#: ../src/gnote.cpp:571 +#: ../src/gnote.cpp:495 msgid "Run Gnote as GNOME Shell search provider." -msgstr "Executa o Gnote como um provedor de pesquisa do GNOME Shell." +msgstr "Executa o Gnote como provedor de pesquisa do GNOME Shell." -#: ../src/gnote.cpp:572 +#: ../src/gnote.cpp:496 msgid "Specify the path of the directory containing the notes." msgstr "Especifica o caminho do diretório que contém as notas." -#: ../src/gnote.cpp:572 +#: ../src/gnote.cpp:496 msgid "path" msgstr "caminho" -#: ../src/gnote.cpp:573 +#: ../src/gnote.cpp:497 msgid "Open the search all notes window with the search text." msgstr "Abre a janela \"pesquisar em todas as notas\" com o texto de pesquisa." -#: ../src/gnote.cpp:573 ../src/gnote.cpp:578 +#: ../src/gnote.cpp:497 ../src/gnote.cpp:502 msgid "text" msgstr "texto" -#: ../src/gnote.cpp:574 +#: ../src/gnote.cpp:498 msgid "Print version information." msgstr "Imprime informações da versão." -#: ../src/gnote.cpp:575 +#: ../src/gnote.cpp:499 msgid "Create and display a new note, with a optional title." msgstr "Cria e exibe uma nova nota, com um título opcional." -#: ../src/gnote.cpp:575 +#: ../src/gnote.cpp:499 msgid "title" msgstr "título" -#: ../src/gnote.cpp:576 +#: ../src/gnote.cpp:500 msgid "Display the existing note matching title." msgstr "Exibe a nota correspondente ao título." -#: ../src/gnote.cpp:576 +#: ../src/gnote.cpp:500 msgid "title/url" msgstr "título/url" -#: ../src/gnote.cpp:577 +#: ../src/gnote.cpp:501 msgid "Display the 'Start Here' note." msgstr "Exibe a nota \"Comece aqui\"." -#: ../src/gnote.cpp:578 +#: ../src/gnote.cpp:502 msgid "Search and highlight text in the opened note." msgstr "Pesquisa e destaca o texto na nota aberta." -#: ../src/gnote.cpp:582 +#: ../src/gnote.cpp:506 msgid "A note taking application" msgstr "Um aplicativo para tomar notas" -#: ../src/gnote.cpp:582 +#: ../src/gnote.cpp:506 msgid "Gnote options at launch" msgstr "Opções do Gnote na inicialização" -#: ../src/gnote.cpp:659 +#: ../src/gnote.cpp:583 msgid "Could not connect to remote instance." msgstr "Não foi possível conectar à instância remota." -#: ../src/gnote.cpp:775 +#: ../src/gnote.cpp:699 msgid "Version %1%" msgstr "Versão %1%" @@ -1479,6 +1409,23 @@ msgid "Window is not embedded" msgstr "A janela não está embutida" +#. Probably IOException or UnauthorizedAccessException? +#: ../src/notebase.cpp:200 ../src/note.cpp:382 +#, c-format +msgid "Exception while saving note: %s" +msgstr "Exceção ao salvar a nota: %s" + +#. write failure, but not critical +#: ../src/notebase.cpp:444 +#, c-format +msgid "Failed to update note format: %s" +msgstr "Falha ao atualizar o formato da nota: %s" + +#: ../src/notebase.cpp:568 +#, c-format +msgid "Filesystem error: %s" +msgstr "Erro de sistema de arquivos: %s" + #: ../src/notebooks/createnotebookdialog.cpp:41 msgid "Create Notebook" msgstr "Criar catálogo de notas" @@ -1536,7 +1483,7 @@ "As notas que pertencem a este catálogo de notas não serão excluídas, mas não " "serão mais associadas a ele. Esta ação não pode ser desfeita." -#: ../src/notebooks/notebookmenuitem.cpp:35 +#: ../src/notebooks/notebookmenuitem.cpp:34 msgid "No notebook" msgstr "Nenhum catálogo de notas" @@ -1544,15 +1491,16 @@ msgid "New \"%1%\" Note" msgstr "Nova nota de \"%1%\"" -#: ../src/notebooks/notebooknoteaddin.cpp:81 -msgid "Place this note into a notebook" -msgstr "Coloca esta nota dentro de um catálogo de notas" - -#: ../src/notebooks/notebooknoteaddin.cpp:191 +#: ../src/notebooks/notebooknoteaddin.cpp:72 msgid "Notebook" msgstr "Catálogo de notas" -#: ../src/notebooks/notebooknoteaddin.cpp:214 +#: ../src/notebooks/notebooknoteaddin.cpp:73 +msgid "Place this note into a notebook" +msgstr "Coloca esta nota dentro de um catálogo de notas" + +#. Add new notebook item +#: ../src/notebooks/notebooknoteaddin.cpp:153 msgid "_New notebook..." msgstr "_Novo catálogo de notas..." @@ -1608,14 +1556,8 @@ "gnote. Error details can be found in ~/.gnote.log." msgstr "" "Ocorreu um erro ao salvar suas notas. Por favor, verifique se você tem espaço " -"em disco suficiente e que tenha permissões sobre ~/.local/share/gnote. Detalhes " -"do erro podem ser localizados em ~/.gnote.log." - -#. Probably IOException or UnauthorizedAccessException? -#: ../src/note.cpp:382 ../src/notebase.cpp:200 -#, c-format -msgid "Exception while saving note: %s" -msgstr "Exceção ao salvar a nota: %s" +"em disco suficiente e que tenha permissões sobre ~/.local/share/gnote. " +"Detalhes do erro podem ser localizados em ~/.gnote.log." #: ../src/note.cpp:474 #, c-format @@ -1626,20 +1568,18 @@ msgid "Setting text content for closed notes not supported" msgstr "Não suporte à definição do conteúdo de texto para notas fechadas" -#. write failure, but not critical -#: ../src/notebase.cpp:444 -#, c-format -msgid "Failed to update note format: %s" -msgstr "Falha ao atualizar o formato da nota: %s" +#: ../src/notemanagerbase.cpp:105 ../src/preferencesdialog.cpp:320 +msgid "New Note Template" +msgstr "Novo modelo de nota" -#: ../src/notebase.cpp:568 -#, c-format -msgid "Filesystem error: %s" -msgstr "Erro de sistema de arquivos: %s" +#: ../src/notemanagerbase.cpp:359 +msgid "Describe your new note here." +msgstr "Descreva sua nova nota aqui." #: ../src/notemanager.cpp:133 msgid "" -"Start Here\n" +"Start " +"Here\n" "\n" "Welcome to Gnote!\n" "\n" @@ -1654,8 +1594,8 @@ "\n" "We've created a note called Using Links in Gnote. Notice how each time we type Using Links in Gnote it automatically gets underlined? Click on the link to open the " -"note." +"link:internal> it automatically gets underlined? Click on the link to open " +"the note." msgstr "" "Comece " "aqui\n" @@ -1666,23 +1606,24 @@ "pensamentos.\n" "\n" "Você pode criar novas notas para armazenar suas ideias ao selecionar o item " -"\"Criar uma nova nota\" no menu do Gnote no painel do seu GNOME. Sua nota será " -"salva automaticamente.\n" +"\"Criar uma nova nota\" no menu do Gnote no painel do seu GNOME. Sua nota " +"será salva automaticamente.\n" "\n" "Em seguida, organize as notas criadas ao associar ideias relacionadas!\n" "\n" "Nós criamos uma nota chamada Utilizando links no Gnote. Viu que cada vez que digitamos Utilizando links no " -"Gnote ele automaticamente fica sublinhado? Clique no link para " -"abrir a nota." +"Gnote ele automaticamente fica sublinhado? Clique no link " +"para abrir a nota." #: ../src/notemanager.cpp:152 msgid "" "Using Links in Gnote\n" "\n" -"Notes in Gnote can be linked together by highlighting text in the current note " -"and clicking the Link button above in the toolbar. Doing so will " -"create a new note and also underline the note's title in the current note.\n" +"Notes in Gnote can be linked together by highlighting text in the current " +"note and clicking the Link button above in the toolbar. Doing " +"so will create a new note and also underline the note's title in the current " +"note.\n" "\n" "Changing the title of a note will update links present in other notes. This " "prevents broken links from occurring when a note is renamed.\n" @@ -1692,16 +1633,16 @@ msgstr "" "Utilizando links no Gnote\n" "\n" -"Notas no Gnote podem ser vinculadas ao destacar o texto na nota atual e clicar " -"no botão Link na barra de ferramentas. Isso criará uma nova nota e " -"o título da nota atual ficará sublinhado.\n" +"Notas no Gnote podem ser vinculadas ao destacar o texto na nota atual e " +"clicar no botão Link na barra de ferramentas. Isso criará uma " +"nova nota e o título da nota atual ficará sublinhado.\n" "\n" "Modificações no título de uma nota atualizará os links presentes em outras " "notas. Isto previne a ocorrência de links quebrados quando uma nota for " "renomeada.\n" "\n" -"Além disso, se você digitar o nome de outra nota na sua nota atual, o link será " -"automaticamente estabelecido para você." +"Além disso, se você digitar o nome de outra nota na sua nota atual, o link " +"será automaticamente estabelecido para você." #. Attempt to find an existing Start Here note #: ../src/notemanager.cpp:167 ../src/notemanager.cpp:208 @@ -1723,14 +1664,6 @@ msgid "Error parsing note XML, skipping \"%s\": %s" msgstr "Erro na análise do XML da nota, ignorando \"%s\": %s" -#: ../src/notemanagerbase.cpp:105 ../src/preferencesdialog.cpp:332 -msgid "New Note Template" -msgstr "Novo modelo de nota" - -#: ../src/notemanagerbase.cpp:359 -msgid "Describe your new note here." -msgstr "Descreva sua nova nota aqui." - #: ../src/noterenamedialog.cpp:123 msgid "Rename Note Links?" msgstr "Renomear links de nota?" @@ -1821,8 +1754,8 @@ "This note is a template note. It determines the default content of regular " "notes, and will not show up in the note menu or search window." msgstr "" -"Esta nota é uma nota de modelo. Determina o conteúdo padrão de notas regulares " -"e não vai aparecer na janela do menu ou na pesquisa de notas." +"Esta nota é uma nota de modelo. Determina o conteúdo padrão de notas " +"regulares e não vai aparecer na janela do menu ou na pesquisa de notas." #: ../src/notewindow.cpp:449 msgid "Convert to regular note" @@ -1840,47 +1773,47 @@ msgid "Save _Title" msgstr "Salvar _título" -#: ../src/notewindow.cpp:562 ../src/notewindow.cpp:1084 +#: ../src/notewindow.cpp:562 ../src/notewindow.cpp:1085 msgid "Cannot create note" msgstr "Não foi possível criar a nota" -#: ../src/notewindow.cpp:827 +#: ../src/notewindow.cpp:828 msgid "_Link" msgstr "_Link" -#: ../src/notewindow.cpp:828 +#: ../src/notewindow.cpp:829 msgid "_Bold" msgstr "_Negrito" -#: ../src/notewindow.cpp:829 +#: ../src/notewindow.cpp:830 msgid "_Italic" msgstr "_Itálico" -#: ../src/notewindow.cpp:830 +#: ../src/notewindow.cpp:831 msgid "_Strikeout" msgstr "Ri_scado" -#: ../src/notewindow.cpp:832 +#: ../src/notewindow.cpp:833 msgid "_Highlight" msgstr "_Destacar" -#: ../src/notewindow.cpp:834 +#: ../src/notewindow.cpp:835 msgid "_Normal" msgstr "_Normal" -#: ../src/notewindow.cpp:836 +#: ../src/notewindow.cpp:837 msgid "Hu_ge" msgstr "Enor_me" -#: ../src/notewindow.cpp:838 +#: ../src/notewindow.cpp:839 msgid "_Large" msgstr "_Grande" -#: ../src/notewindow.cpp:840 +#: ../src/notewindow.cpp:841 msgid "S_mall" msgstr "_Pequeno" -#: ../src/notewindow.cpp:842 +#: ../src/notewindow.cpp:843 msgid "Bullets" msgstr "Marcadores" @@ -1892,122 +1825,109 @@ msgid "Links" msgstr "Links" -#: ../src/preferencesdialog.cpp:125 -msgid "Hotkeys" -msgstr "Teclas de atalho" - #. TRANSLATORS: Addin category. -#: ../src/preferencesdialog.cpp:129 ../src/sharp/addinstreemodel.cpp:164 +#: ../src/preferencesdialog.cpp:125 ../src/sharp/addinstreemodel.cpp:164 msgid "Synchronization" msgstr "Sincronização" -#: ../src/preferencesdialog.cpp:131 +#: ../src/preferencesdialog.cpp:127 msgid "Plugins" msgstr "Plug-ins" -#: ../src/preferencesdialog.cpp:208 +#: ../src/preferencesdialog.cpp:204 #, c-format msgid "Plugin %s is absent" msgstr "Plug-in %s está ausente" -#. Status icon -#: ../src/preferencesdialog.cpp:247 -msgid "Use status _icon" -msgstr "Usar _ícone de status" - -#: ../src/preferencesdialog.cpp:248 -msgid "Show icon in tray, which is the central place of control." -msgstr "Mostra o ícone na bandeja, que é o local central de controle." - #. Open in new window -#: ../src/preferencesdialog.cpp:255 +#: ../src/preferencesdialog.cpp:243 msgid "Always _open notes in new window" msgstr "Sempre _abrir notas em uma nova janela" -#: ../src/preferencesdialog.cpp:268 +#: ../src/preferencesdialog.cpp:256 msgid "_Spell check while typing" msgstr "_Verificação ortográfica ao digitar" -#: ../src/preferencesdialog.cpp:269 +#: ../src/preferencesdialog.cpp:257 msgid "" -"Misspellings will be underlined in red, with correct spelling suggestions shown " -"in the context menu." +"Misspellings will be underlined in red, with correct spelling suggestions " +"shown in the context menu." msgstr "" "Erros ortográficos serão sublinhados de vermelho, com sugestões de ortografia " "mostradas no menu de contexto." #. Auto bulleted list -#: ../src/preferencesdialog.cpp:279 +#: ../src/preferencesdialog.cpp:267 msgid "Enable auto-_bulleted lists" msgstr "Habilitar listas _marcadas automaticamente" -#: ../src/preferencesdialog.cpp:280 +#: ../src/preferencesdialog.cpp:268 msgid "Start new bulleted list by starting new line with character \"-\"." msgstr "" "Iniciar nova lista de marcadores ao iniciar nova linha com o caractere \"-\"." -#: ../src/preferencesdialog.cpp:289 +#: ../src/preferencesdialog.cpp:277 msgid "Use custom _font" msgstr "Utilizar _fonte personalizada" -#: ../src/preferencesdialog.cpp:307 +#: ../src/preferencesdialog.cpp:295 msgid "When renaming a linked note: " msgstr "Ao renomear uma nota vinculada: " -#: ../src/preferencesdialog.cpp:311 +#: ../src/preferencesdialog.cpp:299 msgid "Ask me what to do" msgstr "Pergunte-me o que fazer" -#: ../src/preferencesdialog.cpp:312 +#: ../src/preferencesdialog.cpp:300 msgid "Never rename links" msgstr "Nunca renomear os vínculos" -#: ../src/preferencesdialog.cpp:313 +#: ../src/preferencesdialog.cpp:301 msgid "Always rename links" msgstr "Sempre renomear os vínculos" -#: ../src/preferencesdialog.cpp:333 +#: ../src/preferencesdialog.cpp:321 msgid "" -"Use the new note template to specify the text that should be used when creating " -"a new note." +"Use the new note template to specify the text that should be used when " +"creating a new note." msgstr "" -"Usar o modelo de nova nota para especificar o texto que deve ser usado ao criar " -"uma nova nota." +"Usar o modelo de nova nota para especificar o texto que deve ser usado ao " +"criar uma nova nota." -#: ../src/preferencesdialog.cpp:338 +#: ../src/preferencesdialog.cpp:326 msgid "Open New Note Template" msgstr "Abrir o modelo de nova nota" #. internal links -#: ../src/preferencesdialog.cpp:395 +#: ../src/preferencesdialog.cpp:383 msgid "_Automatically link to notes" msgstr "_Vincular automaticamente a notas" -#: ../src/preferencesdialog.cpp:396 +#: ../src/preferencesdialog.cpp:384 msgid "Enable this option to create a link when text matches note title." msgstr "" -"Habilite esta opção para criar um link quando o texto coincidir com o título da " -"nota." +"Habilite esta opção para criar um link quando o texto coincidir com o título " +"da nota." #. URLs -#: ../src/preferencesdialog.cpp:402 +#: ../src/preferencesdialog.cpp:390 msgid "Create links for _URLs" msgstr "Criar links para _URLs" -#: ../src/preferencesdialog.cpp:403 +#: ../src/preferencesdialog.cpp:391 msgid "" "Enable this option to create links for URLs. Clicking will open URL with " "appropriate program." msgstr "" -"Habilite esta opção para criar links para as URLs. Ao clicar será aberto a URL " -"com o programa apropriado." +"Habilite esta opção para criar links para os URLs. Ao clicar será aberto " +"aquela URL com o programa apropriado." #. WikiWords... -#: ../src/preferencesdialog.cpp:410 +#: ../src/preferencesdialog.cpp:398 msgid "Highlight _WikiWords" msgstr "Destacar palavras _Wiki" -#: ../src/preferencesdialog.cpp:411 +#: ../src/preferencesdialog.cpp:399 msgid "" "Enable this option to highlight words ThatLookLikeThis. Clicking the " "word will create a note with that name." @@ -2015,89 +1935,55 @@ "Habilite essa opção para destacar palavras QueSeParecemComEsta. Ao " "clicar na palavra uma nota com aquele nome será criada." -#. Hotkeys... -#: ../src/preferencesdialog.cpp:441 -msgid "Listen for _hotkeys" -msgstr "Capturar t_eclas de atalho" - -#: ../src/preferencesdialog.cpp:442 -msgid "" -"Hotkeys allow you to quickly access your notes from anywhere with a keypress. " -"Example Hotkeys: <Control><Shift>F11, <Alt>N" -msgstr "" -"Teclas de atalho permitem que você acesse rapidamente suas notas de qualquer " -"lugar pressionando uma tecla. Exemplos de teclas de atalho: <Control>" -"<Shift>F11, <Alt>N" - -#. Show notes menu keybinding... -#: ../src/preferencesdialog.cpp:464 -msgid "Show notes _menu" -msgstr "Mostrar _menu de notas" - -#. Open Start Here keybinding... -#: ../src/preferencesdialog.cpp:481 -msgid "Open \"_Start Here\"" -msgstr "Abrir \"_Comece aqui\"" - -#. Create new note keybinding... -#: ../src/preferencesdialog.cpp:497 -msgid "Create _new note" -msgstr "Criar uma _nova nota" - -#. Open Search window keybinding... -#: ../src/preferencesdialog.cpp:513 -msgid "Open Search _Window" -msgstr "Abrir _janela de pesquisa" - -#: ../src/preferencesdialog.cpp:553 +#: ../src/preferencesdialog.cpp:431 msgid "Ser_vice:" msgstr "Ser_viço:" -#: ../src/preferencesdialog.cpp:609 ../src/preferencesdialog.cpp:1239 +#: ../src/preferencesdialog.cpp:487 ../src/preferencesdialog.cpp:1117 msgid "Not configurable" msgstr "Não configurável" -#: ../src/preferencesdialog.cpp:636 +#: ../src/preferencesdialog.cpp:514 msgid "Automatical background s_ync interval (minutes)" msgstr "Intervalo de sincronização automática em segundo plano (minutos)" #. "Advanced..." button to bring up extra sync config dialog -#: ../src/preferencesdialog.cpp:660 +#: ../src/preferencesdialog.cpp:538 msgid "_Advanced..." msgstr "_Avançado..." -#: ../src/preferencesdialog.cpp:707 +#: ../src/preferencesdialog.cpp:585 msgid "The following plugins are installed:" msgstr "Os seguintes plug-ins estão instalados:" #. TODO: In a future version, add in an "Install Add-ins..." button #. TODO: In a future version, add in a "Repositories..." button -#: ../src/preferencesdialog.cpp:742 +#: ../src/preferencesdialog.cpp:620 msgid "_Enable" msgstr "_Habilitar" -#: ../src/preferencesdialog.cpp:748 +#: ../src/preferencesdialog.cpp:626 msgid "_Disable" msgstr "_Desabilitar" -#: ../src/preferencesdialog.cpp:906 +#: ../src/preferencesdialog.cpp:784 msgid "Not Implemented" msgstr "Não implementado" -#: ../src/preferencesdialog.cpp:922 +#: ../src/preferencesdialog.cpp:800 msgid "%1% Preferences" msgstr "Preferências de %1%" -#: ../src/preferencesdialog.cpp:1057 +#: ../src/preferencesdialog.cpp:935 msgid "Choose Note Font" msgstr "Escolha a fonte das notas" #. Create dialog -#: ../src/preferencesdialog.cpp:1155 +#: ../src/preferencesdialog.cpp:1033 msgid "Other Synchronization Options" msgstr "Outras opções de sincronização" -#: ../src/preferencesdialog.cpp:1158 +#: ../src/preferencesdialog.cpp:1036 msgid "" "When a conflict is detected between a local note and a note on the configured " "synchronization server:" @@ -2106,23 +1992,23 @@ "sincronização configurados:" #. label.Xalign = 0; -#: ../src/preferencesdialog.cpp:1162 +#: ../src/preferencesdialog.cpp:1040 msgid "Always ask me what to do" msgstr "Pergunte-me sempre o que fazer" -#: ../src/preferencesdialog.cpp:1166 +#: ../src/preferencesdialog.cpp:1044 msgid "Rename my local note" msgstr "Renomear minha nota local." -#: ../src/preferencesdialog.cpp:1170 +#: ../src/preferencesdialog.cpp:1048 msgid "Replace my local note with the server's update" msgstr "Substituir minha nota local com a atualização do servidor." -#: ../src/preferencesdialog.cpp:1272 +#: ../src/preferencesdialog.cpp:1150 msgid "Are you sure?" msgstr "Tem certeza?" -#: ../src/preferencesdialog.cpp:1273 +#: ../src/preferencesdialog.cpp:1151 msgid "" "Clearing your synchronization settings is not recommended. You may be forced " "to synchronize all of your notes again when you save new settings." @@ -2131,52 +2017,52 @@ "forçado para sincronizar todas as notas novamente quando você salva as novas " "configurações." -#: ../src/preferencesdialog.cpp:1283 +#: ../src/preferencesdialog.cpp:1161 msgid "Resetting Synchronization Settings" msgstr "Redefinir as configurações de sincronização" -#: ../src/preferencesdialog.cpp:1284 +#: ../src/preferencesdialog.cpp:1162 msgid "" -"You have disabled the configured synchronization service. Your synchronization " -"settings will now be cleared. You may be forced to synchronize all of your " -"notes again when you save new settings." -msgstr "" -"Você desabilitou o serviço de sincronização configurado. Suas configurações de " -"sincronização serão apagadas agora. Você pode ser forçado a sincronizar todas " -"as suas notas novamente quando salvar novas configurações." +"You have disabled the configured synchronization service. Your " +"synchronization settings will now be cleared. You may be forced to " +"synchronize all of your notes again when you save new settings." +msgstr "" +"Você desabilitou o serviço de sincronização configurado. Suas configurações " +"de sincronização serão apagadas agora. Você pode ser forçado a sincronizar " +"todas as suas notas novamente quando salvar novas configurações." -#: ../src/preferencesdialog.cpp:1350 +#: ../src/preferencesdialog.cpp:1228 msgid "Connection successful" msgstr "Conexão realizada com sucesso" -#: ../src/preferencesdialog.cpp:1351 +#: ../src/preferencesdialog.cpp:1229 msgid "" "Gnote is ready to synchronize your notes. Would you like to synchronize them " "now?" msgstr "" "Gnote está pronto a sincronizar suas notas. Gostaria de sincronizá-las agora?" -#: ../src/preferencesdialog.cpp:1375 +#: ../src/preferencesdialog.cpp:1253 msgid "" -"Please check your information and try again. The log file %1% may contain more " -"information about the error." +"Please check your information and try again. The log file %1% may contain " +"more information about the error." msgstr "" -"Por favor, verifique suas informações e tente novamente. O arquivo de log %1% " -"pode conter mais informações sobre o erro." +"Por favor, verifique suas informações e tente novamente. O arquivo de log " +"%1% pode conter mais informações sobre o erro." -#: ../src/preferencesdialog.cpp:1380 +#: ../src/preferencesdialog.cpp:1258 msgid "Error connecting" msgstr "Erro ao conectar" -#: ../src/preferencesdialog.cpp:1443 +#: ../src/preferencesdialog.cpp:1321 msgid "Version:" msgstr "Versão:" -#: ../src/preferencesdialog.cpp:1446 +#: ../src/preferencesdialog.cpp:1324 msgid "Author:" msgstr "Autor:" -#: ../src/preferencesdialog.cpp:1451 +#: ../src/preferencesdialog.cpp:1329 msgid "Copyright:" msgstr "Copyright:" @@ -2353,9 +2239,9 @@ "Exception during server cleanup while committing. Server integrity is OK, but " "there may be some excess files floating around. Here's the error: %s\n" msgstr "" -"Exceção durante limpeza de servidor ao submeter. A integridade do servidor está " -"OK, mas pode haver um excesso de arquivos flutuantes por aí. Aqui está o erro: " -"%s\n" +"Exceção durante limpeza de servidor ao submeter. A integridade do servidor " +"está OK, mas pode haver um excesso de arquivos flutuantes por aí. Aqui está o " +"erro: %s\n" #: ../src/synchronization/filesystemsyncserver.cpp:609 #, c-format @@ -2364,11 +2250,12 @@ #: ../src/synchronization/fusesyncserviceaddin.cpp:115 msgid "" -"This synchronization addin is not supported on your computer. Please make sure " -"you have FUSE and %1% correctly installed and configured" +"This synchronization addin is not supported on your computer. Please make " +"sure you have FUSE and %1% correctly installed and configured" msgstr "" -"Esse suplemento de sincronização não tem suporte no seu computador. Por favor, " -"certifique-se de que você tem FUSE e %1% instalados e configurados corretamente" +"Esse suplemento de sincronização não tem suporte no seu computador. Por " +"favor, certifique-se de que você tem FUSE e %1% instalados e configurados " +"corretamente" #: ../src/synchronization/fusesyncserviceaddin.cpp:158 msgid "Could not read testfile." @@ -2438,11 +2325,11 @@ #: ../src/synchronization/syncdialog.cpp:139 msgid "" -"The server version of \"%1%\" conflicts with your local note. What do you want " -"to do with your local note?" +"The server version of \"%1%\" conflicts with your local note. What do you " +"want to do with your local note?" msgstr "" -"A versão do servidor de \"%1%\" está em conflito com sua nota local. O que quer " -"fazer com sua nota local?" +"A versão do servidor de \"%1%\" está em conflito com sua nota local. O que " +"quer fazer com sua nota local?" #. Expander containing TreeView #: ../src/synchronization/syncdialog.cpp:296 @@ -2495,8 +2382,8 @@ #: ../src/synchronization/syncdialog.cpp:517 msgid "" -"One of your other computers is currently synchronizing. Please wait 2 minutes " -"and try again." +"One of your other computers is currently synchronizing. Please wait 2 " +"minutes and try again." msgstr "" "Um de seus outros computadores está sincronizando agora. Por favor, aguarde 2 " "minutos e tente novamente." @@ -2641,8 +2528,8 @@ #: ../src/synchronization/syncutils.cpp:149 #: ../src/synchronization/syncutils.cpp:181 msgid "" -"The FUSE module could not be loaded. Please check that it is installed properly " -"and try again." +"The FUSE module could not be loaded. Please check that it is installed " +"properly and try again." msgstr "" "O módulo FUSE pode não estar carregado. Por favor, certifique-se de que ele " "está instalado adequadamente e tente novamente." @@ -2666,25 +2553,13 @@ "na inicialização. Adicione \"modprobe fuse\" para o /etc/init.d/boot.local ou " "\"fuse\" para /etc/modules." -#: ../src/tray.cpp:54 -msgid "Take notes" -msgstr "Tome notas" - -#: ../src/tray.cpp:167 -msgid " (new)" -msgstr " (nova)" - -#: ../src/tray.cpp:458 -msgid "_About Gnote" -msgstr "_Sobre o Gnote" - #: ../src/utils.cpp:144 msgid "" -"The \"Gnote Manual\" could not be found. Please verify that your installation " -"has been completed successfully." +"The \"Gnote Manual\" could not be found. Please verify that your " +"installation has been completed successfully." msgstr "" -"O \"Manual do Gnote\" não foi localizado. Por favor, certifique-se de que a sua " -"instalação foi concluída com sucesso." +"O \"Manual do Gnote\" não foi localizado. Por favor, certifique-se de que a " +"sua instalação foi concluída com sucesso." #: ../src/utils.cpp:152 msgid "Help not found" @@ -2746,11 +2621,11 @@ #: ../src/watchers.cpp:231 msgid "" -"A note with the title %1% already exists. Please choose another name for " -"this note before continuing." +"A note with the title %1% already exists. Please choose another name " +"for this note before continuing." msgstr "" -"Já existe uma nota com o título %1%. Por favor, escolha outro nome para " -"esta nota antes de continuar." +"Já existe uma nota com o título %1%. Por favor, escolha outro nome " +"para esta nota antes de continuar." #: ../src/watchers.cpp:246 msgid "Note title taken" @@ -2772,6 +2647,133 @@ msgid "_Open Link" msgstr "Abrir _link" +#~ msgid "" +#~ "Has affect only when started as an application. When set to TRUE, shows a " +#~ "status icon. If set to FALSE, Search All Notes window is used as main " +#~ "application window, closing which makes application to exit." +#~ msgstr "" +#~ "Tem efeito apenas quando iniciado como um aplicativo. Quando definido como " +#~ "VERDADEIRO, mostra um ícone de status. Se definido como FALSO, pesquisa " +#~ "todas as janela do de notas usadas na janela principal do aplicativo, " +#~ "fechando o que faz a aplicação para sair." + +#~ msgid "" +#~ "The global keybinding for showing the Gnote applet's menu. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the " +#~ "option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "As teclas de atalho globais para exibir o menu do miniaplicativo Gnote. O " +#~ "formato se parece com \"<Control>a\" ou \"<Shift><Alt>" +#~ "F1\". O analisador é bastante liberal e permite minúsculas, maiúsculas e " +#~ "também abreviações como \"<Ctl>\" e \"<Ctrl>\". Se você " +#~ "definir a opção com a string especial \"disabled\", não haverá combinação " +#~ "de teclas para essa ação." + +#~ msgid "" +#~ "The global keybinding for opening the \"Start Here\" note. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the " +#~ "option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "As teclas de atalho globais para abrir a nota \"Comece aqui\". O formato " +#~ "se parece com \"<Control>a\" ou \"<Shift><Alt>F1\". O " +#~ "analisador é bastante liberal e permite minúsculas, maiúsculas e também " +#~ "abreviações como \"<Ctl>\" e \"<Ctrl>\". Se você definir a " +#~ "opção com a string especial \"disabled\", não haverá combinação de teclas " +#~ "para essa ação." + +#~ msgid "" +#~ "The global keybinding for creating and displaying a new Note. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the " +#~ "option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "As teclas de atalho globais para criar e exibir uma nova nota. O formato " +#~ "se parece com \"<Control>a\" ou \"<Shift><Alt>F1\". O " +#~ "analisador é bastante liberal e permite minúsculas, maiúsculas e também " +#~ "abreviações como \"<Ctl>\" e \"<Ctrl>\". Se você definir a " +#~ "opção com a string especial \"disabled\", não haverá combinação de teclas " +#~ "para essa ação." + +#~ msgid "" +#~ "The global keybinding for opening the Note Search dialog. The format looks " +#~ "like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " +#~ "fairly liberal and allows lower or upper case, and also abbreviations such " +#~ "as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " +#~ "special string \"disabled\", then there will be no keybinding for this " +#~ "action." +#~ msgstr "" +#~ "As teclas de atalho globais para abrir a caixa de diálogo de pesquisa de " +#~ "notas. O formato se parece com \"<Control>a\" ou \"<Shift><" +#~ "Alt>F1\". O analisador é bastante liberal e permite minúsculas, " +#~ "maiúsculas e também abreviações como \"<Ctl>\" e \"<Ctrl>\". " +#~ "Se você definir a opção com a string especial \"disabled\", não haverá " +#~ "combinação de teclas para essa ação." + +#~ msgid "" +#~ "The global keybinding for opening the Recent Changes dialog. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the " +#~ "option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "As teclas de atalho globais para abrir o diálogo de alterações recentes. O " +#~ "formato se parece com \"<Control>a\" ou \"<Shift><Alt>" +#~ "F1\". O analisador é bastante liberal e permite minúsculas, maiúsculas e " +#~ "também abreviações como \"<Ctl>\" e \"<Ctrl>\". Se você " +#~ "definir a opção com a string especial \"disabled\", não haverá associação " +#~ "de teclas para esta ação." + +#~ msgid "Hotkeys" +#~ msgstr "Teclas de atalho" + +#~ msgid "Use status _icon" +#~ msgstr "Usar _ícone de status" + +#~ msgid "Show icon in tray, which is the central place of control." +#~ msgstr "Mostra o ícone na bandeja, que é o local central de controle." + +#~ msgid "Listen for _hotkeys" +#~ msgstr "Capturar t_eclas de atalho" + +#~ msgid "" +#~ "Hotkeys allow you to quickly access your notes from anywhere with a " +#~ "keypress. Example Hotkeys: <Control><Shift>F11, <" +#~ "Alt>N" +#~ msgstr "" +#~ "Teclas de atalho permitem que você acesse rapidamente suas notas de " +#~ "qualquer lugar pressionando uma tecla. Exemplos de teclas de atalho: " +#~ "<Control><Shift>F11, <Alt>N" + +#~ msgid "Show notes _menu" +#~ msgstr "Mostrar _menu de notas" + +#~ msgid "Open \"_Start Here\"" +#~ msgstr "Abrir \"_Comece aqui\"" + +#~ msgid "Create _new note" +#~ msgstr "Criar uma _nova nota" + +#~ msgid "Open Search _Window" +#~ msgstr "Abrir _janela de pesquisa" + +#~ msgid "Take notes" +#~ msgstr "Tome notas" + +#~ msgid " (new)" +#~ msgstr " (nova)" + +#~ msgid "_About Gnote" +#~ msgstr "_Sobre o Gnote" + #~ msgid "Open \"Search _All Notes\"" #~ msgstr "Abrir \"Pesquisar em _todas as notas\"" diff -Nru gnote-3.14.2/po/sk.po gnote-3.16.0/po/sk.po --- gnote-3.14.2/po/sk.po 1970-01-01 00:00:00.000000000 +0000 +++ gnote-3.16.0/po/sk.po 2015-03-26 20:50:43.000000000 +0000 @@ -0,0 +1,3365 @@ +# Slovak translation of gnote. +# Copyright (C) 2009 Free Software Foundation, Inc. +# This file is distributed under the same license as the gnote package. +# Pavol Klačanský , 2009. +# +msgid "" +msgstr "" +"Project-Id-Version: gnote\n" +"Report-Msgid-Bugs-To: http://bugzilla.gnome.org/enter_bug.cgi?" +"product=gnote&keywords=I18N+L10N&component=general\n" +"POT-Creation-Date: 2015-02-07 17:28+0000\n" +"PO-Revision-Date: 2009-05-01 10:56+0200\n" +"Last-Translator: Pavol Klačanský \n" +"Language-Team: Slovak \n" +"Language: sk\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Plural-Forms: nplurals=3; plural=(n==1) ? 1 : (n>=2 && n<=4) ? 2 : 0;\n" + +#: ../data/appdata/gnote.appdata.xml.in.h:1 +msgid "" +"Gnote is a simple note-taking application for GNOME desktop environment. It " +"allows you to capture your ideas, link them together using WikiWiki-style " +"links, group together in notebooks and some extra features for everyday use." +msgstr "" + +#: ../data/appdata/gnote.appdata.xml.in.h:2 +msgid "" +"Gnote also supports synchronization to make it possible to use on multiple " +"devices." +msgstr "" + +#: ../data/gnote.desktop.in.in.h:1 ../src/recentchanges.cpp:45 +#: ../src/recentchanges.cpp:479 +#, fuzzy +#| msgid "Quit Gnote" +msgid "Gnote" +msgstr "Koniec Gnote" + +#: ../data/gnote.desktop.in.in.h:2 +msgid "Take notes, link ideas, and stay organized" +msgstr "Tvorte poznámky, ukladajte nápady, a zostante zorganizovaný" + +#: ../data/gnote.desktop.in.in.h:3 +msgid "Note-taker" +msgstr "Príjemca poznámky" + +#: ../data/gnote.desktop.in.in.h:4 +msgid "notes;idea;link;organize;" +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:1 +msgid "Enable spellchecking" +msgstr "Povoliť kontrolu pravopisu" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:2 +msgid "" +"If true, misspellings will be underlined in red, and correct spelling " +"suggestions shown in the right-click menu." +msgstr "" +"Ak je pravda, pravopisné chyby budú podčiarknuté červeným, a pravopisne " +"správne návrhy budú zobrazené v ponuke pravým-klikom." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:3 +msgid "Automatically create links when typing" +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:4 +msgid "" +"Enable this option to automatically create a link, when text matches note " +"title." +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:5 +#, fuzzy +#| msgid "Update links in referencing notes" +msgid "Create links for URLs in notes" +msgstr "Aktualizovať odkazy v odkazujúcich poznámkach" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:6 +msgid "Enable this option to create links for URLs in notes." +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:7 +msgid "Enable WikiWord highlighting" +msgstr "Povoliť zvýrazňovanie WikiSlov" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:8 +msgid "" +"Enable this option to highlight words ThatLookLikeThis. Clicking the word " +"will create a note with that name." +msgstr "" +"Povolením tejto možnosti zvýrazníte slová KtoréVyzerajúTakto. Kliknutím na " +"to slovo vytvoríte poznámku s takým názvom." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:9 +msgid "Enable Auto bulleted lists" +msgstr "Povoliť automaticky odrážkované zoznamy" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:10 +msgid "" +"Enable this option if you want bulleted lists to be automatic when you place " +"- or * at the beginning of a line." +msgstr "" +"Povolte túto možnosť, ak chcete aby zoznamy s odrážkami boli automaticky " +"vytvorené, keď dáte na začiatok riadku - alebo *." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:11 +msgid "Enable Middle-Click Paste On Icon" +msgstr "Povoliť vloženie výberu kliknutím prostredného tlačidla na ikonu" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:12 +msgid "" +"Enable this option if you want to be able to middle-click the Gnote icon to " +"paste timestamped content into the Start Here note." +msgstr "" +"Povoľte túto možnosť, ak chcete povoliť vkladanie aktuálneho výberu do " +"poznámky Začnite tu kliknutím prostredného tlačidla na ikonu programu Gnote." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:13 +msgid "Enable custom font" +msgstr "Povoliť vlastné písmo" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:14 +#, fuzzy +#| msgid "" +#| "If true, the font name set in custom_font_face will be used as the font " +#| "when displaying notes. Otherwise the desktop default font will be used." +msgid "" +"If true, the font name set in custom-font-face will be used as the font when " +"displaying notes. Otherwise the desktop default font will be used." +msgstr "" +"Ak je pravda, tak názov písma nastaveného v custom_font_face bude použitý, " +"ako písmo, pri zobrazovaní poznámok. Inak bude použité písmo pracovnej " +"plochy." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:15 +msgid "Custom Font Face" +msgstr "Vlastný štýl písma" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:16 +#, fuzzy +#| msgid "" +#| "If enable_custom_font is true, the font name set here will be used as the " +#| "font when displaying notes." +msgid "" +"If enable-custom-font is true, the font name set here will be used as the " +"font when displaying notes." +msgstr "" +"Ak enable_custom_font je pravda, tak názov písma bude nastavený k použitiu " +"ako písmo, keď budú zobrazované poznámky." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:17 +msgid "Enable global keybindings" +msgstr "Povoliť globálne klávesové skratky" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:18 +#, fuzzy +#| msgid "" +#| "If true, the desktop-global keybindings set in /apps/gnote/" +#| "global_keybindings will be enabled, allowing for useful Gnote actions to " +#| "be available from any application." +msgid "" +"If true, the desktop-global keybindings set in /org/gnome/gnote/global-" +"keybindings will be enabled, allowing for useful Gnote actions to be " +"available from any application." +msgstr "" +"Ak je pravda, tak budú povolené globálne klávesové skratky pracovnej plochy " +"nastavené v /apps/gnote/global_keybindings, povoľujú užitočné akcie v Gnote, " +"aby boli dostupné s akejkoľvek aplikácie." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:19 +msgid "Start Here Note" +msgstr "Poznámka Začnite tu" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:20 +msgid "" +"The note URI of the note that should be considered the \"Start Here\" note, " +"which is always placed at the bottom of the Gnote note menu and also " +"accessible by hotkey." +msgstr "" +"URI poznámky \"Začnite tu\", ktorá je vždy umiestnená dole v ponuke poznámok " +"Gnote a tiež prístupná klávesovou skratkou." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:21 +msgid "Minimum number of notes to show in menu" +msgstr "Minimálny počet poznámok k zobrazeniu v ponuke" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:22 +msgid "" +"Integer determining the minimum number of notes to show in the Gnote note " +"menu." +msgstr "" +"Celé číslo určuje minimálny počet poznámok k zobrazeniu v ponuke poznámok " +"Gnote." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:23 +msgid "List of pinned notes" +msgstr "Zoznam pripnutých poznámok" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:24 +msgid "" +"Whitespace-separated list of note URIs for notes that should always appear " +"in the Gnote note menu." +msgstr "" +"Oddeliť zoznam URI poznámok od poznámok, malo by sa to vždy zjaviť v ponuke " +"poznámok Gnote." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:25 +msgid "Is main window maximized" +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:26 +msgid "If true, Gnote window will be maximized." +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:27 +msgid "Saved height of Search window" +msgstr "Uložená výška okna hľadania" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:28 +msgid "Determines pixel height of Search window; stored on Gnote exit." +msgstr "" +"Určuje výšku v pixeloch okna hľadania; ukladá sa pri ukončení programu Gnote." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:29 +msgid "Saved width of Search window" +msgstr "Uložená šírka okna hľadania" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:30 +msgid "Determines pixel width of Search window; stored on Gnote exit." +msgstr "" +"Určuje šírku v pixeloch okna hľadania; ukladá sa pri ukončení programu Gnote." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:31 +#, fuzzy +#| msgid "Saved vertical position of Search window" +msgid "Saved splitter position of Search window splitter." +msgstr "Uložená zvislá pozícia okna hľadania" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:32 +#, fuzzy +#| msgid "Determines pixel width of Search window; stored on Gnote exit." +msgid "" +"Determines Search window splitter position in pixels; stored on Gnote exit." +msgstr "" +"Určuje šírku v pixeloch okna hľadania; ukladá sa pri ukončení programu Gnote." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:33 +#, fuzzy +#| msgid "Saved height of Search window" +msgid "Saved sorting of the Search window." +msgstr "Uložená výška okna hľadania" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:34 +#, fuzzy +#| msgid "Determines pixel width of Search window; stored on Gnote exit." +msgid "Determines Search window initial sorting." +msgstr "" +"Určuje šírku v pixeloch okna hľadania; ukladá sa pri ukončení programu Gnote." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:35 +msgid "FUSE Mounting Timeout (ms)" +msgstr "Časový limit pripájania FUSE (ms)" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:36 +msgid "" +"Time (in milliseconds) Gnote should wait for a response when using FUSE to " +"mount a sync share." +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:37 +msgid "SSHFS Remote Synchronization Folder" +msgstr "Priečinok pre vzdialenú synchronizáciu SSHFS" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:38 +msgid "Path on SSH server to Gnote synchronization directory (optional)." +msgstr "" +"Umiestnenie synchronizačného priečinku Gnote na SSH serveri. (voliteľné)" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:39 +msgid "SSHFS Synchronization Server URL" +msgstr "URL servera pre vzdialenú synchronizáciu SSHFS" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:40 +msgid "URL of SSH server containing Gnote synchronization directory." +msgstr "URL SSH servera, ktorý obsahuje synchronizačný priečinok Gnote." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:41 +msgid "SSHFS Remote Synchronization User Name" +msgstr "Použivateľské meno pre vzdialenú synchronizáciu SSHFS" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:42 +msgid "User name to use when connecting to the synchronization server via SSH." +msgstr "" +"Používateľské meno, ktoré použiť počas pripájania k synchronizačnému serveru " +"cez SSH." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:43 +msgid "SSHFS Synchronization Server Port" +msgstr "Port servera pre vzdialenú synchronizáciu SSHFS" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:44 +msgid "The port to use when connecting to the synchronization server via SSH." +msgstr "" +"Port, ktorý bude použitý počas pripájania k synchronizačnému serveru cez SSH." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:45 +msgid "Link Updating Behavior on Note Rename" +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:46 +msgid "" +"Integer value indicating if there is a preference to always perform a " +"specific link updating behavior when a note is renamed, instead of prompting " +"the user. The values map to an internal enumeration. 0 indicates that the " +"user wishes to be prompted when renaming a note may impact links that exist " +"in other notes. 1 indicates that links should automatically be removed. 2 " +"indicates that link text should be updated to the new note name so that it " +"will continue linking to the renamed note." +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:47 +msgid "Enable closing notes with escape" +msgstr "Povoliť zatváranie poznámok s escape" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:48 +msgid "If enabled, an opened note can be closed by hitting the escape key." +msgstr "" +"Ak je povolené, tak môže byť otvorená poznámka zatvorená stlačením klávesu " +"escape." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:49 +msgid "Use status icon, when started as an application" +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:50 +msgid "Deprecated, has no effect." +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:51 +#, fuzzy +#| msgid "Open the Search All Notes window" +msgid "Open notes in new window" +msgstr "Otvoriť okno Hľadať vo všetkých poznámkach" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:52 +msgid "" +"Open notes in new window instead of replacing active content of the same " +"window" +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:53 +msgid "Save note window size and autosize note window to it" +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:54 +msgid "" +"Saves note window size and automatically resizes main window to this size, " +"when note is opened." +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:55 +msgid "Show applet menu" +msgstr "Ukázať aplet ponuky" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:56 +msgid "Open Start Here" +msgstr "Otvoriť Začnite tu" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:57 +msgid "Create a new Note" +msgstr "Vytvoriť novú poznámku" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:58 +msgid "Open Search Dialog" +msgstr "Otvoriť dialóg hľadania" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:59 +msgid "Open Recent Changes" +msgstr "Otvoriť nedávne zmeny" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:60 +msgid "HTML Export Last Directory" +msgstr "Exportovať do HTML posledný priečinok" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:61 +msgid "" +"The last directory a note was exported to using the Export To HTML plugin." +msgstr "" +"Posledný priečinok poznámky bol exportovaný pomocou doplnku Exportovať do " +"HTML." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:62 +msgid "HTML Export Linked Notes" +msgstr "Exportovať odkazujúce poznámky do HTML" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:63 +msgid "" +"The last setting for the 'Export linked notes' checkbox in the Export to " +"HTML plugin." +msgstr "" +"Zaškratávacie tlačidlo pre 'Exportovať odkazujúce poznámky' posledné " +"nastavenie v doplnku Exportovať do HTML." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:64 +msgid "HTML Export All Linked Notes" +msgstr "Exportovať všetky odkazujúce poznámky do HTML" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:65 +msgid "" +"The last setting for the 'Include all other linked notes' checkbox in the " +"Export to HTML plugin. This setting is used in conjunction with the 'HTML " +"Export Linked Notes' setting and is used to specify whether all notes (found " +"recursively) should be included during an export to HTML." +msgstr "" +"Zaškratávacie tlačidlo pre 'Vložiť všetky ostatné odkazujúce poznámky' " +"posledné nastavenie v doplnku Exportovať do HTML. Toto nastavenie je použité " +"v spolupráci s nastaveím 'Exportovať odkazujúce poznámky do HTML' a je " +"použité k presnému určeniu, či by mali byť všetky poznámky (nájdené " +"rekurzívne) vložené počas exportu do HTML." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:66 +msgid "Synchronization Client ID" +msgstr "Synchronizovať ID klienta" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:67 +#, fuzzy +#| msgid "" +#| "Unique identifier for this Gnote client, used when communicating with a " +#| "sychronization server." +msgid "" +"Unique identifier for this Gnote client, used when communicating with a " +"synchronization server." +msgstr "" +"Pre tohto Gnote klienta sa používa unikátny identifikátor, keď komunikuje so " +"synchronizačným serverom." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:68 +msgid "Synchronization Local Server Path" +msgstr "Miestna cesta servera synchronizácie" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:69 +msgid "" +"Path to the synchronization server when using the filesystem synchronization " +"service addin." +msgstr "" +"Cesta k synchronizačnému serveru, keď je používaný doplnok služby " +"synchronizácie súborového systému." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:70 +msgid "Selected Synchronization Service Addin" +msgstr "Označený doplnok synchronizačnej služby" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:71 +msgid "" +"Unique identifier for the currently configured note synchronization service " +"addin." +msgstr "" +"Pre súčasné nastavenie poznámky platí unikátny identifikator s doplnku " +"synchronizačnej služby." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:72 +msgid "Note Synchronization Conflict Saved Behavior" +msgstr "Konflikt synchronizovanej poznámky uložený" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:73 +msgid "" +"Integer value indicating if there is a preference to always perform a " +"specific behavior when a conflict is detected, instead of prompting the " +"user. The values map to an internal enumeration. 0 indicates that the user " +"wishes to be prompted when a conflict occurs, so that they may handle each " +"conflict situation on a case-by-case basis." +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:74 +msgid "Automatic Background Synchronization Timeout" +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:75 +msgid "" +"Integer value indicating how frequently to perform a background sync of your " +"notes (when sync is configured). Any value less than 1 indicates that " +"autosync is disabled. The lowest acceptable positive value is 5. Value is in " +"minutes." +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:76 +msgid "Accept SSL Certificates" +msgstr "Prijať SSL certifikáty" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:77 +msgid "" +"Use wdfs option \"-ac\" to accept SSL certificates without prompting the " +"user." +msgstr "" +"Použiť wdfs voľbu \"-ac\" pre prijímanie SSL certifikátov bez pýtania sa " +"používateľa." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:78 +msgid "Share URL" +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:79 +msgid "WebDAV share URL where notes are synchronized to." +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:80 +msgid "Share username" +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:81 +msgid "Username to access WebDAV share." +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:82 +msgid "Timestamp format" +msgstr "Formát časovej značky" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:83 +#, fuzzy +#| msgid "" +#| "The date format that is used for the timestamp. It followe the format of " +#| "strftime(3)." +msgid "" +"The date format that is used for the timestamp. It follows the format of " +"strftime(3)." +msgstr "" +"Formát dátumu používaný pre časovú značku. Je nasledovného formátu " +"strftime(3)." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:84 +msgid "Time between checks" +msgstr "" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:85 +msgid "" +"Time interval between note directory checks (in seconds). Min value is 5." +msgstr "" + +#: ../src/actionmanager.cpp:84 ../src/actionmanager.cpp:171 +msgid "_Quit" +msgstr "_Koniec" + +#: ../src/actionmanager.cpp:84 +msgid "Quit Gnote" +msgstr "Koniec Gnote" + +#: ../src/actionmanager.cpp:89 ../src/actionmanager.cpp:168 +msgid "_Preferences" +msgstr "_Predvoľby" + +#: ../src/actionmanager.cpp:89 ../src/preferencesdialog.cpp:103 +msgid "Gnote Preferences" +msgstr "_Predvoľby" + +#: ../src/actionmanager.cpp:93 +msgid "_Contents" +msgstr "Ob_sah" + +#: ../src/actionmanager.cpp:93 +msgid "Gnote Help" +msgstr "Pomocník Gnote" + +#: ../src/actionmanager.cpp:98 ../src/actionmanager.cpp:170 +msgid "_About" +msgstr "_O programe" + +#: ../src/actionmanager.cpp:98 +msgid "About Gnote" +msgstr "O programe" + +#: ../src/actionmanager.cpp:102 +msgid "TrayIcon" +msgstr "Ikona v oblasti oznámení" + +#: ../src/actionmanager.cpp:107 +msgid "Create _New Note" +msgstr "Vytvoriť _novú poznámku" + +#: ../src/actionmanager.cpp:107 +msgid "Create a new note" +msgstr "Vytvoriť novú poznámku" + +#: ../src/actionmanager.cpp:112 +msgid "_Search All Notes" +msgstr "_Hľadať vo všetkých poznámkach" + +#: ../src/actionmanager.cpp:112 +msgid "Open the Search All Notes window" +msgstr "Otvoriť okno Hľadať vo všetkých poznámkach" + +#: ../src/actionmanager.cpp:166 +msgid "_New Note" +msgstr "_Nová poznámka" + +#: ../src/actionmanager.cpp:167 +#, fuzzy +#| msgid "_Window" +msgid "New _Window" +msgstr "_Okno" + +#: ../src/actionmanager.cpp:169 +msgid "_Help" +msgstr "_Pomocník" + +#: ../src/addininfo.cpp:74 +msgid "Failed to load plugin information!" +msgstr "" + +#: ../src/addininfo.cpp:124 +#, c-format +msgid "Incompatible plug-in %s: expected %s, got %s" +msgstr "" + +#: ../src/addinmanager.cpp:133 +#, c-format +msgid "Note plugin info %s already present" +msgstr "" + +#: ../src/addinmanager.cpp:141 +#, c-format +msgid "%s does not implement %s" +msgstr "" + +#: ../src/addinmanager.cpp:156 +#, c-format +msgid "Note plugin %s already present" +msgstr "" + +#: ../src/addinmanager.cpp:174 +#, c-format +msgid "Note plugin info %s is absent" +msgstr "" + +#: ../src/addinmanager.cpp:187 +#, c-format +msgid "Note plugin %s is absent" +msgstr "" + +#: ../src/addinmanager.cpp:224 +#, c-format +msgid "Failed to find module %s for addin %s" +msgstr "" + +#: ../src/addinmanager.cpp:228 +#, c-format +msgid "Failed to load addin info for %s: %s" +msgstr "" + +#: ../src/addinmanager.cpp:352 +msgid "Trying to load addins when they are already loaded" +msgstr "" + +#: ../src/addins/backlinks/backlinkmenuitem.cpp:41 +msgid "What links here?" +msgstr "Čo sem odkazuje?" + +#: ../src/addins/backlinks/backlinkmenuitem.cpp:42 +#, fuzzy +#| msgid "What links here?" +msgid "Which notes have links to here?" +msgstr "Čo sem odkazuje?" + +#: ../src/addins/backlinks/backlinks.desktop.in.in.h:1 +msgid "Backlinks" +msgstr "" + +#: ../src/addins/backlinks/backlinks.desktop.in.in.h:2 +msgid "See which notes link to the one you're currently viewing." +msgstr "" + +#: ../src/addins/backlinks/backlinks.desktop.in.in.h:3 +#: ../src/addins/inserttimestamp/inserttimestamp.desktop.in.in.h:3 +msgid "Hubert Figuiere and Tomboy Project" +msgstr "Hubert Figuiere a Projekt Tomboy" + +#: ../src/addins/backlinks/backlinksnoteaddin.cpp:86 +msgid "(none)" +msgstr "(nič)" + +#: ../src/addins/bugzilla/bugzilla.desktop.in.in.h:1 +msgid "Bugzilla Links" +msgstr "Odkazy na bugzillu" + +#: ../src/addins/bugzilla/bugzilla.desktop.in.in.h:2 +msgid "" +"Allows you to drag a Bugzilla URL from your browser directly into a Gnote " +"note. The bug number is inserted as a link with a little bug icon next to " +"it." +msgstr "" +"Umožní vám aby ste mohli pretiahnuť URL Bugzilly z prehliadača priamo do " +"poznámky Gnote. Číslo chyby bude vložené ako odkaz s malou ikonou chyby " +"vedľa." + +#: ../src/addins/bugzilla/bugzilla.desktop.in.in.h:3 +#: ../src/addins/exporttohtml/exporttohtml.desktop.in.in.h:3 +#: ../src/addins/fixedwidth/fixedwidth.desktop.in.in.h:3 +#: ../src/addins/printnotes/printnotes.desktop.in.in.h:3 +#: ../src/addins/stickynoteimport/stickynoteimport.desktop.in.in.h:3 +msgid "Hubert Figuiere and the Tomboy Project" +msgstr "Hubert Figuiere a Projekt Tomboy" + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:64 +msgid "" +"You can use any bugzilla just by dragging links into notes. If you want a " +"special icon for certain hosts, add them here." +msgstr "" +"Môžete používať nejaký program bugzilla práve pri presúvaní odkazov do " +"poznámok. Ak chcete špeciálnu ikonu od spoľahlivých hostiteľov, pridajte " +"ich sem." + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:81 +msgid "Host Name" +msgstr "Názov hostiteľa" + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:94 +msgid "Icon" +msgstr "Ikona" + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:229 +msgid "Select an icon..." +msgstr "Zvoliť ikonu..." + +#. Extra Widget +#: ../src/addins/bugzilla/bugzillapreferences.cpp:244 +msgid "_Host name:" +msgstr "Názov _hostiteľa:" + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:278 +#, fuzzy +#| msgid "_Host name:" +msgid "Host name invalid" +msgstr "Názov _hostiteľa:" + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:279 +#, fuzzy +#| msgid "You must specify the Bugzilla host name to use with this icon." +msgid "You must specify a valid Bugzilla host name to use with this icon." +msgstr "" +"Musíte uviesť názov hostiteľa programu Bugzilla pre použitie s touto ikonou." + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:298 +msgid "Error saving icon" +msgstr "Chyba pri ukladaní ikony" + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:299 +msgid "Could not save the icon file." +msgstr "Nemohol byť uložený súbor ikony." + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:371 +msgid "Really remove this icon?" +msgstr "Naozaj odstrániť túto ikonu?" + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:372 +msgid "If you remove an icon it is permanently lost." +msgstr "Ak zmažete ikonu, tak bude navždy stratená." + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:394 +#, fuzzy, c-format +#| msgid "Error saving icon" +msgid "Error removing icon %s: %s" +msgstr "Chyba pri ukladaní ikony" + +#: ../src/addins/exporttogtg/exporttogtg.desktop.in.in.h:1 +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:71 +msgid "Export to Getting Things GNOME" +msgstr "" + +#: ../src/addins/exporttogtg/exporttogtg.desktop.in.in.h:2 +msgid "Exports individual notes as Getting Things GNOME tasks" +msgstr "" + +#: ../src/addins/exporttogtg/exporttogtg.desktop.in.in.h:3 +#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:3 +#: ../src/addins/statistics/statistics.desktop.in.in.h:3 +msgid "Aurimas Černius" +msgstr "" + +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:72 +msgid "Export note as Getting Things GNOME task" +msgstr "" + +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:86 +msgid "GTG XML loaded, but interface not found" +msgstr "" + +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:92 +#, c-format +msgid "Failed to create GTG interface from XML: %s" +msgstr "" + +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:100 +msgid "Failed to create D-Bus proxy for GTG" +msgstr "" + +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:116 +#, c-format +msgid "Failed to call GTG: %s" +msgstr "" + +#: ../src/addins/exporttohtml/exporttohtml.desktop.in.in.h:1 +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:76 +msgid "Export to HTML" +msgstr "Exportovať do HTML" + +#: ../src/addins/exporttohtml/exporttohtml.desktop.in.in.h:2 +#, fuzzy +#| msgid "Export linked notes" +msgid "Exports individual notes to HTML." +msgstr "Exportovať poznámky odkazujúce na ňu" + +#: ../src/addins/exporttohtml/exporttohtmldialog.cpp:41 +msgid "Destination for HTML Export" +msgstr "Cieľ pre HTML export" + +#: ../src/addins/exporttohtml/exporttohtmldialog.cpp:43 +msgid "Export linked notes" +msgstr "Exportovať poznámky odkazujúce na ňu" + +#: ../src/addins/exporttohtml/exporttohtmldialog.cpp:44 +msgid "Include all other linked notes" +msgstr "" +"Vložiť všetky ostatné poznámky odkazujúce na ňu (môžu odkazovať aj nepriamo)" + +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:77 +#, fuzzy +#| msgid "Export to HTML" +msgid "Export note to HTML" +msgstr "Exportovať do HTML" + +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:117 +#, c-format +msgid "Could not open exported note in a web browser: %s" +msgstr "" + +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:121 +#, fuzzy +#| msgid "Your note was exported to \"{0}\"." +msgid "Your note was exported to \"%1%\"." +msgstr "Vaša poznámka bola exportovaná do \"{0}\"." + +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:130 +msgid "Note exported successfully" +msgstr "Poznámky boli úspešne exportované" + +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:144 +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:152 +#, c-format +msgid "Could not export: %s" +msgstr "" + +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:155 +#, fuzzy, c-format +#| msgid "Could not save the file \"{0}\"" +msgid "Could not save the file \"%s\"" +msgstr "Nemohol byť uložený súbor \"{0}\"" + +#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:102 +msgid "_Folder Path:" +msgstr "Ces_ta k priečinku:" + +#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:109 +msgid "Select Synchronization Folder..." +msgstr "Vybrať synchronizačný priečinok..." + +#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:134 +msgid "Folder path field is empty." +msgstr "Cesta v poli priečinku je prázdna." + +#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:141 +#, fuzzy +#| msgid "" +#| "Specified folder path does not exist, and Tomboy was unable to create it." +msgid "" +"Specified folder path does not exist, and Gnote was unable to create it." +msgstr "Určená cesta k priečinku neexistuje , Tomboy ju nemohol vytvoriť." + +#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:217 +msgid "Local Folder" +msgstr "Miestny priečinok" + +#: ../src/addins/filesystemsyncservice/filesystemsyncservice.desktop.in.in.h:1 +msgid "Local Directory Sync Service Plugin" +msgstr "" + +#: ../src/addins/filesystemsyncservice/filesystemsyncservice.desktop.in.in.h:2 +msgid "Synchronize Gnote Notes to a local file system path" +msgstr "" + +#: ../src/addins/filesystemsyncservice/filesystemsyncservice.desktop.in.in.h:3 +#: ../src/addins/webdavsyncservice/webdavsyncservice.desktop.in.in.h:3 +#, fuzzy +#| msgid "Hubert Figuiere and the Tomboy Project" +msgid "Aurimas Černius and the Tomboy Project" +msgstr "Hubert Figuiere a Projekt Tomboy" + +#: ../src/addins/fixedwidth/fixedwidth.desktop.in.in.h:1 +msgid "Fixed Width" +msgstr "Pevná šírka" + +#: ../src/addins/fixedwidth/fixedwidth.desktop.in.in.h:2 +msgid "Adds fixed-width font style." +msgstr "Pridá štýl písma s pevnou šírkou." + +#: ../src/addins/fixedwidth/fixedwidthmenuitem.cpp:35 +#, fuzzy +#| msgid "Fixed Width" +msgid "Fixed Wid_th" +msgstr "Pevná šírka" + +#: ../src/addins/inserttimestamp/inserttimestamp.desktop.in.in.h:1 +#: ../src/addins/inserttimestamp/inserttimestampnoteaddin.cpp:45 +msgid "Insert Timestamp" +msgstr "Vložiť čas" + +#: ../src/addins/inserttimestamp/inserttimestamp.desktop.in.in.h:2 +msgid "Inserts current date and time at the cursor position." +msgstr "Vloží aktuálny dátum a čas na pozícii kurzora." + +#: ../src/addins/inserttimestamp/inserttimestampnoteaddin.cpp:46 +#, fuzzy +#| msgid "Insert Timestamp" +msgid "Insert Timestamp into note" +msgstr "Vložiť čas" + +#. Label +#: ../src/addins/inserttimestamp/inserttimestamppreferences.cpp:70 +msgid "Choose one of the predefined formats or use your own." +msgstr "Zvoliť jeden s preddefinovaných formátov alebo použiť váš vlastný." + +#: ../src/addins/inserttimestamp/inserttimestamppreferences.cpp:78 +msgid "Use _Selected Format" +msgstr "Použiť zvo_lený formát" + +#: ../src/addins/inserttimestamp/inserttimestamppreferences.cpp:110 +msgid "_Use Custom Format" +msgstr "Použiť vlastný f_ormát" + +#. TRANSLATORS: first %s is file name, second is error +#: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:236 +#, c-format +msgid "NoteDirectoryWatcher: Update aborted, error reading %s: %s" +msgstr "" + +#. TRANSLATORS: %s is file +#: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:263 +#, c-format +msgid "NoteDirectoryWatcher: Error reading note title from %s" +msgstr "" + +#. TRANSLATORS: %s is file +#: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:271 +#, c-format +msgid "NoteDirectoryWatcher: Unknown error creating note from %s" +msgstr "" + +#. TRANSLATORS: first %s is file, second is error +#: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:277 +#, c-format +msgid "NoteDirectoryWatcher: Error creating note from %s: %s" +msgstr "" + +#. TRANSLATORS: first %s is file, second is error +#: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:290 +#, c-format +msgid "NoteDirectoryWatcher: Update aborted, error parsing %s: %s" +msgstr "" + +#: ../src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in.in.h:1 +msgid "Note Directory Watcher" +msgstr "" + +#: ../src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in.in.h:2 +msgid "Watch your Gnote note directory for changes to your notes." +msgstr "" + +#: ../src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in.in.h:3 +#, fuzzy +#| msgid "and Tomboy original authors." +msgid "Aurimas Černius and Tomboy original authors" +msgstr "a pôvodný autori programu Tomboy." + +#: ../src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp:35 +msgid "_Directory check interval:" +msgstr "" + +#: ../src/addins/noteoftheday/noteoftheday.cpp:33 +msgid "Today: Template" +msgstr "Dnes: Šablóna" + +#: ../src/addins/noteoftheday/noteoftheday.cpp:35 +#, fuzzy +#| msgid "Today" +msgid "Today: " +msgstr "Dnes" + +#. TRANSLATORS: first %s is note title, second is error +#. TRANSLATORS: first %s is template note title, second is error +#: ../src/addins/noteoftheday/noteoftheday.cpp:49 +#: ../src/addins/noteoftheday/noteofthedaypreferences.cpp:72 +#, c-format +msgid "NoteOfTheDay could not create %s: %s" +msgstr "" + +#: ../src/addins/noteoftheday/noteoftheday.cpp:155 +msgid "Tasks" +msgstr "Úlohy" + +#: ../src/addins/noteoftheday/noteoftheday.cpp:156 +msgid "Appointments" +msgstr "Schôdzky" + +#. Format: "Today: Friday, July 01 2005" +#: ../src/addins/noteoftheday/noteoftheday.cpp:162 +msgid "%A, %B %d %Y" +msgstr "" + +#: ../src/addins/noteoftheday/noteoftheday.desktop.in.in.h:1 +msgid "Note of the Day" +msgstr "" + +#: ../src/addins/noteoftheday/noteoftheday.desktop.in.in.h:2 +msgid "" +"Automatically creates a \"Today\" note for easily jotting down daily thoughts" +msgstr "" + +#: ../src/addins/noteoftheday/noteoftheday.desktop.in.in.h:3 +#, fuzzy +#| msgid "Hubert Figuiere and the Tomboy Project" +msgid "Debarshi Ray and the Tomboy Project" +msgstr "Hubert Figuiere a Projekt Tomboy" + +#: ../src/addins/noteoftheday/noteofthedaypreferences.cpp:34 +msgid "_Open Today: Template" +msgstr "_Otvoriť dnešné: Šablóna" + +#: ../src/addins/noteoftheday/noteofthedaypreferences.cpp:35 +msgid "" +"Change the Today: Template note to customize " +"the text that new Today notes have." +msgstr "" +"Zmeňte poznámku Dnes: Šablóna k prispôsobeniu " +"textu, ktorý budú obsahovať nové Dnešné poznámky." + +#: ../src/addins/printnotes/printnotes.desktop.in.in.h:1 +msgid "Printing Support" +msgstr "Podpora tlačenia" + +#: ../src/addins/printnotes/printnotes.desktop.in.in.h:2 +msgid "Allows you to print a note." +msgstr "Umožní vám tlačiť poznámku" + +#: ../src/addins/printnotes/printnotesnoteaddin.cpp:61 +msgid "Print" +msgstr "Tlačiť..." + +#: ../src/addins/printnotes/printnotesnoteaddin.cpp:61 +#, fuzzy +#| msgid "Print Footer" +msgid "Print note" +msgstr "Tlačiť zápätie" + +#: ../src/addins/printnotes/printnotesnoteaddin.cpp:136 +msgid "Error printing note" +msgstr "Chyba pri tlači poznámky" + +#. %1% is the page number, %2% is the total number of pages +#: ../src/addins/printnotes/printnotesnoteaddin.cpp:303 +msgid "Page %1% of %2%" +msgstr "Strana %1% z %2%" + +#: ../src/addins/readonly/readonly.desktop.in.in.h:1 +#: ../src/addins/readonly/readonlynoteaddin.cpp:53 +msgid "Read Only" +msgstr "" + +#: ../src/addins/readonly/readonly.desktop.in.in.h:2 +msgid "Mark certain notes as read only" +msgstr "" + +#: ../src/addins/readonly/readonly.desktop.in.in.h:3 +msgid "Aurimas Černius, Debarshi Ray and Arief Bayu Purwanto" +msgstr "" + +#: ../src/addins/readonly/readonlynoteaddin.cpp:54 +msgid "Make this note read-only" +msgstr "" + +#: ../src/addins/replacetitle/replacetitle.desktop.in.in.h:1 +#: ../src/addins/replacetitle/replacetitlenoteaddin.cpp:51 +msgid "Replace title" +msgstr "" + +#: ../src/addins/replacetitle/replacetitle.desktop.in.in.h:2 +#, fuzzy +#| msgid "Delete the selected note" +msgid "Replace title with selection." +msgstr "Odstrániť označenú poznámku" + +#: ../src/addins/replacetitle/replacetitle.desktop.in.in.h:3 +msgid "Pierre-Yves Luyten" +msgstr "" + +#: ../src/addins/specialnotes/specialnotesapplicationaddin.cpp:38 +#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:1 +#, fuzzy +#| msgid "Search All Notes" +msgid "Special Notes" +msgstr "Hľadať vo všetkých poznámkach" + +#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:2 +msgid "Show special notes, that are otherwise hidden" +msgstr "" + +#: ../src/addins/statistics/statisticsapplicationaddin.cpp:50 +msgid "Show Statistics" +msgstr "" + +#: ../src/addins/statistics/statistics.desktop.in.in.h:1 +#: ../src/addins/statistics/statisticswidget.cpp:171 +#, fuzzy +#| msgid "Status" +msgid "Statistics" +msgstr "Stav" + +#: ../src/addins/statistics/statistics.desktop.in.in.h:2 +msgid "Show various statistics about notes." +msgstr "" + +#: ../src/addins/statistics/statisticswidget.cpp:91 +#, fuzzy +#| msgid "Gnote Notes" +msgid "Total Notes:" +msgstr "Poznámky Gnote" + +#: ../src/addins/statistics/statisticswidget.cpp:97 +#, fuzzy +#| msgid "Notebooks" +msgid "Total Notebooks:" +msgstr "Zapisníky" + +#: ../src/addins/statistics/statisticswidget.cpp:127 +#, fuzzy +#| msgid "Total: %1% note" +#| msgid_plural "Total: %1% notes" +msgid "%1% note" +msgid_plural "%1% notes" +msgstr[0] "Spolu: %1% poznámok" +msgstr[1] "Spolu: %1% poznámka" +msgstr[2] "Spolu: %1% poznámky" + +#: ../src/addins/stickynoteimport/stickynoteimport.desktop.in.in.h:1 +#, fuzzy +#| msgid "Sticky Note Importer First Run" +msgid "Sticky Notes Importer" +msgstr "Importér Sticky Note prvé spustenie" + +#: ../src/addins/stickynoteimport/stickynoteimport.desktop.in.in.h:2 +#, fuzzy +#| msgid "Import from Sticky Notes" +msgid "Import your notes from the Sticky Notes applet." +msgstr "Importovať z programu Sticky Notes" + +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:87 +msgid "Import from Sticky Notes" +msgstr "Importovať z programu Sticky Notes" + +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:214 +msgid "No Sticky Notes found" +msgstr "Neboli nájdené žiadne Sticky Notes" + +#. %1% is a the file name +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:216 +#, fuzzy +#| msgid "No suitable Sticky Notes file was found at \"{0}\"." +msgid "No suitable Sticky Notes file was found at \"%1%\"." +msgstr "Nebol nájdený žiadny vhodný súbor pre Sticky Notes v \"{0}\"." + +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:224 +msgid "Sticky Notes import completed" +msgstr "Sticky Notes boli importované" + +#. here %1% is the number of notes imported, %2% the total number of notes. +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:226 +#, fuzzy +#| msgid "{0} of {1} Sticky Notes were successfully imported." +msgid "%1% of %2% Sticky Notes were successfully imported." +msgstr "{0} z {1} Sticky Notes boli úspešne importované." + +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:245 +msgid "Untitled" +msgstr "Nepomenovaný" + +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:283 +msgid "Sticky Note: " +msgstr "Sticky Notes:" + +#. namespace +#: ../src/addins/tableofcontents/tableofcontentsaction.cpp:37 +#: ../src/addins/tableofcontents/tableofcontentsaction.cpp:38 +#: ../src/addins/tableofcontents/tableofcontents.desktop.in.in.h:1 +#: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:66 +#, fuzzy +#| msgid "_Contents" +msgid "Table of Contents" +msgstr "Ob_sah" + +#: ../src/addins/tableofcontents/tableofcontents.desktop.in.in.h:2 +msgid "" +"Navigate long structured notes. Set section and subsection headings in your " +"note, and the Table of Contents will show in a menu." +msgstr "" + +#: ../src/addins/tableofcontents/tableofcontents.desktop.in.in.h:3 +msgid "Luc Pionchon" +msgstr "" + +#: ../src/addins/tableofcontents/tableofcontents.desktop.in.in.h:4 +msgid "© 2013 Luc Pionchon" +msgstr "" + +#. no toc items, and no action entries = empty menu +#: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:140 +msgid "(empty table of contents)" +msgstr "" + +#: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:155 +msgid "Heading 1" +msgstr "" + +#: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:161 +msgid "Heading 2" +msgstr "" + +#: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:167 +msgid "Table of Contents Help" +msgstr "" + +#. namespace +#: ../src/addins/todo/todo.desktop.in.in.h:1 +msgid "TODO" +msgstr "" + +#: ../src/addins/todo/todo.desktop.in.in.h:2 +msgid "Highlight FIXME, TODO and XXX patterns in notes." +msgstr "" + +#: ../src/addins/todo/todo.desktop.in.in.h:3 +msgid "Aurimas Černius, Romain Tartière" +msgstr "" + +#: ../src/addins/tomboyimport/tomboyimport.desktop.in.in.h:1 +#, fuzzy +#| msgid "Tomboy Notes" +msgid "Tomboy Importer" +msgstr "Poznámky Tomboy" + +#: ../src/addins/tomboyimport/tomboyimport.desktop.in.in.h:2 +msgid "Import your notes from Tomboy." +msgstr "" + +#: ../src/addins/tomboyimport/tomboyimport.desktop.in.in.h:3 +#, fuzzy +#| msgid "Hubert Figuiere and Tomboy Project" +msgid "Hubert Figuiere" +msgstr "Hubert Figuiere a Projekt Tomboy" + +#: ../src/addins/underline/underline.desktop.in.in.h:1 +msgid "Underline" +msgstr "" + +#: ../src/addins/underline/underline.desktop.in.in.h:2 +msgid "Adds ability to underline text." +msgstr "" + +#: ../src/addins/underline/underline.desktop.in.in.h:3 +#, fuzzy +#| msgid "Hubert Figuiere and the Tomboy Project" +msgid "Hubert Figuière and the Tomboy Project" +msgstr "Hubert Figuiere a Projekt Tomboy" + +#: ../src/addins/underline/underlinemenuitem.cpp:35 +msgid "_Underline" +msgstr "" + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:70 +msgid "_URL:" +msgstr "_URL:" + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:75 +msgid "User_name:" +msgstr "Používateľské me_no" + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:81 +msgid "_Password:" +msgstr "_Heslo:" + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:105 +msgid "WebDAV" +msgstr "" + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:117 +msgid "" +"There was an error connecting to the server. This may be caused by using an " +"incorrect user name and/or password." +msgstr "" +"Chyba pri pripájaní na server. Môže to byť spôsobené používaním nesprávneho " +"používateľského mena a/alebo hesla." + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:173 +msgid "URL, username, or password field is empty." +msgstr "Pole URL, používateľské meno alebo heslo je prázdne." + +#. TODO: If the above fails (no keyring daemon), save all but password +#. to GConf, and notify user. +#. Save configuration into GConf +#. Preferences.Set ("/apps/tomboy/sync_wdfs_url", url ?? string.Empty); +#. Preferences.Set ("/apps/tomboy/sync_wdfs_username", username ?? string.Empty); +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:262 +#, fuzzy +#| msgid "" +#| "Saving configuration to the GNOME keyring failed with the following " +#| "message:" +msgid "" +"Saving configuration to the GNOME keyring failed with the following " +"message:\n" +"\n" +"%1%" +msgstr "" +"Ukladanie nastavení do zväzku kľúčov GNOME zlyhalo s nasledujúcou správou:" + +#: ../src/addins/webdavsyncservice/webdavsyncservice.desktop.in.in.h:1 +msgid "WebDAV Sync Service Plugin" +msgstr "" + +#: ../src/addins/webdavsyncservice/webdavsyncservice.desktop.in.in.h:2 +msgid "Synchronize Gnote Notes to a WebDAV URL." +msgstr "" + +#: ../src/dbus/remotecontrol-client-glue.cpp:138 +#, c-format +msgid "Remote call to %s failed" +msgstr "" + +#: ../src/dbus/remotecontrol.cpp:82 +#, c-format +msgid "Exception thrown when creating note: %s" +msgstr "" + +#: ../src/gnote.cpp:185 +msgid "Gnote is already running. Exiting..." +msgstr "" + +#: ../src/gnote.cpp:289 +msgid "and Tomboy original authors." +msgstr "a pôvodný autori programu Tomboy." + +#: ../src/gnote.cpp:295 +msgid "translator-credits" +msgstr "Pavol Klačanský " + +#: ../src/gnote.cpp:304 +msgid "" +"Copyright © 2010-2015 Aurimas Cernius\n" +"Copyright © 2009-2011 Debarshi Ray\n" +"Copyright © 2009 Hubert Figuiere\n" +"Copyright © 2004-2009 the Tomboy original authors." +msgstr "" + +#: ../src/gnote.cpp:308 +msgid "A simple and easy to use desktop note-taking application." +msgstr "" +"Jednoduchá a ľahko používatelná\n" +"aplikácia pre poznámky na pracovnej ploche." + +#: ../src/gnote.cpp:319 +msgid "Homepage" +msgstr "Domovská stránka" + +#: ../src/gnote.cpp:494 +msgid "Run Gnote in background." +msgstr "" + +#: ../src/gnote.cpp:495 +#, fuzzy +#| msgid "Run Gnote as a GNOME panel applet" +msgid "Run Gnote as GNOME Shell search provider." +msgstr "Spustiť Gnote ako aplet v GNOME paneli" + +#: ../src/gnote.cpp:496 +msgid "Specify the path of the directory containing the notes." +msgstr "" + +#: ../src/gnote.cpp:496 +msgid "path" +msgstr "" + +#: ../src/gnote.cpp:497 +#, fuzzy +#| msgid "Open the Search All Notes window" +msgid "Open the search all notes window with the search text." +msgstr "Otvoriť okno Hľadať vo všetkých poznámkach" + +#: ../src/gnote.cpp:497 ../src/gnote.cpp:502 +msgid "text" +msgstr "" + +#: ../src/gnote.cpp:498 +msgid "Print version information." +msgstr "" + +#: ../src/gnote.cpp:499 +msgid "Create and display a new note, with a optional title." +msgstr "" + +#: ../src/gnote.cpp:499 +#, fuzzy +#| msgid "Untitled" +msgid "title" +msgstr "Nepomenovaný" + +#: ../src/gnote.cpp:500 +msgid "Display the existing note matching title." +msgstr "" + +#: ../src/gnote.cpp:500 +msgid "title/url" +msgstr "" + +#: ../src/gnote.cpp:501 +#, fuzzy +#| msgid "Start Here Note" +msgid "Display the 'Start Here' note." +msgstr "Poznámka Začnite tu" + +#: ../src/gnote.cpp:502 +msgid "Search and highlight text in the opened note." +msgstr "" + +#: ../src/gnote.cpp:506 +msgid "A note taking application" +msgstr "Aplikácia na tvorbu poznámok" + +#: ../src/gnote.cpp:506 +msgid "Gnote options at launch" +msgstr "" + +#: ../src/gnote.cpp:583 +msgid "Could not connect to remote instance." +msgstr "" + +#: ../src/gnote.cpp:699 +#, fuzzy +#| msgid "Version" +msgid "Version %1%" +msgstr "Verzia" + +#. TRANSLATORS: the first %s is icon name, %d is for size, last %s is error description +#: ../src/iconmanager.cpp:66 +#, c-format +msgid "Failed to load icon (%s, %d): %s" +msgstr "" + +#: ../src/noteaddin.cpp:108 ../src/noteaddin.cpp:122 ../src/noteaddin.cpp:135 +msgid "Plugin is disposing already" +msgstr "" + +#: ../src/noteaddin.cpp:139 +msgid "Window is not embedded" +msgstr "" + +#. Probably IOException or UnauthorizedAccessException? +#: ../src/notebase.cpp:200 ../src/note.cpp:382 +#, c-format +msgid "Exception while saving note: %s" +msgstr "" + +#. write failure, but not critical +#: ../src/notebase.cpp:444 +#, c-format +msgid "Failed to update note format: %s" +msgstr "" + +#: ../src/notebase.cpp:568 +#, c-format +msgid "Filesystem error: %s" +msgstr "" + +#: ../src/notebooks/createnotebookdialog.cpp:41 +#, fuzzy +#| msgid "Create a new notebook" +msgid "Create Notebook" +msgstr "Vytvoriť nový zápisník" + +#: ../src/notebooks/createnotebookdialog.cpp:45 +msgid "N_otebook name:" +msgstr "Názov _zápisníka:" + +#: ../src/notebooks/createnotebookdialog.cpp:58 +msgid "Name already taken" +msgstr "Názov je už zadaný" + +#. Translation note: This is the Create button in the Create +#. New Note Dialog. +#: ../src/notebooks/createnotebookdialog.cpp:71 +msgid "C_reate" +msgstr "V_ytvoriť" + +#: ../src/notebooks/notebookapplicationaddin.cpp:66 +#: ../src/searchnoteswidget.cpp:229 +msgid "Notebooks" +msgstr "Zapisníky" + +#: ../src/notebooks/notebookapplicationaddin.cpp:67 +msgid "Create a new note in a notebook" +msgstr "Vytvoriť novú poznámku v zápisníku" + +#: ../src/notebooks/notebookapplicationaddin.cpp:96 +#: ../src/notebooks/notebookapplicationaddin.cpp:146 +msgid "New Note_book..." +msgstr "Nový zá_pisník..." + +#. The templateNoteTite should show the name of the +#. notebook. For example, if the name of the notebooks +#. "Meetings", the templateNoteTitle should be "Meetings +#. Notebook Template". Translators should place the +#. name of the notebook accordingly using "%1%". +#: ../src/notebooks/notebook.cpp:109 +msgid "%1% Notebook Template" +msgstr "%1% šablóna zápisníka" + +#: ../src/notebooks/notebook.cpp:185 ../src/notemanagerbase.cpp:301 +#, fuzzy +#| msgid "_New Note" +msgid "New Note" +msgstr "_Nová poznámka" + +#: ../src/notebooks/notebookmanager.cpp:364 +msgid "Really delete this notebook?" +msgstr "Naozaj odstrániť tento zápisník?" + +#: ../src/notebooks/notebookmanager.cpp:365 +msgid "" +"The notes that belong to this notebook will not be deleted, but they will no " +"longer be associated with this notebook. This action cannot be undone." +msgstr "" +"Poznámky patriace do tohto zápisníku nebudú odstránené, ale už nebudú " +"priradené k tomuto zápisníku. Táto akcia je nevratná." + +#: ../src/notebooks/notebookmenuitem.cpp:34 +msgid "No notebook" +msgstr "Žiadny zápisník" + +#: ../src/notebooks/notebooknewnotemenuitem.cpp:40 +msgid "New \"%1%\" Note" +msgstr "Nová poznámka v \"%1%\"" + +#: ../src/notebooks/notebooknoteaddin.cpp:72 +msgid "Notebook" +msgstr "Zápisník" + +#: ../src/notebooks/notebooknoteaddin.cpp:73 +msgid "Place this note into a notebook" +msgstr "Vložiť túto poznámku do zápisníka" + +#. Add new notebook item +#: ../src/notebooks/notebooknoteaddin.cpp:153 +msgid "_New notebook..." +msgstr "_Nový zápisník..." + +#: ../src/notebooks/specialnotebooks.cpp:46 +msgid "All" +msgstr "Všetky" + +#: ../src/notebooks/specialnotebooks.cpp:75 +#, fuzzy +#| msgid "Unfiled Notes" +msgid "Unfiled" +msgstr "Nezaradené poznámky" + +#: ../src/notebooks/specialnotebooks.cpp:106 +msgid "Important" +msgstr "" + +#: ../src/notebooks/specialnotebooks.cpp:133 +msgid "Active" +msgstr "" + +#: ../src/notebuffer.cpp:1505 +msgid " tag mismatch" +msgstr "" + +#: ../src/notebuffer.cpp:1584 +#, c-format +msgid "Exception: %s" +msgstr "" + +#. TRANSLATORS: %1% will be replaced by note title +#: ../src/note.cpp:59 +#, fuzzy +#| msgid "Really delete this note?" +#| msgid_plural "Really delete these %1% notes?" +msgid "Really delete \"%1%\"?" +msgstr "Skutočne odstrániť týchto %1% poznámok?" + +#. TRANSLATORS: %1% is number of notes +#: ../src/note.cpp:63 +#, fuzzy +#| msgid "Really delete this note?" +#| msgid_plural "Really delete these %1% notes?" +msgid "Really delete %1% note?" +msgid_plural "Really delete %1% notes?" +msgstr[0] "Skutočne odstrániť týchto %1% poznámok?" +msgstr[1] "Skutočne odstrániť túto %1% poznámku?" +msgstr[2] "Skutočne odstrániť tieto %1% poznámky?" + +#: ../src/note.cpp:70 +msgid "If you delete a note it is permanently lost." +msgstr "Ak zmažete poznámku, bude navždy odstránená." + +#: ../src/note.cpp:106 +msgid "Error saving note data." +msgstr "Chyba pri ukladaní údajov poznámky." + +#: ../src/note.cpp:107 +#, fuzzy +#| msgid "" +#| "An error occurred while saving your notes. Please check that you have " +#| "sufficient disk space, and that you have appropriate rights on ~/.gnote. " +#| "Error details can be found in ~/.gnote.log." +msgid "" +"An error occurred while saving your notes. Please check that you have " +"sufficient disk space, and that you have appropriate rights on ~/.local/" +"share/gnote. Error details can be found in ~/.gnote.log." +msgstr "" +"Počas ukladania vašich poznámok sa vyskytla chyba. Skontrolujte, prosím, či " +"máte dostatok miesta na disku, a či máte vhodné oprávnenia v ~/.note. " +"Podrobnosti chyby môžete nájsť v ~/.gnote.log." + +#: ../src/note.cpp:474 +#, fuzzy, c-format +#| msgid "Error saving icon" +msgid "Error while saving: %s" +msgstr "Chyba pri ukladaní ikony" + +#: ../src/note.cpp:699 +msgid "Setting text content for closed notes not supported" +msgstr "" + +#: ../src/notemanagerbase.cpp:105 ../src/preferencesdialog.cpp:320 +msgid "New Note Template" +msgstr "Šablóna novej poznámky" + +#: ../src/notemanagerbase.cpp:359 +msgid "Describe your new note here." +msgstr "Tu napíšte obsah novej poznámky." + +#: ../src/notemanager.cpp:133 +#, fuzzy +#| msgid "" +#| "Start " +#| "Here\n" +#| "\n" +#| "Welcome to Gnote!\n" +#| "\n" +#| "Use this \"Start Here\" note to begin organizing your ideas and " +#| "thoughts.\n" +#| "\n" +#| "You can create new notes to hold your ideas by selecting the \"Create New " +#| "Note\" item from the Gnote Notes menu in your GNOME Panel. Your note will " +#| "be saved automatically.\n" +#| "\n" +#| "Then organize the notes you create by linking related notes and ideas " +#| "together!\n" +#| "\n" +#| "We've created a note called Using Links in Gnote. Notice how each time we type Using Links in " +#| "Gnote it automatically gets underlined? Click on the " +#| "link to open the note." +msgid "" +"Start " +"Here\n" +"\n" +"Welcome to Gnote!\n" +"\n" +"Use this \"Start Here\" note to begin organizing your ideas and thoughts.\n" +"\n" +"You can create new notes to hold your ideas by selecting the \"Create New " +"Note\" item from the Gnote menu in your GNOME Panel. Your note will be saved " +"automatically.\n" +"\n" +"Then organize the notes you create by linking related notes and ideas " +"together!\n" +"\n" +"We've created a note called Using Links in Gnote. Notice how each time we type Using Links in " +"Gnote it automatically gets underlined? Click on the link " +"to open the note." +msgstr "" +"Začnite tu\n" +"\n" +"Vitajte v Gnote!\n" +"\n" +"Použite \"Začnite tu\" poznámku na začiatky organizovania vašich nápadov a " +"myšlienok.\n" +"\n" +"Môžete vytvoriť nové poznámky na uchovanie vašich nápadov vybraním položky " +"\"Vytvoriť novú poznámku\" v ponuke poznámok Gnote vo vašom GNOME paneli. " +"Vaša poznámka bude uložená automaticky.\n" +"\n" +"Po zorganizovaní poznámok vytvorte odkazom príbuzné poznámky a nápady máte " +"spolu!\n" +"\n" +"Vytvorili sme poznámku, ktorá sa volá Používanie odkazov v " +"Gnote. Všimli ste si, keď sme zadali Používanie odkazov v Gnote, že sa to automaticky " +"podčiarklo? Kliknite na odkaz pre otvorenie poznámky." + +#: ../src/notemanager.cpp:152 +msgid "" +"Using Links in Gnote\n" +"\n" +"Notes in Gnote can be linked together by highlighting text in the current " +"note and clicking the Link button above in the toolbar. Doing " +"so will create a new note and also underline the note's title in the current " +"note.\n" +"\n" +"Changing the title of a note will update links present in other notes. This " +"prevents broken links from occurring when a note is renamed.\n" +"\n" +"Also, if you type the name of another note in your current note, it will " +"automatically be linked for you." +msgstr "" +"Používanie odkazov v Gnote\n" +"\n" +"Poznámky v Gnote môžu byť spolu prepojené označením textu v súčastnej " +"poznámke a kliknutím na tlačidlo Odkaz hore v paneli " +"nástrojov. Tak vytvoríte novú poznámku, tiež sa podčiarkne názov poznámky v " +"súčastnej poznámke.\n" +"\n" +"Zmenením názvu poznámky sa aktualizujú odkazy v ostatných poznámkach, ktoré " +"odkazujú na ňu. Týmto sa predchádza výskytu pokazených odkazov, keď je " +"poznámka premenovaná.\n" +"\n" +"Taktiež, ak zadáte názov inej poznámky v súčastnej poznámke, tak bude " +"automaticky prepojená s ňou." + +#. Attempt to find an existing Start Here note +#: ../src/notemanager.cpp:167 ../src/notemanager.cpp:208 +msgid "Start Here" +msgstr "Začnite tu" + +#: ../src/notemanager.cpp:173 +msgid "Using Links in Gnote" +msgstr "Používanie odkazov v Gnote" + +#: ../src/notemanager.cpp:178 +#, fuzzy, c-format +#| msgid "Error printing note" +msgid "Error creating start notes: %s" +msgstr "Chyba pri tlači poznámky" + +#. TRANSLATORS: first %s is file, second is error +#: ../src/notemanager.cpp:196 +#, c-format +msgid "Error parsing note XML, skipping \"%s\": %s" +msgstr "" + +#: ../src/noterenamedialog.cpp:123 +msgid "Rename Note Links?" +msgstr "" + +#: ../src/noterenamedialog.cpp:127 +msgid "_Don't Rename Links" +msgstr "" + +#: ../src/noterenamedialog.cpp:128 +#, fuzzy +#| msgid "_Open Link" +msgid "_Rename Links" +msgstr "_Otvoriť odkaz" + +#: ../src/noterenamedialog.cpp:129 +msgid "Select All" +msgstr "" + +#: ../src/noterenamedialog.cpp:130 +#, fuzzy +#| msgid "Select an icon..." +msgid "Select None" +msgstr "Zvoliť ikonu..." + +#: ../src/noterenamedialog.cpp:131 +#, fuzzy +#| msgid "Close this window" +msgid "Always show this _window" +msgstr "Zavrieť toto okno" + +#: ../src/noterenamedialog.cpp:132 +msgid "Alwa_ys rename links" +msgstr "" + +#: ../src/noterenamedialog.cpp:134 +msgid "Never rename _links" +msgstr "" + +#: ../src/noterenamedialog.cpp:152 +msgid "" +"Rename links in other notes from \"%1\" to " +"\"%2\"?\n" +"\n" +"If you do not rename the links, they will no longer link to anything." +msgstr "" + +#: ../src/noterenamedialog.cpp:185 +#, fuzzy +#| msgid "_Open Link" +msgid "Rename Links" +msgstr "_Otvoriť odkaz" + +#: ../src/noterenamedialog.cpp:200 ../src/synchronization/syncdialog.cpp:331 +msgid "Note Title" +msgstr "Názov poznámky" + +#: ../src/noterenamedialog.cpp:237 +#, fuzzy +#| msgid "_Advanced..." +msgid "Ad_vanced" +msgstr "_Pokročilé..." + +#: ../src/notewindow.cpp:372 +msgid "_Link to New Note" +msgstr "O_dkaz na novú poznámku" + +#: ../src/notewindow.cpp:380 +msgid "Te_xt" +msgstr "Te_xt" + +#: ../src/notewindow.cpp:417 +msgid "Set properties of text" +msgstr "Nastaviť vlastnosti textu" + +#: ../src/notewindow.cpp:421 +msgid "Is Important" +msgstr "" + +#: ../src/notewindow.cpp:422 +msgid "Toggle notes presence in Important Notes notebook" +msgstr "" + +#: ../src/notewindow.cpp:430 ../src/searchnoteswidget.cpp:144 +#: ../src/searchnoteswidget.cpp:147 +msgid "_Delete" +msgstr "O_dstrániť" + +#: ../src/notewindow.cpp:430 +msgid "Delete this note" +msgstr "Odstrániť túto poznámku" + +#: ../src/notewindow.cpp:446 +msgid "" +"This note is a template note. It determines the default content of regular " +"notes, and will not show up in the note menu or search window." +msgstr "" + +#: ../src/notewindow.cpp:449 +msgid "Convert to regular note" +msgstr "" + +#: ../src/notewindow.cpp:452 +msgid "Save Si_ze" +msgstr "" + +#: ../src/notewindow.cpp:456 +msgid "Save Se_lection" +msgstr "" + +#: ../src/notewindow.cpp:460 +#, fuzzy +#| msgid "Note Title" +msgid "Save _Title" +msgstr "Názov poznámky" + +#: ../src/notewindow.cpp:562 ../src/notewindow.cpp:1085 +msgid "Cannot create note" +msgstr "Nemôžem vytvoriť poznámku" + +#: ../src/notewindow.cpp:828 +#, fuzzy +#| msgid "Link" +msgid "_Link" +msgstr "Odkaz" + +#: ../src/notewindow.cpp:829 +msgid "_Bold" +msgstr "_Tučné" + +#: ../src/notewindow.cpp:830 +msgid "_Italic" +msgstr "_Kurzíva" + +#: ../src/notewindow.cpp:831 +msgid "_Strikeout" +msgstr "_Preškrtnuté" + +#: ../src/notewindow.cpp:833 +msgid "_Highlight" +msgstr "_Zvýraznené" + +#: ../src/notewindow.cpp:835 +msgid "_Normal" +msgstr "Normá_lne" + +#: ../src/notewindow.cpp:837 +msgid "Hu_ge" +msgstr "Ob_rovské" + +#: ../src/notewindow.cpp:839 +msgid "_Large" +msgstr "V_eľké" + +#: ../src/notewindow.cpp:841 +msgid "S_mall" +msgstr "_Malé" + +#: ../src/notewindow.cpp:843 +msgid "Bullets" +msgstr "Odrážky" + +#: ../src/preferencesdialog.cpp:121 +msgid "General" +msgstr "" + +#: ../src/preferencesdialog.cpp:122 +#, fuzzy +#| msgid "Link" +msgid "Links" +msgstr "Odkaz" + +#. TRANSLATORS: Addin category. +#: ../src/preferencesdialog.cpp:125 ../src/sharp/addinstreemodel.cpp:164 +msgid "Synchronization" +msgstr "Synchronizácia" + +#: ../src/preferencesdialog.cpp:127 +msgid "Plugins" +msgstr "" + +#: ../src/preferencesdialog.cpp:204 +#, c-format +msgid "Plugin %s is absent" +msgstr "" + +#. Open in new window +#: ../src/preferencesdialog.cpp:243 +msgid "Always _open notes in new window" +msgstr "" + +#: ../src/preferencesdialog.cpp:256 +msgid "_Spell check while typing" +msgstr "Kontrolovať pravopi_s počas písania" + +#: ../src/preferencesdialog.cpp:257 +msgid "" +"Misspellings will be underlined in red, with correct spelling suggestions " +"shown in the context menu." +msgstr "" +"Chyby budú podtrhnuté červenou a návrhy správneho zápisu budú zobrazené v " +"kontextovej ponuke." + +#. Auto bulleted list +#: ../src/preferencesdialog.cpp:267 +msgid "Enable auto-_bulleted lists" +msgstr "Povoliť automaticky o_drážkované zoznamy" + +#: ../src/preferencesdialog.cpp:268 +msgid "Start new bulleted list by starting new line with character \"-\"." +msgstr "" + +#: ../src/preferencesdialog.cpp:277 +msgid "Use custom _font" +msgstr "Použiť vlastné písm_o" + +#: ../src/preferencesdialog.cpp:295 +msgid "When renaming a linked note: " +msgstr "" + +#: ../src/preferencesdialog.cpp:299 +#, fuzzy +#| msgid "Always ask me what to do." +msgid "Ask me what to do" +msgstr "Vždy sa opýtať čo spraviť." + +#: ../src/preferencesdialog.cpp:300 +msgid "Never rename links" +msgstr "" + +#: ../src/preferencesdialog.cpp:301 +msgid "Always rename links" +msgstr "" + +#: ../src/preferencesdialog.cpp:321 +msgid "" +"Use the new note template to specify the text that should be used when " +"creating a new note." +msgstr "" +"Použiť šablónu novej poznámky k určeniu textu, ktorý by mal byť použitý, keď " +"bude vytvorená nová poznámka." + +#: ../src/preferencesdialog.cpp:326 +msgid "Open New Note Template" +msgstr "Otvoriť šablónu novej poznámky" + +#. internal links +#: ../src/preferencesdialog.cpp:383 +msgid "_Automatically link to notes" +msgstr "" + +#: ../src/preferencesdialog.cpp:384 +msgid "Enable this option to create a link when text matches note title." +msgstr "" + +#. URLs +#: ../src/preferencesdialog.cpp:390 +msgid "Create links for _URLs" +msgstr "" + +#: ../src/preferencesdialog.cpp:391 +msgid "" +"Enable this option to create links for URLs. Clicking will open URL with " +"appropriate program." +msgstr "" + +#. WikiWords... +#: ../src/preferencesdialog.cpp:398 +msgid "Highlight _WikiWords" +msgstr "Zvýrazňovať _WikiSlová" + +#: ../src/preferencesdialog.cpp:399 +msgid "" +"Enable this option to highlight words ThatLookLikeThis. Clicking the " +"word will create a note with that name." +msgstr "" +"Povolením tejto možnosti zvýrazníte slová KtoréVyzerajúTakto. " +"Kliknutím na to slovo vytvoríte poznámku s takým názvom." + +#: ../src/preferencesdialog.cpp:431 +msgid "Ser_vice:" +msgstr "Služ_ba:" + +#: ../src/preferencesdialog.cpp:487 ../src/preferencesdialog.cpp:1117 +msgid "Not configurable" +msgstr "Nekonfigurovateľné" + +#: ../src/preferencesdialog.cpp:514 +msgid "Automatical background s_ync interval (minutes)" +msgstr "" + +#. "Advanced..." button to bring up extra sync config dialog +#: ../src/preferencesdialog.cpp:538 +msgid "_Advanced..." +msgstr "_Pokročilé..." + +#: ../src/preferencesdialog.cpp:585 +#, fuzzy +#| msgid "The following add-ins are installed" +msgid "The following plugins are installed:" +msgstr "Nasledujúce doplnky sú nainštalované" + +#. TODO: In a future version, add in an "Install Add-ins..." button +#. TODO: In a future version, add in a "Repositories..." button +#: ../src/preferencesdialog.cpp:620 +msgid "_Enable" +msgstr "_Povoliť" + +#: ../src/preferencesdialog.cpp:626 +msgid "_Disable" +msgstr "Z_akázať" + +#: ../src/preferencesdialog.cpp:784 +msgid "Not Implemented" +msgstr "Nenaimplementované" + +#: ../src/preferencesdialog.cpp:800 +msgid "%1% Preferences" +msgstr "%1% predvoľby" + +#: ../src/preferencesdialog.cpp:935 +msgid "Choose Note Font" +msgstr "Zvoľte písmo poznámky" + +#. Create dialog +#: ../src/preferencesdialog.cpp:1033 +msgid "Other Synchronization Options" +msgstr "Ostatné nastavenia synchronizácie" + +#: ../src/preferencesdialog.cpp:1036 +msgid "" +"When a conflict is detected between a local note and a note on the " +"configured synchronization server:" +msgstr "" +"Keď je zistený rozpor medzi miestnou poznámkou a poznámkou na nastavenom " +"synchronizačnom serveri:" + +#. label.Xalign = 0; +#: ../src/preferencesdialog.cpp:1040 +#, fuzzy +#| msgid "Always ask me what to do." +msgid "Always ask me what to do" +msgstr "Vždy sa opýtať čo spraviť." + +#: ../src/preferencesdialog.cpp:1044 +#, fuzzy +#| msgid "Rename my local note." +msgid "Rename my local note" +msgstr "Premenovať miestnu poznámku." + +#: ../src/preferencesdialog.cpp:1048 +#, fuzzy +#| msgid "Replace my local note with the server's update." +msgid "Replace my local note with the server's update" +msgstr "Nahradiť miestnu poznámku s aktualizáciou poznámky zo servera." + +#: ../src/preferencesdialog.cpp:1150 +#, fuzzy +#| msgid "WARNING: Are you sure?" +msgid "Are you sure?" +msgstr "UPOZORNENIE: Ste si istý?" + +#: ../src/preferencesdialog.cpp:1151 +msgid "" +"Clearing your synchronization settings is not recommended. You may be " +"forced to synchronize all of your notes again when you save new settings." +msgstr "" +"Vymazanie vašich synchronizačných nastavení sa nedoporučuje. Mali by ste si " +"úplne synchronizovať všetky vaše poznámky znova po uložení nových nastavení." + +#: ../src/preferencesdialog.cpp:1161 +msgid "Resetting Synchronization Settings" +msgstr "Nulovanie synchronizačných nastavení" + +#: ../src/preferencesdialog.cpp:1162 +#, fuzzy +#| msgid "" +#| "You have disabled the configured synchronization service. Your " +#| "synchronization settings will now be cleared. You may be forced to " +#| "synchronize all of your notes again when you save new settings" +msgid "" +"You have disabled the configured synchronization service. Your " +"synchronization settings will now be cleared. You may be forced to " +"synchronize all of your notes again when you save new settings." +msgstr "" +"Máte zakázané nastavenia synchronizačného servera. Vaše nastavenia " +"synchronizácie budú vymazané. Mali by ste vynútiť synchronizáciu všetkých " +"vašich poznámok znovu, keď uložíte nové nastavenia" + +#: ../src/preferencesdialog.cpp:1228 +msgid "Connection successful" +msgstr "" + +#: ../src/preferencesdialog.cpp:1229 +#, fuzzy +#| msgid "" +#| "Tomboy is ready to synchronize your notes. Would you like to synchronize " +#| "them now?" +msgid "" +"Gnote is ready to synchronize your notes. Would you like to synchronize them " +"now?" +msgstr "" +"Tomboy je pripravený na synchronizáciu vašich poznámok. Prajete si ich " +"synchronizovať teraz?" + +#: ../src/preferencesdialog.cpp:1253 +msgid "" +"Please check your information and try again. The log file %1% may contain " +"more information about the error." +msgstr "" + +#: ../src/preferencesdialog.cpp:1258 +#, fuzzy +#| msgid "Error connecting :(" +msgid "Error connecting" +msgstr "Chyba pri pripájaní :(" + +#: ../src/preferencesdialog.cpp:1321 +msgid "Version:" +msgstr "Verzia:" + +#: ../src/preferencesdialog.cpp:1324 +msgid "Author:" +msgstr "Autor:" + +#: ../src/preferencesdialog.cpp:1329 +msgid "Copyright:" +msgstr "Autorské práva:" + +#: ../src/recentchanges.cpp:129 +msgid "All Notes" +msgstr "Všetky poznámky" + +#: ../src/recentchanges.cpp:135 +#, fuzzy +#| msgid "_New" +msgid "New" +msgstr "_Nový" + +#: ../src/recentchanges.cpp:156 +msgid "Search" +msgstr "Hľadať" + +#: ../src/recentchanges.cpp:197 +msgid "Find _Next" +msgstr "_Hľadať ďalej" + +#: ../src/recentchanges.cpp:205 +msgid "Find _Previous" +msgstr "Nájsť pre_dchádzajúce" + +#: ../src/recentchanges.cpp:673 +msgid "_Close" +msgstr "Za_vrieť" + +#: ../src/remotecontrolproxy.cpp:57 +#, c-format +msgid "Failed to load D-Bus interface %s: %s" +msgstr "" + +#: ../src/searchnoteswidget.cpp:137 +#, fuzzy +#| msgid "_Open..." +msgid "_Open" +msgstr "_Otvoriť..." + +#: ../src/searchnoteswidget.cpp:140 +msgid "Open In New _Window" +msgstr "" + +#: ../src/searchnoteswidget.cpp:150 +#, fuzzy +#| msgid "User_name:" +msgid "Re_name..." +msgstr "Používateľské me_no" + +#: ../src/searchnoteswidget.cpp:659 +msgid "Note" +msgstr "Poznámka" + +#: ../src/searchnoteswidget.cpp:681 +msgid "Modified" +msgstr "" + +#: ../src/searchnoteswidget.cpp:1000 +msgid "Notes" +msgstr "Poznámky" + +#: ../src/searchnoteswidget.cpp:1019 +msgid "" +"No results found in the selected notebook.\n" +"Click here to search across all notes." +msgstr "" + +#: ../src/searchnoteswidget.cpp:1023 +msgid "Click here to search across all notebooks" +msgstr "" + +#: ../src/searchnoteswidget.cpp:1044 +msgid "Matches" +msgstr "Zhody" + +#. TRANSLATORS: search found a match in note title +#: ../src/searchnoteswidget.cpp:1096 +#, fuzzy +#| msgid "%1% match" +#| msgid_plural "%1% matches" +msgid "Title match" +msgstr "%1% zhôd" + +#: ../src/searchnoteswidget.cpp:1100 +msgid "%1% match" +msgid_plural "%1% matches" +msgstr[0] "%1% zhôd" +msgstr[1] "%1% zhoda" +msgstr[2] "%1% zhody" + +#: ../src/searchnoteswidget.cpp:1311 +msgid "_New" +msgstr "_Nový" + +#: ../src/searchnoteswidget.cpp:1340 +msgid "_Open Template Note" +msgstr "_Otvoriť šablónu poznámky" + +#: ../src/searchnoteswidget.cpp:1351 +#, fuzzy +#| msgid "_New" +msgid "_New..." +msgstr "_Nový" + +#: ../src/searchnoteswidget.cpp:1487 ../src/searchnoteswidget.cpp:1500 +#: ../src/searchnoteswidget.cpp:1511 +#, c-format +msgid "Failed to parse setting %s (Value: %s):" +msgstr "" + +#: ../src/searchnoteswidget.cpp:1488 +msgid "Expected format 'column:order'" +msgstr "" + +#: ../src/searchnoteswidget.cpp:1501 +#, c-format +msgid "Unrecognized column %s" +msgstr "" + +#: ../src/searchnoteswidget.cpp:1512 +#, c-format +msgid "Unrecognized order %s" +msgstr "" + +#: ../src/sharp/addinstreemodel.cpp:109 +msgid "Name" +msgstr "Názov" + +#: ../src/sharp/addinstreemodel.cpp:121 +msgid "Version" +msgstr "Verzia" + +#. TRANSLATORS: Addin category. +#: ../src/sharp/addinstreemodel.cpp:155 +msgid "Formatting" +msgstr "" + +#. TRANSLATORS: Addin category. +#: ../src/sharp/addinstreemodel.cpp:158 +msgid "Desktop integration" +msgstr "" + +#. TRANSLATORS: Addin category. +#: ../src/sharp/addinstreemodel.cpp:161 +#, fuzzy +#| msgid "_Tools" +msgid "Tools" +msgstr "Nás_troje" + +#. TRANSLATORS: Addin category is unknown. +#: ../src/sharp/addinstreemodel.cpp:168 +msgid "Unknown" +msgstr "" + +#: ../src/sharp/modulemanager.cpp:62 +#, fuzzy, c-format +#| msgid "Error saving icon" +msgid "Error loading %s" +msgstr "Chyba pri ukladaní ikony" + +#: ../src/sharp/modulemanager.cpp:69 +#, c-format +msgid "Error getting symbol dynamic_module_instanciate: %s" +msgstr "" + +#: ../src/sharp/xmlreader.cpp:195 +#, c-format +msgid "XML error: %s" +msgstr "" + +#: ../src/sharp/xmlreader.cpp:195 +msgid "unknown parse error" +msgstr "" + +#: ../src/sharp/xmlwriter.cpp:40 +msgid "%1% failed" +msgstr "" + +#: ../src/sharp/xsltransform.cpp:67 +msgid "NULL stylesheet, please fill a bug" +msgstr "" + +#: ../src/synchronization/filesystemsyncserver.cpp:369 +#, c-format +msgid "" +"Exception during server cleanup while committing. Server integrity is OK, " +"but there may be some excess files floating around. Here's the error: %s\n" +msgstr "" + +#: ../src/synchronization/filesystemsyncserver.cpp:609 +#, fuzzy, c-format +#| msgid "Error connecting to the synchronization service. Please try again." +msgid "Error deleting the old synchronization lock \"%s\": %s" +msgstr "" +"Chyba pri pripájaní k synchronizačnej službe. Skúste to, prosím, znovu." + +#: ../src/synchronization/fusesyncserviceaddin.cpp:115 +#, fuzzy +#| msgid "" +#| "This synchronization addin is not supported on your computer. Please make " +#| "sure you have FUSE and {0} correctly installed and configured" +msgid "" +"This synchronization addin is not supported on your computer. Please make " +"sure you have FUSE and %1% correctly installed and configured" +msgstr "" +"Tento synchronizačný doplnok nie je podporovaný na vašom počítači. Prosím " +"preverte, či máte FUSE a {0} správne nainštalované a nastavené" + +#: ../src/synchronization/fusesyncserviceaddin.cpp:158 +msgid "Could not read testfile." +msgstr "Testovací súbor nemohol byť prečítaný." + +#: ../src/synchronization/fusesyncserviceaddin.cpp:167 +msgid "Write test failed." +msgstr "Zlyhala skúška zápisu." + +#: ../src/synchronization/fusesyncserviceaddin.cpp:196 +msgid "Timeout connecting to server." +msgstr "Vypršal časový limit pripájania k serveru." + +#: ../src/synchronization/fusesyncserviceaddin.cpp:202 +msgid "Error connecting to server." +msgstr "Chyba pri pripájaní k serveru." + +#: ../src/synchronization/fusesyncserviceaddin.cpp:215 +msgid "FUSE could not be enabled." +msgstr "FUSE sa nedalo zapnúť." + +#: ../src/synchronization/fusesyncserviceaddin.cpp:246 +#, fuzzy +#| msgid "An error ocurred while connecting to the specified server:" +msgid "An error occurred while connecting to the specified server" +msgstr "Vyskytla sa chyba počas pripájania k určenému serveru:" + +#. TRANSLATORS: %s is file +#: ../src/synchronization/gnotesyncclient.cpp:165 +#, c-format +msgid "Unparsable last-sync-date element in %s" +msgstr "" + +#. TRANSLATORS: %s is file +#: ../src/synchronization/gnotesyncclient.cpp:175 +#, c-format +msgid "Unparsable last-sync-rev element in %s" +msgstr "" + +#: ../src/synchronization/syncdialog.cpp:64 +msgid "Note Conflict" +msgstr "Konflikt medzi poznámkami" + +#. Suggest renaming note by appending " (old)" to the existing title +#: ../src/synchronization/syncdialog.cpp:69 +msgid " (old)" +msgstr " (stará)" + +#: ../src/synchronization/syncdialog.cpp:114 +msgid "Rename local note:" +msgstr "Premenovať miestnu poznámku:" + +#: ../src/synchronization/syncdialog.cpp:121 +msgid "Update links in referencing notes" +msgstr "Aktualizovať odkazy v odkazujúcich poznámkach" + +#: ../src/synchronization/syncdialog.cpp:127 +msgid "Overwrite local note" +msgstr "Prepísať miestnu poznámku" + +#: ../src/synchronization/syncdialog.cpp:131 +msgid "Always perform this action" +msgstr "Vždy vykonať túto akciu" + +#. Set initial dialog text +#: ../src/synchronization/syncdialog.cpp:137 +msgid "Note conflict detected" +msgstr "Bol zistený konflikt medzi poznámkami" + +#: ../src/synchronization/syncdialog.cpp:139 +#, fuzzy +#| msgid "" +#| "The server version of \"{0}\" conflicts with your local note. What do " +#| "you want to do with your local note?" +msgid "" +"The server version of \"%1%\" conflicts with your local note. What do you " +"want to do with your local note?" +msgstr "" +"Serverová verzia \"{0}\" je v konflikte s miestnou poznámkou. Čo chcete " +"spraviť s miestnou poznámkou?" + +#. Expander containing TreeView +#: ../src/synchronization/syncdialog.cpp:296 +msgid "Details" +msgstr "Podrobnosti" + +#: ../src/synchronization/syncdialog.cpp:338 +msgid "Status" +msgstr "Stav" + +#: ../src/synchronization/syncdialog.cpp:483 +msgid "Acquiring sync lock..." +msgstr "Získavam synchronizačný zámok..." + +#: ../src/synchronization/syncdialog.cpp:486 +msgid "Committing changes..." +msgstr "Odovzdávam zmeny..." + +#: ../src/synchronization/syncdialog.cpp:489 +msgid "Synchronizing Notes" +msgstr "Synchronizujú sa poznámky" + +#: ../src/synchronization/syncdialog.cpp:490 +msgid "Synchronizing your notes..." +msgstr "Synchronizujú sa vaše poznámky..." + +#: ../src/synchronization/syncdialog.cpp:491 +msgid "This may take a while, kick back and enjoy!" +msgstr "Môže to chvíľu trvať, oddýchnite si!" + +#: ../src/synchronization/syncdialog.cpp:493 +msgid "Connecting to the server..." +msgstr "Pripájam sa k serveru..." + +#: ../src/synchronization/syncdialog.cpp:499 +msgid "Deleting notes off of the server..." +msgstr "Odstraňujú sa poznámky zo servera..." + +#: ../src/synchronization/syncdialog.cpp:503 +msgid "Downloading new/updated notes..." +msgstr "Sťahujú sa nové/aktualizované poznámky..." + +#: ../src/synchronization/syncdialog.cpp:515 +msgid "Server Locked" +msgstr "Server uzamknutý" + +#: ../src/synchronization/syncdialog.cpp:516 +msgid "Server is locked" +msgstr "Server je uzamknutý" + +#: ../src/synchronization/syncdialog.cpp:517 +msgid "" +"One of your other computers is currently synchronizing. Please wait 2 " +"minutes and try again." +msgstr "" +"Jeden z vašich ostatných počítačov sa práve synchronizuje. Počkajte, prosím, " +"2 minúty a skúste \n" +"to znovu." + +#: ../src/synchronization/syncdialog.cpp:521 +msgid "Preparing to download updates from server..." +msgstr "Pripravujem stiahnutie aktualizácí zo servera..." + +#: ../src/synchronization/syncdialog.cpp:524 +msgid "Preparing to upload updates to server..." +msgstr "Pripravujem nahratie aktualizácií na server..." + +#: ../src/synchronization/syncdialog.cpp:527 +msgid "Uploading notes to server..." +msgstr "Nahrávam poznámky na server..." + +#: ../src/synchronization/syncdialog.cpp:530 +msgid "Synchronization Failed" +msgstr "Synchronizácia zlyhala" + +#: ../src/synchronization/syncdialog.cpp:531 +msgid "Failed to synchronize" +msgstr "Zlyhala synchronizácia" + +#: ../src/synchronization/syncdialog.cpp:532 +msgid "Could not synchronize notes. Check the details below and try again." +msgstr "" +"Nemohli byť synchronizované poznámky. Skontrolujte podrobnosti dole a " +"skúste to znovu." + +#: ../src/synchronization/syncdialog.cpp:538 +msgid "Synchronization Complete" +msgstr "Synchronizácia dokončená" + +#: ../src/synchronization/syncdialog.cpp:539 +msgid "Synchronization is complete" +msgstr "Synchronizácia je dokončená" + +#: ../src/synchronization/syncdialog.cpp:540 +#, fuzzy +#| msgid "{0} note updated." +#| msgid_plural "{0} notes updated." +msgid "%1% note updated." +msgid_plural "%1% notes updated." +msgstr[0] "{0} poznámok aktualizovaných." +msgstr[1] "{0} poznámka aktualizovaná." +msgstr[2] "{0} poznámky aktualizované." + +#: ../src/synchronization/syncdialog.cpp:541 +msgid "Your notes are now up to date." +msgstr "Vaše poznámky boli práve aktualizované." + +#: ../src/synchronization/syncdialog.cpp:546 +msgid "Synchronization Canceled" +msgstr "Synchronizácia zrušená" + +#: ../src/synchronization/syncdialog.cpp:547 +msgid "Synchronization was canceled" +msgstr "Synchronizácia bola zrušená" + +#: ../src/synchronization/syncdialog.cpp:548 +msgid "You canceled the synchronization. You may close the window now." +msgstr "Prerušili ste synchronizáciu. Mali by ste teraz zavrieť okno." + +#: ../src/synchronization/syncdialog.cpp:552 +msgid "Synchronization Not Configured" +msgstr "Synchronizácia nenastavená" + +#: ../src/synchronization/syncdialog.cpp:553 +msgid "Synchronization is not configured" +msgstr "Synchronizácia nie je nastavená" + +#: ../src/synchronization/syncdialog.cpp:554 +msgid "Please configure synchronization in the preferences dialog." +msgstr "" +"Nastavte si prosím synchronizáciu v dialógu\n" +"predvolieb." + +#: ../src/synchronization/syncdialog.cpp:558 +msgid "Synchronization Service Error" +msgstr "Chyba služby synchronizácie" + +#: ../src/synchronization/syncdialog.cpp:559 +msgid "Service error" +msgstr "Chyba služby" + +#: ../src/synchronization/syncdialog.cpp:560 +msgid "Error connecting to the synchronization service. Please try again." +msgstr "" +"Chyba pri pripájaní k synchronizačnej službe. Skúste to, prosím, znovu." + +#: ../src/synchronization/syncdialog.cpp:574 +msgid "Deleted locally" +msgstr "Odstránené miestne" + +#: ../src/synchronization/syncdialog.cpp:577 +msgid "Deleted from server" +msgstr "Odstránená zo servera" + +#: ../src/synchronization/syncdialog.cpp:580 +msgid "Updated" +msgstr "Aktualizované" + +#: ../src/synchronization/syncdialog.cpp:583 +msgid "Added" +msgstr "Pridané" + +#: ../src/synchronization/syncdialog.cpp:586 +msgid "Uploaded changes to server" +msgstr "Zmeny boli nahrané na server" + +#: ../src/synchronization/syncdialog.cpp:589 +msgid "Uploaded new note to server" +msgstr "Nahraná nová poznámka na server" + +#: ../src/synchronization/syncmanager.cpp:66 +msgid "Synchronize Notes" +msgstr "Synchronizovať poznámky" + +#: ../src/synchronization/syncmanager.cpp:85 +#: ../src/synchronization/syncmanager.cpp:102 +#: ../src/synchronization/syncmanager.cpp:575 +#, c-format +msgid "Report a bug. Cast failed: %s" +msgstr "" + +#: ../src/synchronization/syncmanager.cpp:148 +#, c-format +msgid "Error cleaning up addin after synchronization: %s" +msgstr "" + +#: ../src/synchronization/syncmanager.cpp:173 +#, c-format +msgid "Exception while creating SyncServer: %s" +msgstr "" + +#. top-level try +#: ../src/synchronization/syncmanager.cpp:377 +#, fuzzy, c-format +#| msgid "" +#| "Saving configuration to the GNOME keyring failed with the following " +#| "message:" +msgid "Synchronization failed with the following exception: %s" +msgstr "" +"Ukladanie nastavení do zväzku kľúčov GNOME zlyhalo s nasledujúcou správou:" + +#: ../src/synchronization/syncutils.cpp:148 +#: ../src/synchronization/syncutils.cpp:180 +msgid "Could not enable FUSE" +msgstr "Nemohlo byť zapnuté FUSE" + +#: ../src/synchronization/syncutils.cpp:149 +#: ../src/synchronization/syncutils.cpp:181 +msgid "" +"The FUSE module could not be loaded. Please check that it is installed " +"properly and try again." +msgstr "" +"FUSE modul nemohol byť nahratý. Skontrolujte, prosím, či je správne " +"nainštalovaný a skúste to znovu." + +#: ../src/synchronization/syncutils.cpp:157 +msgid "Enable FUSE?" +msgstr "Povoliť FUSE?" + +#. TODO: This message isn't entirely accurate. +#. We should fix it. +#: ../src/synchronization/syncutils.cpp:160 +msgid "" +"The synchronization you've chosen requires the FUSE module to be loaded.\n" +"\n" +"To avoid getting this prompt in the future, you should load FUSE at " +"startup. Add \"modprobe fuse\" to /etc/init.d/boot.local or \"fuse\" to /" +"etc/modules." +msgstr "" +"Synchronizácia vyžaduje, aby ste mali nahratý modul FUSE.\n" +"\n" +"Ak nechcete dostávať túto výzvu, mali by ste pri štarte nahrať FUSE. " +"Pridajte \"modprobe fuse\" do /etc/init.d/boot.local alebo \"fuse\" do /etc/" +"modules." + +#: ../src/utils.cpp:144 +msgid "" +"The \"Gnote Manual\" could not be found. Please verify that your " +"installation has been completed successfully." +msgstr "" +"\"Návod poznámok Gnote\" nemohol byť nájdený. Skontrolujte, prosím, či je " +"inštalácia dokončená úspešne." + +#: ../src/utils.cpp:152 +msgid "Help not found" +msgstr "Pomocník nebol nájdený" + +#: ../src/utils.cpp:185 +msgid "Cannot open location" +msgstr "Nemôžem otvoriť umiestnenie" + +#. TRANSLATORS: argument is time. +#: ../src/utils.cpp:215 +msgid "Today, %1%" +msgstr "Dnes, %1%" + +#: ../src/utils.cpp:216 +msgid "Today" +msgstr "Dnes" + +#. TRANSLATORS: argument is time. +#: ../src/utils.cpp:222 +msgid "Yesterday, %1%" +msgstr "Včera, %1%" + +#: ../src/utils.cpp:223 +msgid "Yesterday" +msgstr "Včera" + +#. TRANSLATORS: argument is time. +#: ../src/utils.cpp:229 +msgid "Tomorrow, %1%" +msgstr "Zajtra, %1%" + +#: ../src/utils.cpp:230 +msgid "Tomorrow" +msgstr "Zajtra" + +#. TRANSLATORS: date in current year. +#: ../src/utils.cpp:234 +msgid "%b %d" +msgstr "" + +#. TRANSLATORS: first argument is date, second is time. +#: ../src/utils.cpp:237 ../src/utils.cpp:249 +#, fuzzy +#| msgid "In %1% day, %2%" +#| msgid_plural "In %1% days, %2%" +msgid "%1%, %2%" +msgstr "O %1% dní, %2%" + +#: ../src/utils.cpp:242 +msgid "No Date" +msgstr "Žiadny dátum" + +#. TRANSLATORS: date in other than current year. +#: ../src/utils.cpp:246 +msgid "%b %d %Y" +msgstr "" + +#: ../src/watchers.cpp:200 +msgid "(Untitled %1%)" +msgstr "(Nepomenované %1%)" + +#: ../src/watchers.cpp:231 +msgid "" +"A note with the title %1% already exists. Please choose another name " +"for this note before continuing." +msgstr "" +"Poznámka s názvom %1% už existuje. Vyberte, prosím, iný názov pre " +"túto poznámku pred pokračovaním." + +#: ../src/watchers.cpp:246 +msgid "Note title taken" +msgstr "Zadaný titulok poznámky" + +#: ../src/watchers.cpp:309 +msgid "Check spelling" +msgstr "" + +#: ../src/watchers.cpp:310 +#, fuzzy +#| msgid "Use tools on this note" +msgid "Check spelling in this note" +msgstr "Použiť nástroje na tejto poznámke" + +#: ../src/watchers.cpp:674 +msgid "_Copy Link Address" +msgstr "_Kopírovať adresu odkazu" + +#: ../src/watchers.cpp:680 +msgid "_Open Link" +msgstr "_Otvoriť odkaz" + +#~ msgid "Accessories" +#~ msgstr "Príslušenstvo" + +#~ msgid "Gnote Applet Factory" +#~ msgstr "Gnote aplet továreň" + +#~ msgid "Simple and easy to use note-taking" +#~ msgstr "Jednoduché a ľahko použiteľné písanie poznámok" + +#~ msgid "Determines X coordinate of Search window; stored on Gnote exit." +#~ msgstr "" +#~ "Určuje súradnicu X okna hľadania; ukladá sa pri ukončení programu Gnote." + +#~ msgid "Determines Y coordinate of Search window; stored on Gnote exit." +#~ msgstr "" +#~ "Určuje súradnicu Y okna hľadania; ukladá sa pri ukončení programu Gnote." + +#~ msgid "Enable startup notes" +#~ msgstr "Povoliť poznámky po štarte" + +#~ msgid "" +#~ "If enabled, all notes that were open when Gnote quit will automatically " +#~ "be reopened at startup." +#~ msgstr "" +#~ "Ak je povolené, tak všetky poznámky, ktoré boli otvorené, keď bol " +#~ "ukončený Gnote, budú automaticky znovu otvorené pri spustení." + +#~ msgid "" +#~ "Indicates that the Sticky Note Importer plugin has not been run, so it " +#~ "should run automatically the next time Gnote starts." +#~ msgstr "" +#~ "Indikuje to, že doplnok Importér Sticky Notes nebeží, mal by sa spustiť " +#~ "automaticky pri ďalšom štarte Gnote." + +#~ msgid "Saved horizontal position of Search window" +#~ msgstr "Uložená vodorovná pozícia okna hľadania" + +#~ msgid "Set to TRUE to activate" +#~ msgstr "Nastaviť na TRUE pre aktiváciu" + +#~ msgid "" +#~ "The global keybinding for creating and displaying a new Note. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Globálne klávesové skratky pre tvorbu a zobrazenie novej poznámky.Formát " +#~ "vyzerá takto \"<Control>a\" alebo \"<Shift><Alt>F1\"." +#~ "Syntaktický analyzátor je značne tolerantný a povoluje veľké a malé " +#~ "písmená,a zvyčajne skratky ako \"<Ctl>\" a \"<Ctrl>\", Ak " +#~ "nastavíte možnosť na špeciálny reťazec \"disabled\", tak tu nebude žiadna " +#~ "klávesová skratka pre túto akciu." + +#~ msgid "" +#~ "The global keybinding for opening the \"Start Here\" note. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Globálne klávesové skratky pre otvorenie poznámky \"Začnite tu\".Formát " +#~ "vyzerá takto \"<Control>a\" alebo \"<Shift><Alt>F1\"." +#~ "Syntaktický analyzátor je značne tolerantný a povoluje veľké a malé " +#~ "písmená,a zvyčajne skratky ako \"<Ctl>\" a \"<Ctrl>\", Ak " +#~ "nastavíte možnosť na špeciálny reťazec \"disabled\", tak tu nebude žiadna " +#~ "klávesová skratka pre túto akciu." + +#~ msgid "" +#~ "The global keybinding for opening the Note Search dialog. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Globálne klávesové skratky pre otvorenie dialógu Hľadanie poznámok.Formát " +#~ "vyzerá takto \"<Control>a\" alebo \"<Shift><Alt>F1\"." +#~ "Syntaktický analyzátor je značne tolerantný a povoluje veľké a malé " +#~ "písmená,a zvyčajne skratky ako \"<Ctl>\" a \"<Ctrl>\", Ak " +#~ "nastavíte možnosť na špeciálny reťazec \"disabled\", tak tu nebude žiadna " +#~ "klávesová skratka pre túto akciu." + +#~ msgid "" +#~ "The global keybinding for opening the Recent Changes dialog. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Globálne klávesové skratky pre otvorenie dialógu Nedávne zmeny.Formát " +#~ "vyzerá takto \"<Control>a\" alebo \"<Shift><Alt>F1\"." +#~ "Syntaktický analyzátor je značne tolerantný a povoluje veľké a malé " +#~ "písmená,a zvyčajne skratky ako \"<Ctl>\" a \"<Ctrl>\", Ak " +#~ "nastavíte možnosť na špeciálny reťazec \"disabled\", tak tu nebude žiadna " +#~ "klávesová skratka pre túto akciu." + +#~ msgid "" +#~ "The global keybinding for showing the Gnote applet's menu. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Globálne klávesové skratky pre zobrazenie Gnote aplet ponuky.Formát " +#~ "vyzerá takto \"<Control>a\" alebo \"<Shift><Alt>F1\"." +#~ "Syntaktický analyzátor je značne tolerantný a povoluje veľké a malé " +#~ "písmená,a zvyčajne skratky ako \"<Ctl>\" a \"<Ctrl>\", Ak " +#~ "nastavíte možnosť na špeciálny reťazec \"disabled\", tak tu nebude žiadna " +#~ "klávesová skratka pre túto akciu." + +#~ msgid "The handler for \"note://\" URLs" +#~ msgstr "Manažér pre \"note://\" URL" + +#~ msgid "Description" +#~ msgstr "Popis" + +#~ msgid "_File" +#~ msgstr "_Súbor" + +#~ msgid "Open the selected note" +#~ msgstr "Otvoriť označenú poznámku" + +#~ msgid "_Edit" +#~ msgstr "_Upraviť" + +#~ msgid "S_ynchronize Notes" +#~ msgstr "S_ynchronizovať poznámky" + +#~ msgid "Start synchronizing notes" +#~ msgstr "Spustiť synchronizáciu poznámok" + +#~ msgid "Cannot create new note" +#~ msgstr "Nemôžem vytvoriť novú poznámku" + +#~ msgid "Editing" +#~ msgstr "Upravovanie" + +#~ msgid "Hotkeys" +#~ msgstr "Klávesové skratky" + +#~ msgid "Add-ins" +#~ msgstr "Doplnky" + +#~ msgid "Listen for _Hotkeys" +#~ msgstr "Po_užívať klávesové skratky" + +#~ msgid "" +#~ "Hotkeys allow you to quickly access your notes from anywhere with a " +#~ "keypress. Example Hotkeys: <Control><Shift>F11, <" +#~ "Alt>N" +#~ msgstr "" +#~ "Klávesové skratky vám umožnia rýchlo pristupovať k vašim poznámkam " +#~ "kdekoľvek stlačením klávesu. Príklad klávesových skratiek: <" +#~ "Control><Shift>F11, <Alt>N" + +#~ msgid "Show notes _menu" +#~ msgstr "Zobraziť ponuku pozná_mok" + +#~ msgid "Open \"_Start Here\"" +#~ msgstr "Otvoriť \"_Začnite tu\"" + +#~ msgid "Create _new note" +#~ msgstr "Vytvoriť _novú poznámku" + +#~ msgid "Open \"Search _All Notes\"" +#~ msgstr "Otvoriť \"_Hľadať vo všetkých poznámkach\"" + +#~ msgid "New Note %1%" +#~ msgstr "Nová poznámka %1%" + +#~ msgid "Find in This Note" +#~ msgstr "Nájsť v tejto poznámke" + +#~ msgid "_Find in This Note" +#~ msgstr "_Nájsť v tejto poznámke" + +#~ msgid "Clos_e All Notes" +#~ msgstr "Z_avrieť všetky poznámky" + +#~ msgid "Search your notes (Ctrl-Shift-F)" +#~ msgstr "Hľadať vo vašich poznámkach (Ctrl-Shift-F)" + +#~ msgid "Link selected text to a new note (Ctrl-L)" +#~ msgstr "Odkaz vybraného textu na novú poznámku (Ctrl-L)" + +#~ msgid "_Text" +#~ msgstr "_Text" + +#~ msgid "T_ools" +#~ msgstr "Nástr_oje" + +#~ msgid "_Find..." +#~ msgstr "_Nájsť..." + +#~ msgid "_Previous" +#~ msgstr "_Predchádzajúce" + +#~ msgid "_Find:" +#~ msgstr "_Nájsť:" + +#~ msgid "Font Size" +#~ msgstr "Veľkosť písma" + +#~ msgid "C_ase Sensitive" +#~ msgstr "Rozlišov_ať veľkosť písmen" + +#~ msgid "_Search:" +#~ msgstr "_Hľadať:" + +#~ msgid "Last Changed" +#~ msgstr "Naposledy zmenené" + +#~ msgid "Matches: %1% note" +#~ msgid_plural "Matches: %1% notes" +#~ msgstr[0] "Spolu: %1% poznámok" +#~ msgstr[1] "Spolu: %1% poznámka" +#~ msgstr[2] "Spolu: %1% poznámky" + +#~ msgid " (new)" +#~ msgstr " (nová)" + +#~ msgid "_About Gnote" +#~ msgstr "_O programe" + +#~ msgid "%1% day ago, %2%" +#~ msgid_plural "%1% days ago, %2%" +#~ msgstr[0] "Pred %1% dňami, %2%" +#~ msgstr[1] "Včera, %2%" +#~ msgstr[2] "Pred %1% dňami, %2%" + +#~ msgid "%1% day ago" +#~ msgid_plural "%1% days ago" +#~ msgstr[0] "Pred %1% dňami" +#~ msgstr[1] "Včera" +#~ msgstr[2] "Pred %1% dňami" + +#~ msgid "In %1% day" +#~ msgid_plural "In %1% days" +#~ msgstr[0] "O %1% dní" +#~ msgstr[1] "O %1% deň" +#~ msgstr[2] "O %1% dni" + +#~ msgid "Type the name of the notebook you'd like to create." +#~ msgstr "Napíšte názov zápisníku, ktorý by ste chceli vytvoriť." + +#~ msgid "Note_books" +#~ msgstr "Zá_pisníky" + +#~ msgid "Create a new note in this notebook" +#~ msgstr "Vytvoriť novú poznámku v tomto zápisníku" + +#~ msgid "Open this notebook's template note" +#~ msgstr "Otvoriť túto šablónu zápisníkovej poznámky" + +#~ msgid "Delete Note_book" +#~ msgstr "Odstrániť zá_pisník" + +#~ msgid "Delete the selected notebook" +#~ msgstr "Odstrániť označený zápisník" + +#~ msgid "No host name specified" +#~ msgstr "Žiadny názov hostiteľa nebol určený" + +#~ msgid "_Fixed Width" +#~ msgstr "Pev_ná šírka" + +#~ msgid "Quit Tomboy" +#~ msgstr "Ukončiť Tomboy" + +#~ msgid "Tomboy Preferences" +#~ msgstr "Predvoľby Tomboy" + +#~ msgid "Tomboy Help" +#~ msgstr "Pomocník Tomboy" + +#~ msgid "Access denied." +#~ msgstr "Prístup odmietnutý." + +#~ msgid "Folder does not exist." +#~ msgstr "Priečinok neexistuje." + +#~ msgid "Cannot open email" +#~ msgstr "Nemôžem otvoriť e-mail" + +#~ msgid "_Browse..." +#~ msgstr "_Prehliadať..." + +#~ msgid "Cannot contact '{0}'" +#~ msgstr "Nepodarilo sa spojiť s '{0}'" + +#~ msgid "Error running gaim-remote: {0}" +#~ msgstr "Chyba spusteného programu gaim-remote: {0}" + +#~ msgid "dddd, MMMM d, h:mm tt" +#~ msgstr "h:mm tt, dddd, d. MMMM" + +#~ msgid "dddd, MMMM d yyyy" +#~ msgstr "dddd, d. MMMM yyyy" + +#~ msgid "dddd MM/dd/yyyy, hh:mm:ss tt" +#~ msgstr "hh:mm:ss tt, dddd dd/MM/yyyy" + +#~ msgid "Add a sketch" +#~ msgstr "Pridať náčrt" + +#~ msgid "Se_rver:" +#~ msgstr "Se_rver:" + +#~ msgid "_Folder Path (optional):" +#~ msgstr "Ces_ta k priečinku (nepovinné):" + +#~ msgid "" +#~ "SSH synchronization requires an existing SSH key for this server and " +#~ "user, added to a running SSH daemon." +#~ msgstr "" +#~ "SSH synchronizácia vyžaduje existujúci SSH kľúč pre tento server a " +#~ "používateľa, pridané do bežiaceho SSH daemon." + +#~ msgid "Server or username field is empty." +#~ msgstr "Pole servera alebo používateľského mena je prázdne." + +#~ msgid "SSH (sshfs FUSE)" +#~ msgstr "SSH (sshfs FUSE)" + +#~ msgid "" +#~ "Timeout connecting to server. Please ensure that your SSH key has been " +#~ "added to a running SSH daemon." +#~ msgstr "" +#~ "Vypršal časový limit pre pripojenie k serveru. Zaistite, prosím, aby bol " +#~ "váš SSH kľúč pridaný do bežiaceho SSH daemon." + +#~ msgid "Tasque" +#~ msgstr "Tasque" + +#~ msgid "--- Tasque is not running ---" +#~ msgstr "--- Tasque nie je spustený ---" + +#~ msgid "WebDAV (wdfs FUSE)" +#~ msgstr "WebDAV (wdfs FUSE)" + +#~ msgid "Really delete this {0} note?" +#~ msgid_plural "Really delete these {0} notes?" +#~ msgstr[0] "Skutočne odstrániť tieto {0} poznámky?" +#~ msgstr[1] "Skutočne odstrániť túto {0} poznámku?" +#~ msgstr[2] "Skutočne odstrániť tieto {0} poznámky?" + +#~ msgid "New Note {0}" +#~ msgstr "Nová poznámka {0}" + +#~ msgid "_Bold" +#~ msgstr "_Tučné" + +#~ msgid "{0} Preferences" +#~ msgstr "{0} Nastavenia" + +#~ msgid "Success! You're connected!" +#~ msgstr "Úspech! Ste pripojený!" + +#~ msgid "" +#~ "Sorry, but something went wrong. Please check your information and try " +#~ "again. The ~/.tomboy.log might be useful too." +#~ msgstr "" +#~ "Prepáčte, ale niečo bolo nesprávne. Skotrolujte, prosím, vaše informácie " +#~ "a skúste to znovu. Nápomocný by mohol byť tiež ~/.tomboy.log ." + +#~ msgid "Add-in Dependencies:" +#~ msgstr "Doplnok závisí od:" + +#~ msgid "Copyright © 2004-2007 Alex Graveley" +#~ msgstr "Autorské práva © 2004-2007 Alex Graveley" + +#~ msgid "" +#~ "Tomboy: A simple, easy to use desktop note-taking application.\n" +#~ "Copyright (C) 2004-2006 Alex Graveley \n" +#~ "\n" +#~ msgstr "" +#~ "Tomboy: Jednoduchá, ľahko používateľná aplikácia na prácu s poznámkami.\n" +#~ "Autorské práva (C) 2004-2006 Alex Graveley \n" +#~ "\n" + +#~ msgid "" +#~ "Usage:\n" +#~ " --version\t\t\tPrint version information.\n" +#~ " --help\t\t\tPrint this usage message.\n" +#~ " --note-path [path]\t\tLoad/store note data in this directory.\n" +#~ " --search [text]\t\tOpen the search all notes window with the search " +#~ "text.\n" +#~ msgstr "" +#~ "Použitie:\n" +#~ " --version\t\t\tZobrazí informácie o verzii.\n" +#~ " --help\t\t\tZobrazí túto správu o používaní.\n" +#~ " --note-path [cesta k priečinku]\t\tNahrať/uskladniť údaje poznámok v " +#~ "tomto priečinku.\n" +#~ " --search [text]\t\tOtvoriť okno hľadania vo všetkých poznámkach s " +#~ "textom na hľadanie.\n" + +#~ msgid "" +#~ " --new-note\t\t\tCreate and display a new note.\n" +#~ " --new-note [title]\t\tCreate and display a new note, with a title.\n" +#~ " --open-note [title/url]\tDisplay the existing note matching title.\n" +#~ " --start-here\t\t\tDisplay the 'Start Here' note.\n" +#~ " --highlight-search [text]\tSearch and highlight text in the opened " +#~ "note.\n" +#~ msgstr "" +#~ " --new-note\t\t\tVytvoriť a zobraziť novú poznámku.\n" +#~ " --new-note [názov]\t\tVytvoriť a zobraziť novú poznámku s názvom.\n" +#~ " --open-note [názov/url]\tZobraziť existujúcu poznámku zodpovedajúcu " +#~ "názvu.\n" +#~ " --start-here\t\t\tZobraziť poznámku 'Začnite tu'.\n" +#~ " --highlight-search [text]\tHľadať a zvýrazniť text v otvorenej " +#~ "poznámke.\n" + +#~ msgid "D-BUS remote control disabled.\n" +#~ msgstr "Zakázané vzdialené ovládanie D-BUS.\n" + +#~ msgid "Version {0}" +#~ msgstr "Verzia {0}" + +#~ msgid "" +#~ "Tomboy: unsupported option '{0}'\n" +#~ "Try 'tomboy --help' for more information.\n" +#~ "D-BUS remote control disabled." +#~ msgstr "" +#~ "Tomboy: nepodporovaná voľba '{0}'\n" +#~ "Skúste 'tomboy --help' pre viac informácií.\n" +#~ "Zakázané vzdialené ovládanie D-BUS." + +#~ msgid "_About Tomboy" +#~ msgstr "_O Tomboy" + +#~ msgid "Today, {0}" +#~ msgstr "Dnes, {0}" + +#~ msgid "MMMM d, h:mm tt" +#~ msgstr "d. MMMM, h:mm tt" + +#~ msgid "MMMM d" +#~ msgstr "d. MMMM" + +#~ msgid "MMMM d yyyy, h:mm tt" +#~ msgstr "d. MMMM yyyy, h:mm tt" + +#~ msgid "MMMM d yyyy" +#~ msgstr "d. MMMM yyyy" + +#~ msgid "Really delete these notes?" +#~ msgstr "Naozaj odstrániť tieto poznámky?" + +#~ msgid "Preparing pages..." +#~ msgstr "Pripravujú sa stránky..." + +#~ msgid "Rendering page %d of %d..." +#~ msgstr "Vykresľuje sa stránka %d z %d" + +#~ msgid "Printing page %d of %d..." +#~ msgstr "Tlačí sa stránka %d z %d..." + +#~ msgid "Print preview" +#~ msgstr "Náhľad pred tlačou" + +#~ msgid "%A %x, %X" +#~ msgstr "%A %x, %X" + +#~ msgid "Configuration" +#~ msgstr "Konfigurácia" + +#~ msgid "Configuration options for the print job" +#~ msgstr "Voľby nastavení pre tlačovú úlohu" + +#~ msgid "Source Buffer" +#~ msgstr "Zdrojový zásobník" + +#~ msgid "GtkTextBuffer object to print" +#~ msgstr "GtkTextBuffer objekt k tlačeniu" + +#~ msgid "Tabs Width" +#~ msgstr "Šírka kariet" + +#~ msgid "Width in equivalent space characters of tabs" +#~ msgstr "Rovnaká šírka medzier medzi znakmi oddelenými tabulátormi" + +#~ msgid "Wrap Mode" +#~ msgstr "Zalamovací režim" + +#~ msgid "Word wrapping mode" +#~ msgstr "Mód zalamovania slov" + +#~ msgid "Highlight" +#~ msgstr "Zvýraznenie" + +#~ msgid "Whether to print the document with highlighted syntax" +#~ msgstr "Či tlačiť dokument so zvýraznenou syntaxou" + +#~ msgid "Font" +#~ msgstr "Písmo" + +#~ msgid "GnomeFont name to use for the document text (deprecated)" +#~ msgstr "Názov GnomeFont použiť pre text dokumentu (nedoporučované)" + +#~ msgid "Font to use for the document text (e.g. \"Monospace 10\")" +#~ msgstr "Použiť písmo na text dokumentu (napríklad \"Monospace 10\")" + +#~ msgid "Numbers Font" +#~ msgstr "Počet písiem" + +#~ msgid "GnomeFont name to use for the line numbers (deprecated)" +#~ msgstr "Názov GnomeFont použitého pre čísla riadkov (zastaralé)" + +#~ msgid "Font description to use for the line numbers" +#~ msgstr "Druh písma použiť pre čísla riadkov" + +#~ msgid "Print Line Numbers" +#~ msgstr "Tlačiť čísla riadkov" + +#~ msgid "Interval of printed line numbers (0 means no numbers)" +#~ msgstr "Rozpätie tlačených číslovaných riadkov (0 - žiadne čísla)" + +#~ msgid "Print Header" +#~ msgstr "Tlačiť záhlavie" + +#~ msgid "Whether to print a header in each page" +#~ msgstr "Či tlačiť záhlavie na každej strane" + +#~ msgid "Whether to print a footer in each page" +#~ msgstr "Či tlačiť zápätie na každej strane" + +#~ msgid "Header and Footer Font" +#~ msgstr "Písmo záhlavia a zápätia" + +#~ msgid "GnomeFont name to use for the header and footer (deprecated)" +#~ msgstr "Názov GnomeFont použitého pre záhlavie a zápätie (zastaralé)" + +#~ msgid "Header and Footer Font Description" +#~ msgstr "Druh písma záhlavia a zápätia" + +#~ msgid "Font to use for headers and footers (e.g. \"Monospace 10\")" +#~ msgstr "Písmo použiť pre záhlavie a zápätie (napr. \"Monospace 10\")" + +#~ msgid "Add-in" +#~ msgstr "Doplnok" + +#~ msgid "Other" +#~ msgstr "Ostatné" diff -Nru gnote-3.14.2/po/sr@latin.po gnote-3.16.0/po/sr@latin.po --- gnote-3.14.2/po/sr@latin.po 2015-01-17 12:53:24.000000000 +0000 +++ gnote-3.16.0/po/sr@latin.po 2015-03-07 18:13:28.000000000 +0000 @@ -5,11 +5,11 @@ # Miroslav Nikolić , 2012—2014. msgid "" msgstr "" -"Project-Id-Version: HEAD\n" +"Project-Id-Version: gnote\n" "Report-Msgid-Bugs-To: http://bugzilla.gnome.org/enter_bug.cgi?product=gnote&k" "eywords=I18N+L10N&component=general\n" -"POT-Creation-Date: 2014-12-25 09:19+0000\n" -"PO-Revision-Date: 2014-12-25 13:14+0200\n" +"POT-Creation-Date: 2014-12-27 09:20+0000\n" +"PO-Revision-Date: 2014-12-27 15:26+0200\n" "Last-Translator: Miroslav Nikolić \n" "Language-Team: Serbian \n" "Language: sr\n" @@ -361,16 +361,15 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:53 msgid "Save note window size and autosize note window to it" msgstr "" -"Čuva veličinu prozora beleške i samostalno podešava veličinu prozora beleške " -"na nju" +"Čuva veličinu prozora beleške i sam postavlja veličinu prozora beleške na nju" #: ../data/org.gnome.gnote.gschema.xml.in.h:54 msgid "" "Saves note window size and automatically resizes main window to this size, " "when note is opened." msgstr "" -"Čuva veličinu prozora beleške i samostalno menja veličinu glavnog prozora na " -"ovu veličinu, prilikom otvaranja beleške." +"Čuva veličinu prozora beleške i sam menja veličinu glavnog prozora na ovu " +"veličinu, kada se otvori beleška." #: ../data/org.gnome.gnote.gschema.xml.in.h:55 msgid "Show applet menu" @@ -1383,23 +1382,23 @@ msgid "Exception thrown when creating note: %s" msgstr "Došlo je do izuzetka pri stvaranju beleške: %s" -#: ../src/gnote.cpp:200 +#: ../src/gnote.cpp:202 msgid "Gnote is already running. Exiting..." msgstr "Gnomov beležnik je već pokrenut. Izlazim..." -#: ../src/gnote.cpp:365 +#: ../src/gnote.cpp:367 msgid "and Tomboy original authors." msgstr "i izvorni autori Tomičinih beleški." -#: ../src/gnote.cpp:371 +#: ../src/gnote.cpp:373 msgid "translator-credits" msgstr "" "Miloš Popović \n" -"Miroslav Nikolić \n" +"Miroslav Nikolić\n" "\n" "http://prevod.org — prevod na srpski jezik." -#: ../src/gnote.cpp:380 +#: ../src/gnote.cpp:382 msgid "" "Copyright © 2010-2014 Aurimas Cernius\n" "Copyright © 2009-2011 Debarshi Ray\n" @@ -1411,79 +1410,79 @@ "Autorska prava © 2009 Iber Figjer\n" "Autorska prava © 2004-2009 prvobitni autori Tomičinih beleški." -#: ../src/gnote.cpp:384 +#: ../src/gnote.cpp:386 msgid "A simple and easy to use desktop note-taking application." msgstr "Jednostavan i zgodan programčić za hvatanje beleški." -#: ../src/gnote.cpp:395 +#: ../src/gnote.cpp:397 msgid "Homepage" msgstr "Veb stranica" -#: ../src/gnote.cpp:570 +#: ../src/gnote.cpp:572 msgid "Run Gnote in background." msgstr "Pokreće Gnomovog beležnika u pozadini." -#: ../src/gnote.cpp:571 +#: ../src/gnote.cpp:573 msgid "Run Gnote as GNOME Shell search provider." -msgstr "Pokreće Gnomovog beležnika kao dostavljača pretrage Gnomove školjke." +msgstr "Pokreće Gnomovog beležnika kao dostavnika pretrage Gnomove školjke." -#: ../src/gnote.cpp:572 +#: ../src/gnote.cpp:574 msgid "Specify the path of the directory containing the notes." msgstr "Navodi putanju direktorijuma koji sadrži beleške." -#: ../src/gnote.cpp:572 +#: ../src/gnote.cpp:574 msgid "path" msgstr "putanja" -#: ../src/gnote.cpp:573 +#: ../src/gnote.cpp:575 msgid "Open the search all notes window with the search text." msgstr "Otvara prozor za pretraživanje svih beleški uz tekst pretrage." -#: ../src/gnote.cpp:573 ../src/gnote.cpp:578 +#: ../src/gnote.cpp:575 ../src/gnote.cpp:580 msgid "text" msgstr "tekst" -#: ../src/gnote.cpp:574 +#: ../src/gnote.cpp:576 msgid "Print version information." msgstr "Ispisuje podatke o izdanju." -#: ../src/gnote.cpp:575 +#: ../src/gnote.cpp:577 msgid "Create and display a new note, with a optional title." msgstr "Pravi i prikazuje novu belešku, sa opcionalnim naslovom." -#: ../src/gnote.cpp:575 +#: ../src/gnote.cpp:577 msgid "title" msgstr "naslov" -#: ../src/gnote.cpp:576 +#: ../src/gnote.cpp:578 msgid "Display the existing note matching title." msgstr "Prikazuje postojeću belešku koja odgovara naslovu." -#: ../src/gnote.cpp:576 +#: ../src/gnote.cpp:578 msgid "title/url" msgstr "naslov/adresa" -#: ../src/gnote.cpp:577 +#: ../src/gnote.cpp:579 msgid "Display the 'Start Here' note." msgstr "Prikazuje belešku „Polazna stanica“." -#: ../src/gnote.cpp:578 +#: ../src/gnote.cpp:580 msgid "Search and highlight text in the opened note." msgstr "Traži i ističe tekst u otvorenoj beleški." -#: ../src/gnote.cpp:582 +#: ../src/gnote.cpp:584 msgid "A note taking application" msgstr "Program za beleške" -#: ../src/gnote.cpp:582 +#: ../src/gnote.cpp:584 msgid "Gnote options at launch" msgstr "Opcije Gnomovog beležnika pri pokretanju" -#: ../src/gnote.cpp:659 +#: ../src/gnote.cpp:661 msgid "Could not connect to remote instance." msgstr "Ne mogu da se povežem na udaljeni primerak." -#: ../src/gnote.cpp:775 +#: ../src/gnote.cpp:777 msgid "Version %1%" msgstr "Izdanje %1%" @@ -1829,11 +1828,11 @@ #: ../src/notewindow.cpp:421 msgid "Is Important" -msgstr "Važno je" +msgstr "Važno" #: ../src/notewindow.cpp:422 msgid "Toggle notes presence in Important Notes notebook" -msgstr "Prebacite prisustvo beleški u beležnici važnih beleški" +msgstr "Prebacuje prisustvo beleški u beležnici važnih beležaka" #: ../src/notewindow.cpp:430 ../src/searchnoteswidget.cpp:144 #: ../src/searchnoteswidget.cpp:147 @@ -1874,7 +1873,7 @@ #: ../src/notewindow.cpp:827 msgid "_Link" -msgstr "_Poveži" +msgstr "_Uveži" #: ../src/notewindow.cpp:828 msgid "_Bold" @@ -2027,8 +2026,8 @@ "Enable this option to create links for URLs. Clicking will open URL with " "appropriate program." msgstr "" -"Uključite ovu opciju napravite veze za adrese. Klik će otvoriti adresu " -"odgovarajućim programom." +"Uključite ovu opciju da napravite vezu za adrese. Pritisak će otvoriti tu " +"adresu odgovarajućim programom." #. WikiWords... #: ../src/preferencesdialog.cpp:410 @@ -2646,7 +2645,7 @@ #: ../src/synchronization/syncmanager.cpp:575 #, c-format msgid "Report a bug. Cast failed: %s" -msgstr "Prijavite grešku. Izlivanje nije uspelo: %s" +msgstr "Prijavite grešku. Izlivak nije uspeo: %s" #: ../src/synchronization/syncmanager.cpp:148 #, c-format diff -Nru gnote-3.14.2/po/sr.po gnote-3.16.0/po/sr.po --- gnote-3.14.2/po/sr.po 2015-01-17 12:53:24.000000000 +0000 +++ gnote-3.16.0/po/sr.po 2015-03-07 18:13:28.000000000 +0000 @@ -5,11 +5,11 @@ # Мирослав Николић , 2012—2014. msgid "" msgstr "" -"Project-Id-Version: HEAD\n" +"Project-Id-Version: gnote\n" "Report-Msgid-Bugs-To: http://bugzilla.gnome.org/enter_bug.cgi?product=gnote&k" "eywords=I18N+L10N&component=general\n" -"POT-Creation-Date: 2014-12-25 09:19+0000\n" -"PO-Revision-Date: 2014-12-25 13:14+0200\n" +"POT-Creation-Date: 2014-12-27 09:20+0000\n" +"PO-Revision-Date: 2014-12-27 15:26+0200\n" "Last-Translator: Мирослав Николић \n" "Language-Team: Serbian \n" "Language: sr\n" @@ -361,16 +361,15 @@ #: ../data/org.gnome.gnote.gschema.xml.in.h:53 msgid "Save note window size and autosize note window to it" msgstr "" -"Чува величину прозора белешке и самостално подешава величину прозора белешке " -"на њу" +"Чува величину прозора белешке и сам поставља величину прозора белешке на њу" #: ../data/org.gnome.gnote.gschema.xml.in.h:54 msgid "" "Saves note window size and automatically resizes main window to this size, " "when note is opened." msgstr "" -"Чува величину прозора белешке и самостално мења величину главног прозора на " -"ову величину, приликом отварања белешке." +"Чува величину прозора белешке и сам мења величину главног прозора на ову " +"величину, када се отвори белешка." #: ../data/org.gnome.gnote.gschema.xml.in.h:55 msgid "Show applet menu" @@ -1383,23 +1382,23 @@ msgid "Exception thrown when creating note: %s" msgstr "Дошло је до изузетка при стварању белешке: %s" -#: ../src/gnote.cpp:200 +#: ../src/gnote.cpp:202 msgid "Gnote is already running. Exiting..." msgstr "Гномов бележник је већ покренут. Излазим..." -#: ../src/gnote.cpp:365 +#: ../src/gnote.cpp:367 msgid "and Tomboy original authors." msgstr "и изворни аутори Томичиних белешки." -#: ../src/gnote.cpp:371 +#: ../src/gnote.cpp:373 msgid "translator-credits" msgstr "" "Милош Поповић \n" -"Мирослав Николић \n" +"Мирослав Николић\n" "\n" "http://prevod.org — превод на српски језик." -#: ../src/gnote.cpp:380 +#: ../src/gnote.cpp:382 msgid "" "Copyright © 2010-2014 Aurimas Cernius\n" "Copyright © 2009-2011 Debarshi Ray\n" @@ -1411,79 +1410,79 @@ "Ауторска права © 2009 Ибер Фигјер\n" "Ауторска права © 2004-2009 првобитни аутори Томичиних белешки." -#: ../src/gnote.cpp:384 +#: ../src/gnote.cpp:386 msgid "A simple and easy to use desktop note-taking application." msgstr "Једноставан и згодан програмчић за хватање белешки." -#: ../src/gnote.cpp:395 +#: ../src/gnote.cpp:397 msgid "Homepage" msgstr "Веб страница" -#: ../src/gnote.cpp:570 +#: ../src/gnote.cpp:572 msgid "Run Gnote in background." msgstr "Покреће Гномовог бележника у позадини." -#: ../src/gnote.cpp:571 +#: ../src/gnote.cpp:573 msgid "Run Gnote as GNOME Shell search provider." -msgstr "Покреће Гномовог бележника као достављача претраге Гномове шкољке." +msgstr "Покреће Гномовог бележника као доставника претраге Гномове шкољке." -#: ../src/gnote.cpp:572 +#: ../src/gnote.cpp:574 msgid "Specify the path of the directory containing the notes." msgstr "Наводи путању директоријума који садржи белешке." -#: ../src/gnote.cpp:572 +#: ../src/gnote.cpp:574 msgid "path" msgstr "путања" -#: ../src/gnote.cpp:573 +#: ../src/gnote.cpp:575 msgid "Open the search all notes window with the search text." msgstr "Отвара прозор за претраживање свих белешки уз текст претраге." -#: ../src/gnote.cpp:573 ../src/gnote.cpp:578 +#: ../src/gnote.cpp:575 ../src/gnote.cpp:580 msgid "text" msgstr "текст" -#: ../src/gnote.cpp:574 +#: ../src/gnote.cpp:576 msgid "Print version information." msgstr "Исписује податке о издању." -#: ../src/gnote.cpp:575 +#: ../src/gnote.cpp:577 msgid "Create and display a new note, with a optional title." msgstr "Прави и приказује нову белешку, са опционалним насловом." -#: ../src/gnote.cpp:575 +#: ../src/gnote.cpp:577 msgid "title" msgstr "наслов" -#: ../src/gnote.cpp:576 +#: ../src/gnote.cpp:578 msgid "Display the existing note matching title." msgstr "Приказује постојећу белешку која одговара наслову." -#: ../src/gnote.cpp:576 +#: ../src/gnote.cpp:578 msgid "title/url" msgstr "наслов/адреса" -#: ../src/gnote.cpp:577 +#: ../src/gnote.cpp:579 msgid "Display the 'Start Here' note." msgstr "Приказује белешку „Полазна станица“." -#: ../src/gnote.cpp:578 +#: ../src/gnote.cpp:580 msgid "Search and highlight text in the opened note." msgstr "Тражи и истиче текст у отвореној белешки." -#: ../src/gnote.cpp:582 +#: ../src/gnote.cpp:584 msgid "A note taking application" msgstr "Програм за белешке" -#: ../src/gnote.cpp:582 +#: ../src/gnote.cpp:584 msgid "Gnote options at launch" msgstr "Опције Гномовог бележника при покретању" -#: ../src/gnote.cpp:659 +#: ../src/gnote.cpp:661 msgid "Could not connect to remote instance." msgstr "Не могу да се повежем на удаљени примерак." -#: ../src/gnote.cpp:775 +#: ../src/gnote.cpp:777 msgid "Version %1%" msgstr "Издање %1%" @@ -1829,11 +1828,11 @@ #: ../src/notewindow.cpp:421 msgid "Is Important" -msgstr "Важно је" +msgstr "Важно" #: ../src/notewindow.cpp:422 msgid "Toggle notes presence in Important Notes notebook" -msgstr "Пребаците присуство белешки у бележници важних белешки" +msgstr "Пребацује присуство белешки у бележници важних бележака" #: ../src/notewindow.cpp:430 ../src/searchnoteswidget.cpp:144 #: ../src/searchnoteswidget.cpp:147 @@ -1874,7 +1873,7 @@ #: ../src/notewindow.cpp:827 msgid "_Link" -msgstr "_Повежи" +msgstr "_Увежи" #: ../src/notewindow.cpp:828 msgid "_Bold" @@ -2027,8 +2026,8 @@ "Enable this option to create links for URLs. Clicking will open URL with " "appropriate program." msgstr "" -"Укључите ову опцију направите везе за адресе. Клик ће отворити адресу " -"одговарајућим програмом." +"Укључите ову опцију да направите везу за адресе. Притисак ће отворити ту " +"адресу одговарајућим програмом." #. WikiWords... #: ../src/preferencesdialog.cpp:410 @@ -2646,7 +2645,7 @@ #: ../src/synchronization/syncmanager.cpp:575 #, c-format msgid "Report a bug. Cast failed: %s" -msgstr "Пријавите грешку. Изливање није успело: %s" +msgstr "Пријавите грешку. Изливак није успео: %s" #: ../src/synchronization/syncmanager.cpp:148 #, c-format diff -Nru gnote-3.14.2/po/sv.po gnote-3.16.0/po/sv.po --- gnote-3.14.2/po/sv.po 2012-09-26 20:25:11.000000000 +0000 +++ gnote-3.16.0/po/sv.po 2015-03-26 20:50:43.000000000 +0000 @@ -7,8 +7,9 @@ msgid "" msgstr "" "Project-Id-Version: gnote\n" -"Report-Msgid-Bugs-To: \n" -"POT-Creation-Date: 2012-03-20 09:06+0100\n" +"Report-Msgid-Bugs-To: http://bugzilla.gnome.org/enter_bug.cgi?" +"product=gnote&keywords=I18N+L10N&component=general\n" +"POT-Creation-Date: 2015-01-18 22:13+0000\n" "PO-Revision-Date: 2012-03-20 09:12+0100\n" "Last-Translator: Daniel Nylander \n" "Language-Team: Swedish \n" @@ -18,7 +19,21 @@ "Content-Transfer-Encoding: 8bit\n" "Plural-Forms: nplurals=2; plural=(n != 1);\n" -#: ../data/gnote.desktop.in.in.h:1 +#: ../data/appdata/gnote.appdata.xml.in.h:1 +msgid "" +"Gnote is a simple note-taking application for GNOME desktop environment. It " +"allows you to capture your ideas, link them together using WikiWiki-style " +"links, group together in notebooks and some extra features for everyday use." +msgstr "" + +#: ../data/appdata/gnote.appdata.xml.in.h:2 +msgid "" +"Gnote also supports synchronization to make it possible to use on multiple " +"devices." +msgstr "" + +#: ../data/gnote.desktop.in.in.h:1 ../src/recentchanges.cpp:45 +#: ../src/recentchanges.cpp:479 msgid "Gnote" msgstr "Gnote" @@ -30,509 +45,767 @@ msgid "Note-taker" msgstr "Anteckningsverktyg" +#: ../data/gnote.desktop.in.in.h:4 +msgid "notes;idea;link;organize;" +msgstr "" + #: ../data/org.gnome.gnote.gschema.xml.in.h:1 msgid "Enable spellchecking" msgstr "Aktivera stavningskontroll" #: ../data/org.gnome.gnote.gschema.xml.in.h:2 -msgid "If true, misspellings will be underlined in red, and correct spelling suggestions shown in the right-click menu." -msgstr "Om sant, så kommer felstavningar att understrykas med rött och förslag på korrekta stavningar visas i högerklicksmenyn." +msgid "" +"If true, misspellings will be underlined in red, and correct spelling " +"suggestions shown in the right-click menu." +msgstr "" +"Om sant, så kommer felstavningar att understrykas med rött och förslag på " +"korrekta stavningar visas i högerklicksmenyn." #: ../data/org.gnome.gnote.gschema.xml.in.h:3 -msgid "Enable WikiWord highlighting" -msgstr "Aktivera WikiOrd-färgmarkering" +msgid "Automatically create links when typing" +msgstr "" #: ../data/org.gnome.gnote.gschema.xml.in.h:4 -msgid "Enable this option to highlight words ThatLookLikeThis. Clicking the word will create a note with that name." -msgstr "Aktivera detta alternativ för att färgmarkera ord som SerUtSomDetta. Att klicka på ett sådant ord kommer att skapa en anteckning med det namnet." +msgid "" +"Enable this option to automatically create a link, when text matches note " +"title." +msgstr "" #: ../data/org.gnome.gnote.gschema.xml.in.h:5 -msgid "Enable Auto bulleted lists" -msgstr "Aktivera automatiska punktlistor" +#, fuzzy +#| msgid "Update links in referencing notes" +msgid "Create links for URLs in notes" +msgstr "Uppdatera länkar i refererande anteckningar" #: ../data/org.gnome.gnote.gschema.xml.in.h:6 -msgid "Enable this option if you want bulleted lists to be automatic when you place - or * at the beginning of a line." -msgstr "Aktivera detta alternativ om du vill att punktlistor ska vara automatiska när du placerar ett - eller * i början av en rad." +msgid "Enable this option to create links for URLs in notes." +msgstr "" #: ../data/org.gnome.gnote.gschema.xml.in.h:7 -msgid "Enable Middle-Click Paste On Icon" -msgstr "Aktivera inklistring vid mittenklick på ikon" +msgid "Enable WikiWord highlighting" +msgstr "Aktivera WikiOrd-färgmarkering" #: ../data/org.gnome.gnote.gschema.xml.in.h:8 -msgid "Enable this option if you want to be able to middle-click the Gnote icon to paste timestamped content into the Start Here note." -msgstr "Aktivera detta alternativ om du vill kunna klistra in tidsstämplat innehåll i Börja här-anteckningen genom att mittenklicka på Gnote-ikonen." +msgid "" +"Enable this option to highlight words ThatLookLikeThis. Clicking the word " +"will create a note with that name." +msgstr "" +"Aktivera detta alternativ för att färgmarkera ord som SerUtSomDetta. Att " +"klicka på ett sådant ord kommer att skapa en anteckning med det namnet." #: ../data/org.gnome.gnote.gschema.xml.in.h:9 -msgid "Enable custom font" -msgstr "Aktivera anpassat typsnitt" +msgid "Enable Auto bulleted lists" +msgstr "Aktivera automatiska punktlistor" #: ../data/org.gnome.gnote.gschema.xml.in.h:10 -msgid "If true, the font name set in custom-font-face will be used as the font when displaying notes. Otherwise the desktop default font will be used." -msgstr "Om sant, så kommer typsnittet satt i custom-font-face att användas för att visa anteckningar. Annars så kommer skrivbordets standardtypsnitt att användas." +msgid "" +"Enable this option if you want bulleted lists to be automatic when you place " +"- or * at the beginning of a line." +msgstr "" +"Aktivera detta alternativ om du vill att punktlistor ska vara automatiska " +"när du placerar ett - eller * i början av en rad." #: ../data/org.gnome.gnote.gschema.xml.in.h:11 -msgid "Custom Font Face" -msgstr "Anpassat typsnitt" +msgid "Enable Middle-Click Paste On Icon" +msgstr "Aktivera inklistring vid mittenklick på ikon" #: ../data/org.gnome.gnote.gschema.xml.in.h:12 -msgid "If enable-custom-font is true, the font name set here will be used as the font when displaying notes." -msgstr "Om enable-custom-font är sant så kommer typsnittets namn som ställts in här att användas för att visa anteckningar." +msgid "" +"Enable this option if you want to be able to middle-click the Gnote icon to " +"paste timestamped content into the Start Here note." +msgstr "" +"Aktivera detta alternativ om du vill kunna klistra in tidsstämplat innehåll " +"i Börja här-anteckningen genom att mittenklicka på Gnote-ikonen." #: ../data/org.gnome.gnote.gschema.xml.in.h:13 -msgid "Enable global keybindings" -msgstr "Aktivera globala tangentmappningar" +msgid "Enable custom font" +msgstr "Aktivera anpassat typsnitt" #: ../data/org.gnome.gnote.gschema.xml.in.h:14 -msgid "If true, the desktop-global keybindings set in /org/gnome/gnote/global-keybindings will be enabled, allowing for useful Gnote actions to be available from any application." -msgstr "Om sant, så kommer de allmänna tangentbordsgenvägarna inställda i /org/gnome/gnote/global-keybindings att aktiveras, och tillåta Gnote-åtgärder från vilket program som helst." +msgid "" +"If true, the font name set in custom-font-face will be used as the font when " +"displaying notes. Otherwise the desktop default font will be used." +msgstr "" +"Om sant, så kommer typsnittet satt i custom-font-face att användas för att " +"visa anteckningar. Annars så kommer skrivbordets standardtypsnitt att " +"användas." #: ../data/org.gnome.gnote.gschema.xml.in.h:15 -msgid "Start Here Note" -msgstr "\"Börja här\"-anteckning" +msgid "Custom Font Face" +msgstr "Anpassat typsnitt" #: ../data/org.gnome.gnote.gschema.xml.in.h:16 -msgid "The note URI of the note that should be considered the \"Start Here\" note, which is always placed at the bottom of the Gnote note menu and also accessible by hotkey." -msgstr "Antecknings-uri:n för anteckningen som ska anses vara \"Börja här\"-anteckningen, vilken alltid placeras i nederkant av Gnote-anteckningsmenyn och även är åtkomlig med en snabbtangent." +msgid "" +"If enable-custom-font is true, the font name set here will be used as the " +"font when displaying notes." +msgstr "" +"Om enable-custom-font är sant så kommer typsnittets namn som ställts in här " +"att användas för att visa anteckningar." #: ../data/org.gnome.gnote.gschema.xml.in.h:17 -msgid "Minimum number of notes to show in menu" -msgstr "Minimal antal anteckningar att visa i menyn" +msgid "Enable global keybindings" +msgstr "Aktivera globala tangentmappningar" #: ../data/org.gnome.gnote.gschema.xml.in.h:18 -msgid "Integer determining the minimum number of notes to show in the Gnote note menu." -msgstr "Heltal som bestämmer minimalt antal anteckningar att visa i Gnotes anteckningsmeny." +msgid "" +"If true, the desktop-global keybindings set in /org/gnome/gnote/global-" +"keybindings will be enabled, allowing for useful Gnote actions to be " +"available from any application." +msgstr "" +"Om sant, så kommer de allmänna tangentbordsgenvägarna inställda i /org/gnome/" +"gnote/global-keybindings att aktiveras, och tillåta Gnote-åtgärder från " +"vilket program som helst." #: ../data/org.gnome.gnote.gschema.xml.in.h:19 -msgid "List of pinned notes" -msgstr "Lista över nålade anteckningar" +msgid "Start Here Note" +msgstr "\"Börja här\"-anteckning" #: ../data/org.gnome.gnote.gschema.xml.in.h:20 -msgid "Whitespace-separated list of note URIs for notes that should always appear in the Gnote note menu." -msgstr "Blankstegsseparerad lista över URI:er för anteckningar som alltid ska visas i Gnotes anteckningsmeny." +msgid "" +"The note URI of the note that should be considered the \"Start Here\" note, " +"which is always placed at the bottom of the Gnote note menu and also " +"accessible by hotkey." +msgstr "" +"Antecknings-uri:n för anteckningen som ska anses vara \"Börja här\"-" +"anteckningen, vilken alltid placeras i nederkant av Gnote-anteckningsmenyn " +"och även är åtkomlig med en snabbtangent." #: ../data/org.gnome.gnote.gschema.xml.in.h:21 -msgid "Enable startup notes" -msgstr "Aktivera anteckningar vid uppstart" +msgid "Minimum number of notes to show in menu" +msgstr "Minimal antal anteckningar att visa i menyn" #: ../data/org.gnome.gnote.gschema.xml.in.h:22 -msgid "If enabled, all notes that were open when Gnote quit will automatically be reopened at startup." -msgstr "Om aktiverad kommer alla anteckningar som var öppnade när Gnote avslutades att öppnas igen vid nästa uppstart." +msgid "" +"Integer determining the minimum number of notes to show in the Gnote note " +"menu." +msgstr "" +"Heltal som bestämmer minimalt antal anteckningar att visa i Gnotes " +"anteckningsmeny." #: ../data/org.gnome.gnote.gschema.xml.in.h:23 -msgid "Saved height of Search window" -msgstr "Sparad höjd för sökfönstret" +msgid "List of pinned notes" +msgstr "Lista över nålade anteckningar" #: ../data/org.gnome.gnote.gschema.xml.in.h:24 -msgid "Determines pixel height of Search window; stored on Gnote exit." -msgstr "Bestämmer bildpunktshöjd för sökfönstret; lagras när Gnote avslutas." +msgid "" +"Whitespace-separated list of note URIs for notes that should always appear " +"in the Gnote note menu." +msgstr "" +"Blankstegsseparerad lista över URI:er för anteckningar som alltid ska visas " +"i Gnotes anteckningsmeny." #: ../data/org.gnome.gnote.gschema.xml.in.h:25 -msgid "Saved width of Search window" -msgstr "Sparad bredd för sökfönstret" +msgid "Is main window maximized" +msgstr "" #: ../data/org.gnome.gnote.gschema.xml.in.h:26 -msgid "Determines pixel width of Search window; stored on Gnote exit." -msgstr "Bestämmer bildpunktsbredd för sökfönstret; lagras när Gnote avslutas." +msgid "If true, Gnote window will be maximized." +msgstr "" #: ../data/org.gnome.gnote.gschema.xml.in.h:27 -msgid "Saved horizontal position of Search window" -msgstr "Sparad horisontell position för sökfönstret" +msgid "Saved height of Search window" +msgstr "Sparad höjd för sökfönstret" #: ../data/org.gnome.gnote.gschema.xml.in.h:28 -msgid "Determines X coordinate of Search window; stored on Gnote exit." -msgstr "Bestämmer X-koordinaten för sökfönstret; lagras när Gnote avslutas." +msgid "Determines pixel height of Search window; stored on Gnote exit." +msgstr "Bestämmer bildpunktshöjd för sökfönstret; lagras när Gnote avslutas." #: ../data/org.gnome.gnote.gschema.xml.in.h:29 -msgid "Saved vertical position of Search window" -msgstr "Sparad vertikal position för sökfönstret" +msgid "Saved width of Search window" +msgstr "Sparad bredd för sökfönstret" #: ../data/org.gnome.gnote.gschema.xml.in.h:30 -msgid "Determines Y coordinate of Search window; stored on Gnote exit." -msgstr "Bestämmer Y-koordinaten för sökfönstret; lagras när Gnote avslutas." +msgid "Determines pixel width of Search window; stored on Gnote exit." +msgstr "Bestämmer bildpunktsbredd för sökfönstret; lagras när Gnote avslutas." #: ../data/org.gnome.gnote.gschema.xml.in.h:31 msgid "Saved splitter position of Search window splitter." msgstr "Sparad delningsposition för sökfönstret." #: ../data/org.gnome.gnote.gschema.xml.in.h:32 -msgid "Determines Search window splitter position in pixels; stored on Gnote exit." -msgstr "Bestämmer delningsposition för sökfönstret (i bildpunkter); lagras när Gnote avslutas." +msgid "" +"Determines Search window splitter position in pixels; stored on Gnote exit." +msgstr "" +"Bestämmer delningsposition för sökfönstret (i bildpunkter); lagras när Gnote " +"avslutas." #: ../data/org.gnome.gnote.gschema.xml.in.h:33 -msgid "FUSE Mounting Timeout (ms)" -msgstr "Tidsgräns för FUSE-montering (ms)" +#, fuzzy +#| msgid "Saved height of Search window" +msgid "Saved sorting of the Search window." +msgstr "Sparad höjd för sökfönstret" #: ../data/org.gnome.gnote.gschema.xml.in.h:34 -msgid "Time (in milliseconds) Gnote should wait for a response when using FUSE to mount a sync share." -msgstr "Tid (i millisekunder) som Gnote ska vänta på ett svar när FUSE används för att montera en synkroniseringsutdelning." +#, fuzzy +#| msgid "" +#| "Determines Search window splitter position in pixels; stored on Gnote " +#| "exit." +msgid "Determines Search window initial sorting." +msgstr "" +"Bestämmer delningsposition för sökfönstret (i bildpunkter); lagras när Gnote " +"avslutas." #: ../data/org.gnome.gnote.gschema.xml.in.h:35 +msgid "FUSE Mounting Timeout (ms)" +msgstr "Tidsgräns för FUSE-montering (ms)" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:36 +msgid "" +"Time (in milliseconds) Gnote should wait for a response when using FUSE to " +"mount a sync share." +msgstr "" +"Tid (i millisekunder) som Gnote ska vänta på ett svar när FUSE används för " +"att montera en synkroniseringsutdelning." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:37 msgid "SSHFS Remote Synchronization Folder" msgstr "Mapp för SSHFS-fjärrsynkronisering" -#: ../data/org.gnome.gnote.gschema.xml.in.h:36 +#: ../data/org.gnome.gnote.gschema.xml.in.h:38 msgid "Path on SSH server to Gnote synchronization directory (optional)." msgstr "Sökväg på SSH-servern för Gnotes synkroniseringskatalog (valfritt)." -#: ../data/org.gnome.gnote.gschema.xml.in.h:37 +#: ../data/org.gnome.gnote.gschema.xml.in.h:39 msgid "SSHFS Synchronization Server URL" msgstr "Server-URL för SSHFS-synkronisering" -#: ../data/org.gnome.gnote.gschema.xml.in.h:38 +#: ../data/org.gnome.gnote.gschema.xml.in.h:40 msgid "URL of SSH server containing Gnote synchronization directory." msgstr "URL för SSH-servern som innehåller Gnotes synkroniseringskatalog." -#: ../data/org.gnome.gnote.gschema.xml.in.h:39 +#: ../data/org.gnome.gnote.gschema.xml.in.h:41 msgid "SSHFS Remote Synchronization User Name" msgstr "Användarnamn för SSHFS-fjärrsynkronisering" -#: ../data/org.gnome.gnote.gschema.xml.in.h:40 +#: ../data/org.gnome.gnote.gschema.xml.in.h:42 msgid "User name to use when connecting to the synchronization server via SSH." -msgstr "Användarnamnet att använda vid anslutning till synkroniseringsservern via SSH." +msgstr "" +"Användarnamnet att använda vid anslutning till synkroniseringsservern via " +"SSH." -#: ../data/org.gnome.gnote.gschema.xml.in.h:41 +#: ../data/org.gnome.gnote.gschema.xml.in.h:43 msgid "SSHFS Synchronization Server Port" msgstr "Serverport för SSHFS-synkronisering" -#: ../data/org.gnome.gnote.gschema.xml.in.h:42 +#: ../data/org.gnome.gnote.gschema.xml.in.h:44 msgid "The port to use when connecting to the synchronization server via SSH." msgstr "Porten att använda vid anslutning till synkroniseringsservern via SSH." -#: ../data/org.gnome.gnote.gschema.xml.in.h:43 +#: ../data/org.gnome.gnote.gschema.xml.in.h:45 msgid "Link Updating Behavior on Note Rename" msgstr "Beteende för länkuppdatering vid namnbyte" -#: ../data/org.gnome.gnote.gschema.xml.in.h:44 -msgid "Integer value indicating if there is a preference to always perform a specific link updating behavior when a note is renamed, instead of prompting the user. The values map to an internal enumeration. 0 indicates that the user wishes to be prompted when renaming a note may impact links that exist in other notes. 1 indicates that links should automatically be removed. 2 indicates that link text should be updated to the new note name so that it will continue linking to the renamed note." -msgstr "Heltalsvärde som indikerar om det finns en inställning för att alltid genomföra ett specifikt beteende för länkuppdateringar när en anteckning byter namn, istället för att fråga användaren. Värdena mappas till en intern numrering. 0 indikerar att användaren önskar att bli tillfrågad när en anteckning byter namn som kan påverka länkar som finns i andra anteckningar så att det nya anteckningsnamnet fortsätter att länka till anteckningen med nytt namn." +#: ../data/org.gnome.gnote.gschema.xml.in.h:46 +msgid "" +"Integer value indicating if there is a preference to always perform a " +"specific link updating behavior when a note is renamed, instead of prompting " +"the user. The values map to an internal enumeration. 0 indicates that the " +"user wishes to be prompted when renaming a note may impact links that exist " +"in other notes. 1 indicates that links should automatically be removed. 2 " +"indicates that link text should be updated to the new note name so that it " +"will continue linking to the renamed note." +msgstr "" +"Heltalsvärde som indikerar om det finns en inställning för att alltid " +"genomföra ett specifikt beteende för länkuppdateringar när en anteckning " +"byter namn, istället för att fråga användaren. Värdena mappas till en intern " +"numrering. 0 indikerar att användaren önskar att bli tillfrågad när en " +"anteckning byter namn som kan påverka länkar som finns i andra anteckningar " +"så att det nya anteckningsnamnet fortsätter att länka till anteckningen med " +"nytt namn." -#: ../data/org.gnome.gnote.gschema.xml.in.h:45 +#: ../data/org.gnome.gnote.gschema.xml.in.h:47 msgid "Enable closing notes with escape" msgstr "Aktivera stängning av anteckningar med escape-tangenten" -#: ../data/org.gnome.gnote.gschema.xml.in.h:46 +#: ../data/org.gnome.gnote.gschema.xml.in.h:48 msgid "If enabled, an opened note can be closed by hitting the escape key." -msgstr "Om aktiverad kan en öppnad anteckning stängas genom att trycka på escape-tangenten." +msgstr "" +"Om aktiverad kan en öppnad anteckning stängas genom att trycka på escape-" +"tangenten." -#: ../data/org.gnome.gnote.gschema.xml.in.h:47 +#: ../data/org.gnome.gnote.gschema.xml.in.h:49 msgid "Use status icon, when started as an application" msgstr "Använd statusikon, när startad som ett program" -#: ../data/org.gnome.gnote.gschema.xml.in.h:48 -msgid "Has affect only when started as an application. When set to TRUE, shows a status icon. If set to FALSE, Search All Notes window is used as main application window, closing which makes application to exit." -msgstr "Har endast effekt när startad som ett program. När inställd till TRUE så visas en statusikon. Om inställd till FALSE kommer Sök i alla anteckningar-fönstret att användas som huvudfönster för programmet, vilket gör att programmet avslutas om fönstret stängs." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:49 -msgid "Show applet menu" -msgstr "Visa panelprogramsmenyn" - #: ../data/org.gnome.gnote.gschema.xml.in.h:50 -msgid "The global keybinding for showing the Gnote applet's menu. The format looks like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is fairly liberal and allows lower or upper case, and also abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the special string \"disabled\", then there will be no keybinding for this action." -msgstr "Den globala tangentmappningen för att öppna Gnotes panelprogramsmeny. Formatet ser ut som \"<Control>a\" eller \"<Shift><Alt>F1\". Läsaren är ganska öppen och tillåter stora och små bokstäver, såvälsom förkortningar såsom \"<Ctl>\" och \"<Ctrl>\". Ställer du in alternativet till specialsträngen \"disabled\" så blir det ingen tangentbordsbindning för denna handling." +msgid "Deprecated, has no effect." +msgstr "" #: ../data/org.gnome.gnote.gschema.xml.in.h:51 -msgid "Open Start Here" -msgstr "Öppna \"Börja här\"" +#, fuzzy +#| msgid "Open the Search All Notes window" +msgid "Open notes in new window" +msgstr "Öppna \"Sök i alla anteckningar\"-fönstret" #: ../data/org.gnome.gnote.gschema.xml.in.h:52 -msgid "The global keybinding for opening the \"Start Here\" note. The format looks like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is fairly liberal and allows lower or upper case, and also abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the special string \"disabled\", then there will be no keybinding for this action." -msgstr "Den globala tangentmappningen för att öppna \"Börja Här\"-anteckningen. Formatet ser ut som \"<Control>a\" eller \"<Shift><Alt>F1\". Läsaren är ganska öppen och tillåter stora och små bokstäver, såvälsom förkortningar såsom \"<Ctl>\" och \"<Ctrl>\". Ställer du in alternativet till specialsträngen \"disabled\" så blir det ingen tangentbordsbindning för denna handling." +msgid "" +"Open notes in new window instead of replacing active content of the same " +"window" +msgstr "" #: ../data/org.gnome.gnote.gschema.xml.in.h:53 -msgid "Create a new Note" -msgstr "Skapa en ny anteckning" +msgid "Save note window size and autosize note window to it" +msgstr "" #: ../data/org.gnome.gnote.gschema.xml.in.h:54 -msgid "The global keybinding for creating and displaying a new Note. The format looks like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is fairly liberal and allows lower or upper case, and also abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the special string \"disabled\", then there will be no keybinding for this action." -msgstr "Den globala tangentmappningen för att skapa och visa en ny anteckning. Formatet ser ut som \"<Control>a\" eller \"<Shift><Alt>F1\". Läsaren är ganska öppen och tillåter stora och små bokstäver, såvälsom förkortningar såsom \"<Ctl>\" och \"<Ctrl>\". Ställer du in alternativet till specialsträngen \"disabled\" så blir det ingen tangentbordsbindning för denna handling." +msgid "" +"Saves note window size and automatically resizes main window to this size, " +"when note is opened." +msgstr "" #: ../data/org.gnome.gnote.gschema.xml.in.h:55 -msgid "Open Search Dialog" -msgstr "Öppna sökdialog" +msgid "Show applet menu" +msgstr "Visa panelprogramsmenyn" #: ../data/org.gnome.gnote.gschema.xml.in.h:56 -msgid "The global keybinding for opening the Note Search dialog. The format looks like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is fairly liberal and allows lower or upper case, and also abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the special string \"disabled\", then there will be no keybinding for this action." -msgstr "Den globala tangentmappningen för att öppna Sök-dialogen. Formatet ser ut som \"<Control>a\" eller \"<Shift><Alt>F1\". Läsaren är ganska öppen och tillåter stora och små bokstäver, såvälsom förkortningar såsom \"<Ctl>\" och \"<Ctrl>\". Ställer du in alternativet till specialsträngen \"disabled\" så blir det ingen tangentbordsbindning för denna handling." +msgid "Open Start Here" +msgstr "Öppna \"Börja här\"" #: ../data/org.gnome.gnote.gschema.xml.in.h:57 -msgid "Open Recent Changes" -msgstr "Öppna senaste ändringarna" +msgid "Create a new Note" +msgstr "Skapa en ny anteckning" #: ../data/org.gnome.gnote.gschema.xml.in.h:58 -msgid "The global keybinding for opening the Recent Changes dialog. The format looks like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is fairly liberal and allows lower or upper case, and also abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the special string \"disabled\", then there will be no keybinding for this action." -msgstr "Den globala tangentmappningen för att öppna \"Senaste ändringar\"-dialogen. Formatet ser ut som \"<Control>a\" eller \"<Shift><Alt>F1\". Läsaren är ganska öppen och tillåter stora och små bokstäver, såvälsom förkortningar såsom \"<Ctl>\" och \"<Ctrl>\". Ställer du in alternativet till specialsträngen \"disabled\" så blir det ingen tangentbordsbindning för denna handling." +msgid "Open Search Dialog" +msgstr "Öppna sökdialog" #: ../data/org.gnome.gnote.gschema.xml.in.h:59 -msgid "HTML Export Last Directory" -msgstr "HTML-exportera senaste katalogen" +msgid "Open Recent Changes" +msgstr "Öppna senaste ändringarna" #: ../data/org.gnome.gnote.gschema.xml.in.h:60 -msgid "The last directory a note was exported to using the Export To HTML plugin." -msgstr "Senaste katalogen som en anteckning exporterades till med insticksmodulen \"Exportera till HTML\"." +msgid "HTML Export Last Directory" +msgstr "HTML-exportera senaste katalogen" #: ../data/org.gnome.gnote.gschema.xml.in.h:61 -msgid "HTML Export Linked Notes" -msgstr "HTML-exportera länkade anteckningar" +msgid "" +"The last directory a note was exported to using the Export To HTML plugin." +msgstr "" +"Senaste katalogen som en anteckning exporterades till med insticksmodulen " +"\"Exportera till HTML\"." #: ../data/org.gnome.gnote.gschema.xml.in.h:62 -msgid "The last setting for the 'Export linked notes' checkbox in the Export to HTML plugin." -msgstr "Senaste inställningen för kryssrutan \"Exportera länkade anteckningar\" i insticksmodulen \"Exportera till HTML\"." +msgid "HTML Export Linked Notes" +msgstr "HTML-exportera länkade anteckningar" #: ../data/org.gnome.gnote.gschema.xml.in.h:63 -msgid "HTML Export All Linked Notes" -msgstr "HTML-exportera alla länkade anteckningar" +msgid "" +"The last setting for the 'Export linked notes' checkbox in the Export to " +"HTML plugin." +msgstr "" +"Senaste inställningen för kryssrutan \"Exportera länkade anteckningar\" i " +"insticksmodulen \"Exportera till HTML\"." #: ../data/org.gnome.gnote.gschema.xml.in.h:64 -msgid "The last setting for the 'Include all other linked notes' checkbox in the Export to HTML plugin. This setting is used in conjunction with the 'HTML Export Linked Notes' setting and is used to specify whether all notes (found recursively) should be included during an export to HTML." -msgstr "Den senaste inställningen för kryssrutan \"Inkludera alla andra länkade anteckningar\" i insticksmodulen \"Exportera till HTML\". Den här inställningen används i kombination med inställningen för \"HTML-exportera länkade anteckningar\" och används för att ange huruvida alla anteckningar (rekursivt hittade) ska inkluderas vid en HTML-exportering." +msgid "HTML Export All Linked Notes" +msgstr "HTML-exportera alla länkade anteckningar" #: ../data/org.gnome.gnote.gschema.xml.in.h:65 -msgid "Synchronization Client ID" -msgstr "Id för synkroniseringsklient" +msgid "" +"The last setting for the 'Include all other linked notes' checkbox in the " +"Export to HTML plugin. This setting is used in conjunction with the 'HTML " +"Export Linked Notes' setting and is used to specify whether all notes (found " +"recursively) should be included during an export to HTML." +msgstr "" +"Den senaste inställningen för kryssrutan \"Inkludera alla andra länkade " +"anteckningar\" i insticksmodulen \"Exportera till HTML\". Den här " +"inställningen används i kombination med inställningen för \"HTML-exportera " +"länkade anteckningar\" och används för att ange huruvida alla anteckningar " +"(rekursivt hittade) ska inkluderas vid en HTML-exportering." #: ../data/org.gnome.gnote.gschema.xml.in.h:66 -msgid "Unique identifier for this Gnote client, used when communicating with a sychronization server." -msgstr "Unik identifierare för den den här Gnote-klienten, används vid kommunikation med en synkroniseringsserver." +msgid "Synchronization Client ID" +msgstr "Id för synkroniseringsklient" #: ../data/org.gnome.gnote.gschema.xml.in.h:67 -msgid "Synchronization Local Server Path" -msgstr "Lokal serversökväg för synkronisering" +#, fuzzy +#| msgid "" +#| "Unique identifier for this Gnote client, used when communicating with a " +#| "sychronization server." +msgid "" +"Unique identifier for this Gnote client, used when communicating with a " +"synchronization server." +msgstr "" +"Unik identifierare för den den här Gnote-klienten, används vid kommunikation " +"med en synkroniseringsserver." #: ../data/org.gnome.gnote.gschema.xml.in.h:68 -msgid "Path to the synchronization server when using the filesystem synchronization service addin." -msgstr "Sökväg till synkroniseringsservern när tilläggstjänsten för synkronisering av filsystem används." +msgid "Synchronization Local Server Path" +msgstr "Lokal serversökväg för synkronisering" #: ../data/org.gnome.gnote.gschema.xml.in.h:69 -msgid "Selected Synchronization Service Addin" -msgstr "Valde tillägget synkroniseringstjänst" +msgid "" +"Path to the synchronization server when using the filesystem synchronization " +"service addin." +msgstr "" +"Sökväg till synkroniseringsservern när tilläggstjänsten för synkronisering " +"av filsystem används." #: ../data/org.gnome.gnote.gschema.xml.in.h:70 -msgid "Unique identifier for the currently configured note synchronization service addin." -msgstr "Unik identifierare för den för närvarande konfigurerade tilläggstjänsten för synkronisering av anteckningar." +msgid "Selected Synchronization Service Addin" +msgstr "Valde tillägget synkroniseringstjänst" #: ../data/org.gnome.gnote.gschema.xml.in.h:71 -msgid "Note Synchronization Conflict Saved Behavior" -msgstr "Sparat beteende för synkroniseringskonflikter för anteckningar" +msgid "" +"Unique identifier for the currently configured note synchronization service " +"addin." +msgstr "" +"Unik identifierare för den för närvarande konfigurerade tilläggstjänsten för " +"synkronisering av anteckningar." #: ../data/org.gnome.gnote.gschema.xml.in.h:72 -msgid "Integer value indicating if there is a preference to always perform a specific behavior when a conflict is detected, instead of prompting the user. The values map to an internal enumeration. 0 indicates that the user wishes to be prompted when a conflict occurs, so that they may handle each conflict situation on a case-by-case basis." -msgstr "Heltalsvärde som indikerar om det finns en inställning för att alltid genomföra ett specifikt beteende när en konflikt har upptäckts, istället för att fråga användaren. Värdena mappas till en intern numrering. 0 indikerar att användaren önskar att bli tillfrågad när en konflikt uppstår, så att användaren kan hantera konflikten från fall till fall." +msgid "Note Synchronization Conflict Saved Behavior" +msgstr "Sparat beteende för synkroniseringskonflikter för anteckningar" #: ../data/org.gnome.gnote.gschema.xml.in.h:73 -msgid "Automatic Background Synchronization Timeout" -msgstr "Tidsgräns överstegs för automatisk bakgrundssynkronisering" +msgid "" +"Integer value indicating if there is a preference to always perform a " +"specific behavior when a conflict is detected, instead of prompting the " +"user. The values map to an internal enumeration. 0 indicates that the user " +"wishes to be prompted when a conflict occurs, so that they may handle each " +"conflict situation on a case-by-case basis." +msgstr "" +"Heltalsvärde som indikerar om det finns en inställning för att alltid " +"genomföra ett specifikt beteende när en konflikt har upptäckts, istället för " +"att fråga användaren. Värdena mappas till en intern numrering. 0 indikerar " +"att användaren önskar att bli tillfrågad när en konflikt uppstår, så att " +"användaren kan hantera konflikten från fall till fall." #: ../data/org.gnome.gnote.gschema.xml.in.h:74 -msgid "Integer value indicating how frequently to perform a background sync of your notes (when sync is configured). Any value less than 1 indicates that autosync is disabled. The lowest acceptable positive value is 5. Value is in minutes." -msgstr "Heltalsvärde som indikerar hur frekvent en bakgrundssynkronisering kommer att genomföras av dina anteckningar (när synkronisering är konfigurerad). Alla värden mindre än 1 indikerar att automatisk synkronisering är inaktiverad. Det lägsta tillåtna positiva värdet är 5. Värdet anges i minuter." +msgid "Automatic Background Synchronization Timeout" +msgstr "Tidsgräns överstegs för automatisk bakgrundssynkronisering" #: ../data/org.gnome.gnote.gschema.xml.in.h:75 -msgid "Accept SSL Certificates" -msgstr "Acceptera SSL-certifikat" +msgid "" +"Integer value indicating how frequently to perform a background sync of your " +"notes (when sync is configured). Any value less than 1 indicates that " +"autosync is disabled. The lowest acceptable positive value is 5. Value is in " +"minutes." +msgstr "" +"Heltalsvärde som indikerar hur frekvent en bakgrundssynkronisering kommer " +"att genomföras av dina anteckningar (när synkronisering är konfigurerad). " +"Alla värden mindre än 1 indikerar att automatisk synkronisering är " +"inaktiverad. Det lägsta tillåtna positiva värdet är 5. Värdet anges i " +"minuter." #: ../data/org.gnome.gnote.gschema.xml.in.h:76 -msgid "Use wdfs option \"-ac\" to accept SSL certificates without prompting the user." -msgstr "Använd wdfs-flaggan \"-ac\" för att acceptera SSL-certifikat utan att tillfråga användaren." +msgid "Accept SSL Certificates" +msgstr "Acceptera SSL-certifikat" #: ../data/org.gnome.gnote.gschema.xml.in.h:77 -msgid "Timestamp format" -msgstr "Format för tidsstämpel" +msgid "" +"Use wdfs option \"-ac\" to accept SSL certificates without prompting the " +"user." +msgstr "" +"Använd wdfs-flaggan \"-ac\" för att acceptera SSL-certifikat utan att " +"tillfråga användaren." #: ../data/org.gnome.gnote.gschema.xml.in.h:78 -msgid "The date format that is used for the timestamp. It follows the format of strftime(3)." -msgstr "Datumformatet som används för tidsstämpeln. Den följer formatet för strftime(3)." - -#: ../src/actionmanager.cpp:174 -msgid "_File" -msgstr "_Arkiv" - -#: ../src/actionmanager.cpp:178 -msgid "_New" -msgstr "_Ny" +msgid "Share URL" +msgstr "" -#: ../src/actionmanager.cpp:179 -#: ../src/actionmanager.cpp:230 -msgid "Create a new note" -msgstr "Skapa en ny anteckning" +#: ../data/org.gnome.gnote.gschema.xml.in.h:79 +msgid "WebDAV share URL where notes are synchronized to." +msgstr "" -#: ../src/actionmanager.cpp:184 -msgid "_Open..." -msgstr "_Öppna..." +#: ../data/org.gnome.gnote.gschema.xml.in.h:80 +msgid "Share username" +msgstr "" -#: ../src/actionmanager.cpp:184 -msgid "Open the selected note" -msgstr "Öppna den valda anteckningen" +#: ../data/org.gnome.gnote.gschema.xml.in.h:81 +msgid "Username to access WebDAV share." +msgstr "" -#: ../src/actionmanager.cpp:190 -msgid "_Delete" -msgstr "_Ta bort" +#: ../data/org.gnome.gnote.gschema.xml.in.h:82 +msgid "Timestamp format" +msgstr "Format för tidsstämpel" -#: ../src/actionmanager.cpp:190 -msgid "Delete the selected note" -msgstr "Ta bort den valda anteckningen" +#: ../data/org.gnome.gnote.gschema.xml.in.h:83 +msgid "" +"The date format that is used for the timestamp. It follows the format of " +"strftime(3)." +msgstr "" +"Datumformatet som används för tidsstämpeln. Den följer formatet för " +"strftime(3)." -#: ../src/actionmanager.cpp:196 -#: ../src/notewindow.cpp:377 -msgid "_Close" -msgstr "S_täng" +#: ../data/org.gnome.gnote.gschema.xml.in.h:84 +msgid "Time between checks" +msgstr "" -#: ../src/actionmanager.cpp:196 -msgid "Close this window" -msgstr "Stäng det här fönstret" +#: ../data/org.gnome.gnote.gschema.xml.in.h:85 +msgid "" +"Time interval between note directory checks (in seconds). Min value is 5." +msgstr "" -#: ../src/actionmanager.cpp:201 -#: ../src/tray.cpp:477 +#: ../src/actionmanager.cpp:84 ../src/actionmanager.cpp:171 msgid "_Quit" msgstr "_Avsluta" -#: ../src/actionmanager.cpp:201 +#: ../src/actionmanager.cpp:84 msgid "Quit Gnote" msgstr "Avsluta Gnote" -#: ../src/actionmanager.cpp:204 -msgid "_Edit" -msgstr "R_edigera" - -#: ../src/actionmanager.cpp:209 -#: ../src/applet.cpp:383 -#: ../src/tray.cpp:460 +#: ../src/actionmanager.cpp:89 ../src/actionmanager.cpp:168 msgid "_Preferences" msgstr "_Inställningar" -#: ../src/actionmanager.cpp:209 -#: ../src/preferencesdialog.cpp:101 +#: ../src/actionmanager.cpp:89 ../src/preferencesdialog.cpp:103 msgid "Gnote Preferences" msgstr "Inställningar för Gnote" -#: ../src/actionmanager.cpp:212 -#: ../src/applet.cpp:384 -#: ../src/tray.cpp:465 -msgid "_Help" -msgstr "_Hjälp" - -#: ../src/actionmanager.cpp:216 +#: ../src/actionmanager.cpp:93 msgid "_Contents" msgstr "_Innehåll" -#: ../src/actionmanager.cpp:216 +#: ../src/actionmanager.cpp:93 msgid "Gnote Help" msgstr "Hjälp för Gnote" -#: ../src/actionmanager.cpp:221 -#: ../src/applet.cpp:385 +#: ../src/actionmanager.cpp:98 ../src/actionmanager.cpp:170 msgid "_About" msgstr "_Om" -#: ../src/actionmanager.cpp:221 +#: ../src/actionmanager.cpp:98 msgid "About Gnote" msgstr "Om Gnote" -#: ../src/actionmanager.cpp:225 +#: ../src/actionmanager.cpp:102 msgid "TrayIcon" msgstr "Lådikon" -#: ../src/actionmanager.cpp:230 +#: ../src/actionmanager.cpp:107 msgid "Create _New Note" msgstr "Skapa _ny anteckning" -#: ../src/actionmanager.cpp:235 -#: ../src/notewindow.cpp:329 +#: ../src/actionmanager.cpp:107 +msgid "Create a new note" +msgstr "Skapa en ny anteckning" + +#: ../src/actionmanager.cpp:112 msgid "_Search All Notes" msgstr "_Sök i alla anteckningar" -#: ../src/actionmanager.cpp:235 +#: ../src/actionmanager.cpp:112 msgid "Open the Search All Notes window" msgstr "Öppna \"Sök i alla anteckningar\"-fönstret" -#: ../src/actionmanager.cpp:240 -msgid "S_ynchronize Notes" -msgstr "S_ynkronisera anteckningar" - -#: ../src/actionmanager.cpp:240 -msgid "Start synchronizing notes" -msgstr "Starta synkronisering av anteckningar" +#: ../src/actionmanager.cpp:166 +msgid "_New Note" +msgstr "_Ny anteckning" + +#: ../src/actionmanager.cpp:167 +#, fuzzy +#| msgid "_Window" +msgid "New _Window" +msgstr "_Fönster" + +#: ../src/actionmanager.cpp:169 +msgid "_Help" +msgstr "_Hjälp" + +#: ../src/addininfo.cpp:74 +msgid "Failed to load plugin information!" +msgstr "" + +#: ../src/addininfo.cpp:124 +#, c-format +msgid "Incompatible plug-in %s: expected %s, got %s" +msgstr "" + +#: ../src/addinmanager.cpp:133 +#, c-format +msgid "Note plugin info %s already present" +msgstr "" + +#: ../src/addinmanager.cpp:141 +#, c-format +msgid "%s does not implement %s" +msgstr "" + +#: ../src/addinmanager.cpp:156 +#, c-format +msgid "Note plugin %s already present" +msgstr "" + +#: ../src/addinmanager.cpp:174 +#, c-format +msgid "Note plugin info %s is absent" +msgstr "" + +#: ../src/addinmanager.cpp:187 +#, c-format +msgid "Note plugin %s is absent" +msgstr "" + +#: ../src/addinmanager.cpp:224 +#, c-format +msgid "Failed to find module %s for addin %s" +msgstr "" + +#: ../src/addinmanager.cpp:228 +#, c-format +msgid "Failed to load addin info for %s: %s" +msgstr "" + +#: ../src/addinmanager.cpp:352 +msgid "Trying to load addins when they are already loaded" +msgstr "" + +#: ../src/addins/backlinks/backlinkmenuitem.cpp:41 +msgid "What links here?" +msgstr "Vad länkar hit?" + +#: ../src/addins/backlinks/backlinkmenuitem.cpp:42 +#, fuzzy +#| msgid "What links here?" +msgid "Which notes have links to here?" +msgstr "Vad länkar hit?" -#: ../src/addins/backlinks/backlinksnoteaddin.cpp:43 +#: ../src/addins/backlinks/backlinks.desktop.in.in.h:1 msgid "Backlinks" msgstr "Baklänkar" -#: ../src/addins/backlinks/backlinksnoteaddin.cpp:47 +#: ../src/addins/backlinks/backlinks.desktop.in.in.h:2 msgid "See which notes link to the one you're currently viewing." msgstr "Se vilka anteckningar som länkar till den som du ser på just nu." -#: ../src/addins/backlinks/backlinksnoteaddin.cpp:51 -#: ../src/addins/inserttimestamp/inserttimestampnoteaddin.cpp:53 +#: ../src/addins/backlinks/backlinks.desktop.in.in.h:3 +#: ../src/addins/inserttimestamp/inserttimestamp.desktop.in.in.h:3 msgid "Hubert Figuiere and Tomboy Project" msgstr "Hubert Figuiere och Tomboy-projektet" -#: ../src/addins/backlinks/backlinksnoteaddin.cpp:89 -msgid "What links here?" -msgstr "Vad länkar hit?" - -#: ../src/addins/backlinks/backlinksnoteaddin.cpp:145 +#: ../src/addins/backlinks/backlinksnoteaddin.cpp:86 msgid "(none)" msgstr "(ingen)" -#: ../src/addins/bugzilla/bugzillanoteaddin.cpp:60 +#: ../src/addins/bugzilla/bugzilla.desktop.in.in.h:1 msgid "Bugzilla Links" msgstr "Bugzilla-länkar" -#: ../src/addins/bugzilla/bugzillanoteaddin.cpp:64 -msgid "Allows you to drag a Bugzilla URL from your browser directly into a Gnote note. The bug number is inserted as a link with a little bug icon next to it." -msgstr "Låter dig dra en Bugzilla-URL från din webbläsare direkt in i en Gnote-anteckning. Felnumret infogas som en länk med en liten \"bug\"-ikon bredvid sig." - -#: ../src/addins/bugzilla/bugzillanoteaddin.cpp:68 -#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:72 -#: ../src/addins/printnotes/printnotesnoteaddin.cpp:57 -#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:67 +#: ../src/addins/bugzilla/bugzilla.desktop.in.in.h:2 +msgid "" +"Allows you to drag a Bugzilla URL from your browser directly into a Gnote " +"note. The bug number is inserted as a link with a little bug icon next to " +"it." +msgstr "" +"Låter dig dra en Bugzilla-URL från din webbläsare direkt in i en Gnote-" +"anteckning. Felnumret infogas som en länk med en liten \"bug\"-ikon bredvid " +"sig." + +#: ../src/addins/bugzilla/bugzilla.desktop.in.in.h:3 +#: ../src/addins/exporttohtml/exporttohtml.desktop.in.in.h:3 +#: ../src/addins/fixedwidth/fixedwidth.desktop.in.in.h:3 +#: ../src/addins/printnotes/printnotes.desktop.in.in.h:3 +#: ../src/addins/stickynoteimport/stickynoteimport.desktop.in.in.h:3 msgid "Hubert Figuiere and the Tomboy Project" msgstr "Hubert Figuiere och Tomboy-projektet" -#: ../src/addins/bugzilla/bugzillapreferences.cpp:62 -msgid "You can use any bugzilla just by dragging links into notes. If you want a special icon for certain hosts, add them here." -msgstr "Du kan använda en valfri bugzilla helt enkelt genom att dra länkar till anteckningar. Om du vill ha en speciell ikon för vissa värddatorer kan du lägga till dem här." +#: ../src/addins/bugzilla/bugzillapreferences.cpp:64 +msgid "" +"You can use any bugzilla just by dragging links into notes. If you want a " +"special icon for certain hosts, add them here." +msgstr "" +"Du kan använda en valfri bugzilla helt enkelt genom att dra länkar till " +"anteckningar. Om du vill ha en speciell ikon för vissa värddatorer kan du " +"lägga till dem här." -#: ../src/addins/bugzilla/bugzillapreferences.cpp:79 +#: ../src/addins/bugzilla/bugzillapreferences.cpp:81 msgid "Host Name" msgstr "Värdnamn" -#: ../src/addins/bugzilla/bugzillapreferences.cpp:92 +#: ../src/addins/bugzilla/bugzillapreferences.cpp:94 msgid "Icon" msgstr "Ikon" -#: ../src/addins/bugzilla/bugzillapreferences.cpp:226 +#: ../src/addins/bugzilla/bugzillapreferences.cpp:229 msgid "Select an icon..." msgstr "Välj en ikon..." #. Extra Widget -#: ../src/addins/bugzilla/bugzillapreferences.cpp:241 +#: ../src/addins/bugzilla/bugzillapreferences.cpp:244 msgid "_Host name:" msgstr "_Värdnamn:" -#: ../src/addins/bugzilla/bugzillapreferences.cpp:273 +#: ../src/addins/bugzilla/bugzillapreferences.cpp:278 msgid "Host name invalid" msgstr "Värdnamnet är ogiltigt" -#: ../src/addins/bugzilla/bugzillapreferences.cpp:274 +#: ../src/addins/bugzilla/bugzillapreferences.cpp:279 msgid "You must specify a valid Bugzilla host name to use with this icon." -msgstr "Du måste ange ett giltigt värdnamn för den Bugzilla som ska användas med den här ikonen." +msgstr "" +"Du måste ange ett giltigt värdnamn för den Bugzilla som ska användas med den " +"här ikonen." -#: ../src/addins/bugzilla/bugzillapreferences.cpp:293 +#: ../src/addins/bugzilla/bugzillapreferences.cpp:298 msgid "Error saving icon" msgstr "Fel vid sparandet av ikon" -#: ../src/addins/bugzilla/bugzillapreferences.cpp:294 +#: ../src/addins/bugzilla/bugzillapreferences.cpp:299 msgid "Could not save the icon file." msgstr "Kunde inte spara ikonfilen. " -#: ../src/addins/bugzilla/bugzillapreferences.cpp:366 +#: ../src/addins/bugzilla/bugzillapreferences.cpp:371 msgid "Really remove this icon?" msgstr "Verkligen ta bort den här ikonen?" -#: ../src/addins/bugzilla/bugzillapreferences.cpp:367 +#: ../src/addins/bugzilla/bugzillapreferences.cpp:372 msgid "If you remove an icon it is permanently lost." msgstr "Om du tar bort en ikon försvinner den för alltid." +#: ../src/addins/bugzilla/bugzillapreferences.cpp:394 +#, fuzzy, c-format +#| msgid "Error saving icon" +msgid "Error removing icon %s: %s" +msgstr "Fel vid sparandet av ikon" + +#: ../src/addins/exporttogtg/exporttogtg.desktop.in.in.h:1 +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:71 +msgid "Export to Getting Things GNOME" +msgstr "" + +#: ../src/addins/exporttogtg/exporttogtg.desktop.in.in.h:2 +#, fuzzy +#| msgid "Exports individual notes to HTML." +msgid "Exports individual notes as Getting Things GNOME tasks" +msgstr "Exportera individuella anteckningar till HTML." + +#: ../src/addins/exporttogtg/exporttogtg.desktop.in.in.h:3 +#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:3 +#: ../src/addins/statistics/statistics.desktop.in.in.h:3 +msgid "Aurimas Černius" +msgstr "" + +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:72 +msgid "Export note as Getting Things GNOME task" +msgstr "" + +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:86 +msgid "GTG XML loaded, but interface not found" +msgstr "" + +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:92 +#, c-format +msgid "Failed to create GTG interface from XML: %s" +msgstr "" + +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:100 +msgid "Failed to create D-Bus proxy for GTG" +msgstr "" + +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:116 +#, c-format +msgid "Failed to call GTG: %s" +msgstr "" + +#: ../src/addins/exporttohtml/exporttohtml.desktop.in.in.h:1 +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:76 +msgid "Export to HTML" +msgstr "Exportera till HTML" + +#: ../src/addins/exporttohtml/exporttohtml.desktop.in.in.h:2 +msgid "Exports individual notes to HTML." +msgstr "Exportera individuella anteckningar till HTML." + #: ../src/addins/exporttohtml/exporttohtmldialog.cpp:41 msgid "Destination for HTML Export" msgstr "Mål för HTML-export" @@ -545,247 +818,522 @@ msgid "Include all other linked notes" msgstr "Inkludera alla andra länkade anteckningar" -#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:64 -#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:99 -msgid "Export to HTML" +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:77 +#, fuzzy +#| msgid "Export to HTML" +msgid "Export note to HTML" msgstr "Exportera till HTML" -#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:68 -msgid "Exports individual notes to HTML." -msgstr "Exportera individuella anteckningar till HTML." +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:117 +#, c-format +msgid "Could not open exported note in a web browser: %s" +msgstr "" -#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:145 +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:121 msgid "Your note was exported to \"%1%\"." msgstr "Din anteckning exporterades till \"%1%\"." -#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:154 +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:130 msgid "Note exported successfully" msgstr "Anteckningen exporterades" -#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:179 +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:144 +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:152 +#, fuzzy, c-format +#| msgid "Could not save the file \"%s\"" +msgid "Could not export: %s" +msgstr "Kunde inte spara filen \"%s\"" + +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:155 #, c-format msgid "Could not save the file \"%s\"" msgstr "Kunde inte spara filen \"%s\"" -#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:49 -msgid "Local Directory Sync Service Add-in" -msgstr "Tillägg för lokal synkroniseringstjänst" - -#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:53 -msgid "Synchronize Gnote Notes to a local file system path" -msgstr "Synkronisera Gnote-anteckningar till ett lokalt filsystem" - -#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:57 -msgid "Aurimas Cernius and the Tomboy Project" -msgstr "Aurimas Cernius och Tomboy-projektet" - -#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:124 +#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:102 msgid "_Folder Path:" msgstr "_Mappsökväg:" -#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:131 +#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:109 msgid "Select Synchronization Folder..." msgstr "Välj synkroniseringsmapp..." -#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:154 +#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:134 msgid "Folder path field is empty." msgstr "Fältet för mappsökväg är tomt." -#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:161 -msgid "Specified folder path does not exist, and Gnote was unable to create it." +#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:141 +msgid "" +"Specified folder path does not exist, and Gnote was unable to create it." msgstr "Angiven mappsökväg finns inte och Gnote kunde inte skapa den." -#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:237 +#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:217 msgid "Local Folder" msgstr "Lokal mapp" -#: ../src/addins/fixedwidth/fixedwidthmenuitem.cpp:35 -msgid "Fixed Wid_th" -msgstr "Fast _bredd" +#: ../src/addins/filesystemsyncservice/filesystemsyncservice.desktop.in.in.h:1 +#, fuzzy +#| msgid "Local Directory Sync Service Add-in" +msgid "Local Directory Sync Service Plugin" +msgstr "Tillägg för lokal synkroniseringstjänst" + +#: ../src/addins/filesystemsyncservice/filesystemsyncservice.desktop.in.in.h:2 +msgid "Synchronize Gnote Notes to a local file system path" +msgstr "Synkronisera Gnote-anteckningar till ett lokalt filsystem" + +#: ../src/addins/filesystemsyncservice/filesystemsyncservice.desktop.in.in.h:3 +#: ../src/addins/webdavsyncservice/webdavsyncservice.desktop.in.in.h:3 +#, fuzzy +#| msgid "Aurimas Cernius and the Tomboy Project" +msgid "Aurimas Černius and the Tomboy Project" +msgstr "Aurimas Cernius och Tomboy-projektet" -#. this is the name of the plugin. -#: ../src/addins/fixedwidth/fixedwidthnoteaddin.cpp:49 +#: ../src/addins/fixedwidth/fixedwidth.desktop.in.in.h:1 msgid "Fixed Width" msgstr "Fast bredd" -#: ../src/addins/fixedwidth/fixedwidthnoteaddin.cpp:53 +#: ../src/addins/fixedwidth/fixedwidth.desktop.in.in.h:2 msgid "Adds fixed-width font style." msgstr "Lägger till en typsnittsstil med fast bredd." -#. Add the menu item when the window is created +#: ../src/addins/fixedwidth/fixedwidthmenuitem.cpp:35 +msgid "Fixed Wid_th" +msgstr "Fast _bredd" + +#: ../src/addins/inserttimestamp/inserttimestamp.desktop.in.in.h:1 #: ../src/addins/inserttimestamp/inserttimestampnoteaddin.cpp:45 -#: ../src/addins/inserttimestamp/inserttimestampnoteaddin.cpp:78 msgid "Insert Timestamp" msgstr "Infoga tidsstämpel" -#: ../src/addins/inserttimestamp/inserttimestampnoteaddin.cpp:49 +#: ../src/addins/inserttimestamp/inserttimestamp.desktop.in.in.h:2 msgid "Inserts current date and time at the cursor position." msgstr "Infogar aktuellt datum och tid vid markörens position." +#: ../src/addins/inserttimestamp/inserttimestampnoteaddin.cpp:46 +#, fuzzy +#| msgid "Insert Timestamp" +msgid "Insert Timestamp into note" +msgstr "Infoga tidsstämpel" + #. Label -#: ../src/addins/inserttimestamp/inserttimestamppreferences.cpp:67 +#: ../src/addins/inserttimestamp/inserttimestamppreferences.cpp:70 msgid "Choose one of the predefined formats or use your own." msgstr "Välj ett av de fördefinierade formaten eller använd ditt egna format." -#: ../src/addins/inserttimestamp/inserttimestamppreferences.cpp:75 +#: ../src/addins/inserttimestamp/inserttimestamppreferences.cpp:78 msgid "Use _Selected Format" msgstr "Använd _valt format" -#: ../src/addins/inserttimestamp/inserttimestamppreferences.cpp:104 +#: ../src/addins/inserttimestamp/inserttimestamppreferences.cpp:110 msgid "_Use Custom Format" msgstr "Använd anpassat t_ypsnitt" -#: ../src/addins/noteoftheday/noteofthedayapplicationaddin.cpp:45 -msgid "Note of the Day" -msgstr "Dagens anteckning" +#. TRANSLATORS: first %s is file name, second is error +#: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:236 +#, c-format +msgid "NoteDirectoryWatcher: Update aborted, error reading %s: %s" +msgstr "" -#: ../src/addins/noteoftheday/noteofthedayapplicationaddin.cpp:49 -msgid "Automatically creates a \"Today\" note for easily jotting down daily thoughts" -msgstr "Skapar automatiskt en \"Idag\"-anteckning för att enklare plita ner dagliga tankar" +#. TRANSLATORS: %s is file +#: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:263 +#, c-format +msgid "NoteDirectoryWatcher: Error reading note title from %s" +msgstr "" -#: ../src/addins/noteoftheday/noteofthedayapplicationaddin.cpp:54 -msgid "Debarshi Ray and the Tomboy Project" -msgstr "Debarshi Ray och Tomboy-projektet" +#. TRANSLATORS: %s is file +#: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:271 +#, c-format +msgid "NoteDirectoryWatcher: Unknown error creating note from %s" +msgstr "" + +#. TRANSLATORS: first %s is file, second is error +#: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:277 +#, c-format +msgid "NoteDirectoryWatcher: Error creating note from %s: %s" +msgstr "" + +#. TRANSLATORS: first %s is file, second is error +#: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:290 +#, c-format +msgid "NoteDirectoryWatcher: Update aborted, error parsing %s: %s" +msgstr "" + +#: ../src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in.in.h:1 +msgid "Note Directory Watcher" +msgstr "" + +#: ../src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in.in.h:2 +msgid "Watch your Gnote note directory for changes to your notes." +msgstr "" + +#: ../src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in.in.h:3 +#, fuzzy +#| msgid "and Tomboy original authors." +msgid "Aurimas Černius and Tomboy original authors" +msgstr "och de ursprungliga utvecklarna av Tomboy." + +#: ../src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp:35 +msgid "_Directory check interval:" +msgstr "" -#: ../src/addins/noteoftheday/noteoftheday.cpp:32 +#: ../src/addins/noteoftheday/noteoftheday.cpp:33 msgid "Today: Template" msgstr "Idag: Mall" -#: ../src/addins/noteoftheday/noteoftheday.cpp:34 +#: ../src/addins/noteoftheday/noteoftheday.cpp:35 msgid "Today: " msgstr "Idag: " -#: ../src/addins/noteoftheday/noteoftheday.cpp:158 +#. TRANSLATORS: first %s is note title, second is error +#. TRANSLATORS: first %s is template note title, second is error +#: ../src/addins/noteoftheday/noteoftheday.cpp:49 +#: ../src/addins/noteoftheday/noteofthedaypreferences.cpp:72 +#, c-format +msgid "NoteOfTheDay could not create %s: %s" +msgstr "" + +#: ../src/addins/noteoftheday/noteoftheday.cpp:155 msgid "Tasks" msgstr "Uppgifter" -#: ../src/addins/noteoftheday/noteoftheday.cpp:159 +#: ../src/addins/noteoftheday/noteoftheday.cpp:156 msgid "Appointments" msgstr "Möten" #. Format: "Today: Friday, July 01 2005" -#: ../src/addins/noteoftheday/noteoftheday.cpp:165 +#: ../src/addins/noteoftheday/noteoftheday.cpp:162 msgid "%A, %B %d %Y" msgstr "%A, %d %B %Y" -#: ../src/addins/noteoftheday/noteofthedaypreferences.cpp:35 +#: ../src/addins/noteoftheday/noteoftheday.desktop.in.in.h:1 +msgid "Note of the Day" +msgstr "Dagens anteckning" + +#: ../src/addins/noteoftheday/noteoftheday.desktop.in.in.h:2 +msgid "" +"Automatically creates a \"Today\" note for easily jotting down daily thoughts" +msgstr "" +"Skapar automatiskt en \"Idag\"-anteckning för att enklare plita ner dagliga " +"tankar" + +#: ../src/addins/noteoftheday/noteoftheday.desktop.in.in.h:3 +msgid "Debarshi Ray and the Tomboy Project" +msgstr "Debarshi Ray och Tomboy-projektet" + +#: ../src/addins/noteoftheday/noteofthedaypreferences.cpp:34 msgid "_Open Today: Template" msgstr "_Öppna Idag: Mall" -#: ../src/addins/noteoftheday/noteofthedaypreferences.cpp:36 -msgid "Change the Today: Template note to customize the text that new Today notes have." -msgstr "Ändra anteckningen Idag: Mall för att anpassa texten som nya Idag-anteckningar använder." +#: ../src/addins/noteoftheday/noteofthedaypreferences.cpp:35 +msgid "" +"Change the Today: Template note to customize " +"the text that new Today notes have." +msgstr "" +"Ändra anteckningen Idag: Mall för att anpassa " +"texten som nya Idag-anteckningar använder." -#: ../src/addins/printnotes/printnotesnoteaddin.cpp:49 +#: ../src/addins/printnotes/printnotes.desktop.in.in.h:1 msgid "Printing Support" msgstr "Utskriftsstöd" -#: ../src/addins/printnotes/printnotesnoteaddin.cpp:53 +#: ../src/addins/printnotes/printnotes.desktop.in.in.h:2 msgid "Allows you to print a note." msgstr "Låter dig skriva ut en anteckning." -#: ../src/addins/printnotes/printnotesnoteaddin.cpp:80 +#: ../src/addins/printnotes/printnotesnoteaddin.cpp:61 msgid "Print" msgstr "Skriv ut" -#: ../src/addins/printnotes/printnotesnoteaddin.cpp:135 +#: ../src/addins/printnotes/printnotesnoteaddin.cpp:61 +#, fuzzy +#| msgid "Print Footer" +msgid "Print note" +msgstr "Skriv ut sidfot" + +#: ../src/addins/printnotes/printnotesnoteaddin.cpp:136 msgid "Error printing note" msgstr "Fel vid utskrift av anteckning" #. %1% is the page number, %2% is the total number of pages -#: ../src/addins/printnotes/printnotesnoteaddin.cpp:299 +#: ../src/addins/printnotes/printnotesnoteaddin.cpp:303 msgid "Page %1% of %2%" msgstr "Sida %1% av %2%" -#: ../src/addins/replacetitle/replacetitlenoteaddin.cpp:43 -#: ../src/addins/replacetitle/replacetitlenoteaddin.cpp:77 +#: ../src/addins/readonly/readonly.desktop.in.in.h:1 +#: ../src/addins/readonly/readonlynoteaddin.cpp:53 +msgid "Read Only" +msgstr "" + +#: ../src/addins/readonly/readonly.desktop.in.in.h:2 +msgid "Mark certain notes as read only" +msgstr "" + +#: ../src/addins/readonly/readonly.desktop.in.in.h:3 +msgid "Aurimas Černius, Debarshi Ray and Arief Bayu Purwanto" +msgstr "" + +#: ../src/addins/readonly/readonlynoteaddin.cpp:54 +msgid "Make this note read-only" +msgstr "" + +#: ../src/addins/replacetitle/replacetitle.desktop.in.in.h:1 +#: ../src/addins/replacetitle/replacetitlenoteaddin.cpp:51 msgid "Replace title" msgstr "Ersätt titel" -#: ../src/addins/replacetitle/replacetitlenoteaddin.cpp:48 +#: ../src/addins/replacetitle/replacetitle.desktop.in.in.h:2 msgid "Replace title with selection." msgstr "Ersätt titeln med markeringen." -#: ../src/addins/replacetitle/replacetitlenoteaddin.cpp:54 +#: ../src/addins/replacetitle/replacetitle.desktop.in.in.h:3 msgid "Pierre-Yves Luyten" msgstr "Pierre-Yves Luyten" -#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:59 +#: ../src/addins/specialnotes/specialnotesapplicationaddin.cpp:38 +#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:1 +#, fuzzy +#| msgid "Search All Notes" +msgid "Special Notes" +msgstr "Sök i alla anteckningar" + +#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:2 +msgid "Show special notes, that are otherwise hidden" +msgstr "" + +#: ../src/addins/statistics/statisticsapplicationaddin.cpp:50 +msgid "Show Statistics" +msgstr "" + +#: ../src/addins/statistics/statistics.desktop.in.in.h:1 +#: ../src/addins/statistics/statisticswidget.cpp:171 +#, fuzzy +#| msgid "Status" +msgid "Statistics" +msgstr "Status" + +#: ../src/addins/statistics/statistics.desktop.in.in.h:2 +msgid "Show various statistics about notes." +msgstr "" + +#: ../src/addins/statistics/statisticswidget.cpp:91 +#, fuzzy +#| msgid "Gnote Notes" +msgid "Total Notes:" +msgstr "Gnote-anteckningar" + +#: ../src/addins/statistics/statisticswidget.cpp:97 +#, fuzzy +#| msgid "Notebooks" +msgid "Total Notebooks:" +msgstr "Anteckningsblock" + +#: ../src/addins/statistics/statisticswidget.cpp:127 +#, fuzzy +#| msgid "Total: %1% note" +#| msgid_plural "Total: %1% notes" +msgid "%1% note" +msgid_plural "%1% notes" +msgstr[0] "Totalt: %1% anteckning" +msgstr[1] "Totalt: %1% anteckningar" + +#: ../src/addins/stickynoteimport/stickynoteimport.desktop.in.in.h:1 msgid "Sticky Notes Importer" msgstr "Importera från Klisterlappar" -#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:63 +#: ../src/addins/stickynoteimport/stickynoteimport.desktop.in.in.h:2 msgid "Import your notes from the Sticky Notes applet." msgstr "Importera dina anteckningar från panelprogrammet Klisterlappar." -#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:109 +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:87 msgid "Import from Sticky Notes" msgstr "Importera från Klisterlappar" -#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:209 +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:214 msgid "No Sticky Notes found" msgstr "Inga klisterlappar hittades" #. %1% is a the file name -#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:211 +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:216 msgid "No suitable Sticky Notes file was found at \"%1%\"." msgstr "Ingen lämplig Klisterlappar-fil hittades i \"%1%\"." -#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:219 +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:224 msgid "Sticky Notes import completed" msgstr "Importeringen från Klisterlappar är färdig" #. here %1% is the number of notes imported, %2% the total number of notes. -#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:221 +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:226 msgid "%1% of %2% Sticky Notes were successfully imported." msgstr "%1% av %2% klisterlappar blev importerade." -#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:240 +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:245 msgid "Untitled" msgstr "Namnlös" -#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:278 +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:283 msgid "Sticky Note: " msgstr "Klisterlapp: " -#: ../src/addins/tomboyimport/tomboyimportaddin.cpp:48 +#. namespace +#: ../src/addins/tableofcontents/tableofcontentsaction.cpp:37 +#: ../src/addins/tableofcontents/tableofcontentsaction.cpp:38 +#: ../src/addins/tableofcontents/tableofcontents.desktop.in.in.h:1 +#: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:66 +msgid "Table of Contents" +msgstr "Innehållsförteckning" + +#: ../src/addins/tableofcontents/tableofcontents.desktop.in.in.h:2 +msgid "" +"Navigate long structured notes. Set section and subsection headings in your " +"note, and the Table of Contents will show in a menu." +msgstr "" + +#: ../src/addins/tableofcontents/tableofcontents.desktop.in.in.h:3 +msgid "Luc Pionchon" +msgstr "" + +#: ../src/addins/tableofcontents/tableofcontents.desktop.in.in.h:4 +msgid "© 2013 Luc Pionchon" +msgstr "" + +#. no toc items, and no action entries = empty menu +#: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:140 +#, fuzzy +#| msgid "Open Table of Contents" +msgid "(empty table of contents)" +msgstr "Öppna innehållsförteckning" + +#: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:155 +msgid "Heading 1" +msgstr "" + +#: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:161 +msgid "Heading 2" +msgstr "" + +#: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:167 +#, fuzzy +#| msgid "Table of Contents" +msgid "Table of Contents Help" +msgstr "Innehållsförteckning" + +#. namespace +#: ../src/addins/todo/todo.desktop.in.in.h:1 +msgid "TODO" +msgstr "" + +#: ../src/addins/todo/todo.desktop.in.in.h:2 +msgid "Highlight FIXME, TODO and XXX patterns in notes." +msgstr "" + +#: ../src/addins/todo/todo.desktop.in.in.h:3 +msgid "Aurimas Černius, Romain Tartière" +msgstr "" + +#: ../src/addins/tomboyimport/tomboyimport.desktop.in.in.h:1 msgid "Tomboy Importer" msgstr "Tomboy-importerare" -#: ../src/addins/tomboyimport/tomboyimportaddin.cpp:52 +#: ../src/addins/tomboyimport/tomboyimport.desktop.in.in.h:2 msgid "Import your notes from Tomboy." msgstr "Importera dina anteckningar från Tomboy." -#: ../src/addins/tomboyimport/tomboyimportaddin.cpp:56 +#: ../src/addins/tomboyimport/tomboyimport.desktop.in.in.h:3 msgid "Hubert Figuiere" msgstr "Hubert Figuiere" -#: ../src/addins/underline/underlinemenuitem.cpp:35 -msgid "_Underline" -msgstr "_Understryk" - -#. this is the name of the plugin. -#: ../src/addins/underline/underlinenoteaddin.cpp:49 +#: ../src/addins/underline/underline.desktop.in.in.h:1 msgid "Underline" msgstr "Understryk" -#: ../src/addins/underline/underlinenoteaddin.cpp:53 +#: ../src/addins/underline/underline.desktop.in.in.h:2 msgid "Adds ability to underline text." msgstr "Lägger till möjligheten att stryka under text." -#: ../src/addins/underline/underlinenoteaddin.cpp:57 +#: ../src/addins/underline/underline.desktop.in.in.h:3 msgid "Hubert Figuière and the Tomboy Project" msgstr "Hubert Figuière och Tomboy-projektet" -#: ../src/gnote.cpp:372 -msgid "Cannot create new note" -msgstr "Kan inte skapa ny anteckning" +#: ../src/addins/underline/underlinemenuitem.cpp:35 +msgid "_Underline" +msgstr "_Understryk" + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:70 +msgid "_URL:" +msgstr "_Url:" + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:75 +msgid "User_name:" +msgstr "Användar_namn:" + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:81 +msgid "_Password:" +msgstr "_Lösenord:" + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:105 +msgid "WebDAV" +msgstr "" + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:117 +msgid "" +"There was an error connecting to the server. This may be caused by using an " +"incorrect user name and/or password." +msgstr "" +"Det inträffade ett fel vid anslutning till servern. Det kan ha orsakats av " +"ett felaktigt användarnamn och/eller lösenord." + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:173 +msgid "URL, username, or password field is empty." +msgstr "Fältet för url, användarnamn eller lösenord är tomt." + +#. TODO: If the above fails (no keyring daemon), save all but password +#. to GConf, and notify user. +#. Save configuration into GConf +#. Preferences.Set ("/apps/tomboy/sync_wdfs_url", url ?? string.Empty); +#. Preferences.Set ("/apps/tomboy/sync_wdfs_username", username ?? string.Empty); +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:262 +#, fuzzy +#| msgid "" +#| "Saving configuration to the GNOME keyring failed with the following " +#| "message:" +msgid "" +"Saving configuration to the GNOME keyring failed with the following " +"message:\n" +"\n" +"%1%" +msgstr "" +"Sparning av konfiguration till GNOME-nyckelringen misslyckades med följande " +"meddelande:" + +#: ../src/addins/webdavsyncservice/webdavsyncservice.desktop.in.in.h:1 +msgid "WebDAV Sync Service Plugin" +msgstr "" + +#: ../src/addins/webdavsyncservice/webdavsyncservice.desktop.in.in.h:2 +#, fuzzy +#| msgid "Synchronize Gnote Notes to a local file system path" +msgid "Synchronize Gnote Notes to a WebDAV URL." +msgstr "Synkronisera Gnote-anteckningar till ett lokalt filsystem" + +#: ../src/dbus/remotecontrol-client-glue.cpp:138 +#, fuzzy, c-format +#| msgid "Installation failed" +msgid "Remote call to %s failed" +msgstr "Installationen misslyckades" + +#: ../src/dbus/remotecontrol.cpp:82 +#, c-format +msgid "Exception thrown when creating note: %s" +msgstr "" + +#: ../src/gnote.cpp:185 +msgid "Gnote is already running. Exiting..." +msgstr "" -#: ../src/gnote.cpp:425 +#: ../src/gnote.cpp:289 msgid "and Tomboy original authors." msgstr "och de ursprungliga utvecklarna av Tomboy." -#: ../src/gnote.cpp:434 +#: ../src/gnote.cpp:295 msgid "translator-credits" msgstr "" "Daniel Nylander \n" @@ -795,9 +1343,15 @@ "Skicka synpunkter på översättningen\n" "till ." -#: ../src/gnote.cpp:443 +#: ../src/gnote.cpp:304 +#, fuzzy +#| msgid "" +#| "Copyright © 2010-2012 Aurimas Cernius\n" +#| "Copyright © 2009-2011 Debarshi Ray\n" +#| "Copyright © 2009 Hubert Figuiere\n" +#| "Copyright © 2004-2009 the Tomboy original authors." msgid "" -"Copyright © 2010-2012 Aurimas Cernius\n" +"Copyright © 2010-2015 Aurimas Cernius\n" "Copyright © 2009-2011 Debarshi Ray\n" "Copyright © 2009 Hubert Figuiere\n" "Copyright © 2004-2009 the Tomboy original authors." @@ -807,1087 +1361,1666 @@ "Copyright © 2009 Hubert Figuiere\n" "Copyright © 2004-2009 De ursprungliga Tomboy-upphovsmännen." -#: ../src/gnote.cpp:447 +#: ../src/gnote.cpp:308 msgid "A simple and easy to use desktop note-taking application." msgstr "Ett enkelt och lättanvänt program för att ta anteckningar." -#: ../src/gnote.cpp:458 +#: ../src/gnote.cpp:319 msgid "Homepage" msgstr "Webbplats" -#: ../src/gnote.cpp:554 -msgid "Run Gnote as a GNOME panel applet." -msgstr "Kör Gnote som ett panelprogram i GNOME." - -#: ../src/gnote.cpp:555 +#: ../src/gnote.cpp:494 msgid "Run Gnote in background." msgstr "Kör Gnote i bakgrunden." -#: ../src/gnote.cpp:556 +#: ../src/gnote.cpp:495 +#, fuzzy +#| msgid "Run Gnote as a GNOME panel applet." +msgid "Run Gnote as GNOME Shell search provider." +msgstr "Kör Gnote som ett panelprogram i GNOME." + +#: ../src/gnote.cpp:496 msgid "Specify the path of the directory containing the notes." msgstr "Ange sökvägen för katalogen som innehåller anteckningarna." -#: ../src/gnote.cpp:556 +#: ../src/gnote.cpp:496 msgid "path" msgstr "sökväg" -#: ../src/gnote.cpp:557 +#: ../src/gnote.cpp:497 msgid "Open the search all notes window with the search text." msgstr "Öppna \"Sök i alla anteckningar\"-fönstret med söktexten." -#: ../src/gnote.cpp:557 -#: ../src/gnote.cpp:562 +#: ../src/gnote.cpp:497 ../src/gnote.cpp:502 msgid "text" msgstr "text" -#: ../src/gnote.cpp:558 +#: ../src/gnote.cpp:498 msgid "Print version information." msgstr "Skriv ut versionsinformation." -#: ../src/gnote.cpp:559 +#: ../src/gnote.cpp:499 msgid "Create and display a new note, with a optional title." msgstr "Skapa och visa en ny anteckning, med en valfri titel." -#: ../src/gnote.cpp:559 +#: ../src/gnote.cpp:499 msgid "title" msgstr "titel" -#: ../src/gnote.cpp:560 +#: ../src/gnote.cpp:500 msgid "Display the existing note matching title." msgstr "Visa den befintliga matchande titeln för anteckningen." -#: ../src/gnote.cpp:560 +#: ../src/gnote.cpp:500 msgid "title/url" msgstr "titel/url" -#: ../src/gnote.cpp:561 +#: ../src/gnote.cpp:501 msgid "Display the 'Start Here' note." msgstr "Visa \"Börja här\"-anteckningen." -#: ../src/gnote.cpp:562 +#: ../src/gnote.cpp:502 msgid "Search and highlight text in the opened note." msgstr "Sök och färgmarkera text i den öppnade anteckningen." -#: ../src/gnote.cpp:566 +#: ../src/gnote.cpp:506 msgid "A note taking application" msgstr "Ett anteckningsblock" -#: ../src/gnote.cpp:566 +#: ../src/gnote.cpp:506 msgid "Gnote options at launch" msgstr "Gnote-alternativ vid uppstart" -#: ../src/gnote.cpp:759 +#: ../src/gnote.cpp:583 +msgid "Could not connect to remote instance." +msgstr "" + +#: ../src/gnote.cpp:699 msgid "Version %1%" msgstr "Version %1%" -#: ../src/notebooks/createnotebookdialog.cpp:38 -#: ../src/notebooks/notebookapplicationaddin.cpp:109 -msgid "Create a new notebook" -msgstr "Skapa ett nytt anteckningsblock" +#. TRANSLATORS: the first %s is icon name, %d is for size, last %s is error description +#: ../src/iconmanager.cpp:66 +#, c-format +msgid "Failed to load icon (%s, %d): %s" +msgstr "" + +#: ../src/noteaddin.cpp:108 ../src/noteaddin.cpp:122 ../src/noteaddin.cpp:135 +msgid "Plugin is disposing already" +msgstr "" + +#: ../src/noteaddin.cpp:139 +msgid "Window is not embedded" +msgstr "" + +#. Probably IOException or UnauthorizedAccessException? +#: ../src/notebase.cpp:200 ../src/note.cpp:382 +#, c-format +msgid "Exception while saving note: %s" +msgstr "" -#: ../src/notebooks/createnotebookdialog.cpp:39 -msgid "Type the name of the notebook you'd like to create." -msgstr "Ange namnet på anteckningsblocket du vill skapa." +#. write failure, but not critical +#: ../src/notebase.cpp:444 +#, c-format +msgid "Failed to update note format: %s" +msgstr "" + +#: ../src/notebase.cpp:568 +#, c-format +msgid "Filesystem error: %s" +msgstr "" + +#: ../src/notebooks/createnotebookdialog.cpp:41 +#, fuzzy +#| msgid "Create a new notebook" +msgid "Create Notebook" +msgstr "Skapa ett nytt anteckningsblock" -#: ../src/notebooks/createnotebookdialog.cpp:47 +#: ../src/notebooks/createnotebookdialog.cpp:45 msgid "N_otebook name:" msgstr "Namn _på anteckningsblock:" -#: ../src/notebooks/createnotebookdialog.cpp:60 +#: ../src/notebooks/createnotebookdialog.cpp:58 msgid "Name already taken" msgstr "Namnet används redan" #. Translation note: This is the Create button in the Create #. New Note Dialog. -#: ../src/notebooks/createnotebookdialog.cpp:73 +#: ../src/notebooks/createnotebookdialog.cpp:71 msgid "C_reate" msgstr "S_kapa" -#: ../src/notebooks/notebookapplicationaddin.cpp:103 -msgid "Note_books" -msgstr "Antecknings_block" +#: ../src/notebooks/notebookapplicationaddin.cpp:66 +#: ../src/searchnoteswidget.cpp:229 +msgid "Notebooks" +msgstr "Anteckningsblock" -#: ../src/notebooks/notebookapplicationaddin.cpp:104 -#: ../src/notebooks/notebookapplicationaddin.cpp:129 +#: ../src/notebooks/notebookapplicationaddin.cpp:67 msgid "Create a new note in a notebook" msgstr "Skapa en ny anteckning i ett anteckningsblock" -#: ../src/notebooks/notebookapplicationaddin.cpp:108 -#: ../src/notebooks/notebookapplicationaddin.cpp:263 +#: ../src/notebooks/notebookapplicationaddin.cpp:96 +#: ../src/notebooks/notebookapplicationaddin.cpp:146 msgid "New Note_book..." msgstr "Nytt antecknings_block..." -#: ../src/notebooks/notebookapplicationaddin.cpp:113 -msgid "_New Note" -msgstr "_Ny anteckning" - -#: ../src/notebooks/notebookapplicationaddin.cpp:114 -msgid "Create a new note in this notebook" -msgstr "Skapa en ny anteckning i detta anteckningsblock" - -#: ../src/notebooks/notebookapplicationaddin.cpp:118 -msgid "_Open Template Note" -msgstr "_Öppna anteckningsmall" - -#: ../src/notebooks/notebookapplicationaddin.cpp:119 -msgid "Open this notebook's template note" -msgstr "Öppna anteckningsmallen för detta anteckningsblock" - -#: ../src/notebooks/notebookapplicationaddin.cpp:123 -msgid "Delete Note_book" -msgstr "Ta bort antecknings_block" - -#: ../src/notebooks/notebookapplicationaddin.cpp:124 -msgid "Delete the selected notebook" -msgstr "Ta bort det valda anteckningsblocket" - -#: ../src/notebooks/notebookapplicationaddin.cpp:128 -#: ../src/recentchanges.cpp:296 -msgid "Notebooks" -msgstr "Anteckningsblock" - #. The templateNoteTite should show the name of the #. notebook. For example, if the name of the notebooks #. "Meetings", the templateNoteTitle should be "Meetings #. Notebook Template". Translators should place the #. name of the notebook accordingly using "%1%". -#: ../src/notebooks/notebook.cpp:87 +#: ../src/notebooks/notebook.cpp:109 msgid "%1% Notebook Template" msgstr "Anteckningsmall för %1%" -#: ../src/notebooks/notebook.cpp:167 -#: ../src/notemanager.cpp:555 +#: ../src/notebooks/notebook.cpp:185 ../src/notemanagerbase.cpp:301 msgid "New Note" msgstr "Ny anteckning" -#: ../src/notebooks/notebook.cpp:207 -msgid "All Notes" -msgstr "Alla anteckningar" - -#: ../src/notebooks/notebook.cpp:219 -msgid "Unfiled Notes" -msgstr "Ej arkiverade anteckningar" - -#: ../src/notebooks/notebookmanager.cpp:337 +#: ../src/notebooks/notebookmanager.cpp:364 msgid "Really delete this notebook?" msgstr "Verkligen ta bort detta anteckningsblock?" -#: ../src/notebooks/notebookmanager.cpp:338 -msgid "The notes that belong to this notebook will not be deleted, but they will no longer be associated with this notebook. This action cannot be undone." -msgstr "Anteckningarna som tillhör detta anteckningsblock kommer inte att tas bort men de kommer inte längre att vara associerade med detta anteckningsblock. Denna åtgärd kan inte ångras." +#: ../src/notebooks/notebookmanager.cpp:365 +msgid "" +"The notes that belong to this notebook will not be deleted, but they will no " +"longer be associated with this notebook. This action cannot be undone." +msgstr "" +"Anteckningarna som tillhör detta anteckningsblock kommer inte att tas bort " +"men de kommer inte längre att vara associerade med detta anteckningsblock. " +"Denna åtgärd kan inte ångras." #: ../src/notebooks/notebookmenuitem.cpp:35 msgid "No notebook" msgstr "Inget anteckningsblock" -#: ../src/notebooks/notebooknewnotemenuitem.cpp:39 +#: ../src/notebooks/notebooknewnotemenuitem.cpp:40 msgid "New \"%1%\" Note" msgstr "Ny \"%1%\"-anteckning" -#: ../src/notebooks/notebooknoteaddin.cpp:86 +#: ../src/notebooks/notebooknoteaddin.cpp:81 msgid "Place this note into a notebook" msgstr "Placera denna anteckning i ett anteckningsblock" -#: ../src/notebooks/notebooknoteaddin.cpp:196 +#: ../src/notebooks/notebooknoteaddin.cpp:191 msgid "Notebook" msgstr "Anteckningsblock" -#: ../src/notebooks/notebooknoteaddin.cpp:222 +#: ../src/notebooks/notebooknoteaddin.cpp:214 msgid "_New notebook..." msgstr "_Nytt anteckningsblock..." +#: ../src/notebooks/specialnotebooks.cpp:46 +msgid "All" +msgstr "Alla" + +#: ../src/notebooks/specialnotebooks.cpp:75 +#, fuzzy +#| msgid "Unfiled Notes" +msgid "Unfiled" +msgstr "Ej arkiverade anteckningar" + +#: ../src/notebooks/specialnotebooks.cpp:106 +msgid "Important" +msgstr "" + +#: ../src/notebooks/specialnotebooks.cpp:133 +msgid "Active" +msgstr "" + +#: ../src/notebuffer.cpp:1505 +msgid " tag mismatch" +msgstr "" + +#: ../src/notebuffer.cpp:1584 +#, fuzzy, c-format +#| msgid "Exception occurred: {0}" +msgid "Exception: %s" +msgstr "Undantag inträffade: {0}" + +#. TRANSLATORS: %1% will be replaced by note title +#: ../src/note.cpp:59 +#, fuzzy +#| msgid "Really delete %1% note?" +#| msgid_plural "Really delete %1% notes?" +msgid "Really delete \"%1%\"?" +msgstr "Verkligen ta bort %1% anteckning?" + #. TRANSLATORS: %1% is number of notes -#: ../src/note.cpp:74 +#: ../src/note.cpp:63 msgid "Really delete %1% note?" msgid_plural "Really delete %1% notes?" msgstr[0] "Verkligen ta bort %1% anteckning?" msgstr[1] "Verkligen ta bort %1% anteckningar?" -#: ../src/note.cpp:81 +#: ../src/note.cpp:70 msgid "If you delete a note it is permanently lost." msgstr "Om du tar bort en anteckning försvinner den för alltid." -#: ../src/note.cpp:117 +#: ../src/note.cpp:106 msgid "Error saving note data." msgstr "Fel vid sparande av anteckningsdata." -#: ../src/note.cpp:118 -msgid "An error occurred while saving your notes. Please check that you have sufficient disk space, and that you have appropriate rights on ~/.gnote. Error details can be found in ~/.gnote.log." -msgstr "Ett fel inträffade när dina anteckningar sparades. Kontrollera att du har tillräckligt mycket diskutrymme och att du har lämpliga rättigheter på ~/.gnote. Mer information kan hittas i ~/.gnote.log." - -#. New Note Template -#. Translators: This is 'New Note' Template, not New 'Note Template' -#: ../src/notemanager.cpp:112 -#: ../src/preferencesdialog.cpp:323 +#: ../src/note.cpp:107 +#, fuzzy +#| msgid "" +#| "An error occurred while saving your notes. Please check that you have " +#| "sufficient disk space, and that you have appropriate rights on ~/.gnote. " +#| "Error details can be found in ~/.gnote.log." +msgid "" +"An error occurred while saving your notes. Please check that you have " +"sufficient disk space, and that you have appropriate rights on ~/.local/" +"share/gnote. Error details can be found in ~/.gnote.log." +msgstr "" +"Ett fel inträffade när dina anteckningar sparades. Kontrollera att du har " +"tillräckligt mycket diskutrymme och att du har lämpliga rättigheter på ~/." +"gnote. Mer information kan hittas i ~/.gnote.log." + +#: ../src/note.cpp:474 +#, fuzzy, c-format +#| msgid "Error saving icon" +msgid "Error while saving: %s" +msgstr "Fel vid sparandet av ikon" + +#: ../src/note.cpp:699 +msgid "Setting text content for closed notes not supported" +msgstr "" + +#: ../src/notemanagerbase.cpp:105 ../src/preferencesdialog.cpp:320 msgid "New Note Template" msgstr "Ny anteckningsmall" -#: ../src/notemanager.cpp:249 +#: ../src/notemanagerbase.cpp:359 +msgid "Describe your new note here." +msgstr "Beskriv din nya anteckning här." + +#: ../src/notemanager.cpp:133 msgid "" -"Start Here\n" +"Start " +"Here\n" "\n" "Welcome to Gnote!\n" "\n" "Use this \"Start Here\" note to begin organizing your ideas and thoughts.\n" "\n" -"You can create new notes to hold your ideas by selecting the \"Create New Note\" item from the Gnote menu in your GNOME Panel. Your note will be saved automatically.\n" +"You can create new notes to hold your ideas by selecting the \"Create New " +"Note\" item from the Gnote menu in your GNOME Panel. Your note will be saved " +"automatically.\n" "\n" -"Then organize the notes you create by linking related notes and ideas together!\n" +"Then organize the notes you create by linking related notes and ideas " +"together!\n" "\n" -"We've created a note called Using Links in Gnote. Notice how each time we type Using Links in Gnote it automatically gets underlined? Click on the link to open the note." +"We've created a note called Using Links in Gnote. Notice how each time we type Using Links in " +"Gnote it automatically gets underlined? Click on the link " +"to open the note." msgstr "" -"Börja här\n" +"Börja " +"här\n" "\n" "Välkommen till Gnote!\n" "\n" -"Använd anteckningen \"Börja här\" för att börja organisera dina idéer och tankar.\n" +"Använd anteckningen \"Börja här\" för att börja organisera dina idéer och " +"tankar.\n" "\n" -"Du kan skapa nya anteckningar som innehåller dina idéer genom att välja \"Skapa ny anteckning\" från Gnote-menyn i din GNOME-panel. Din anteckning kommer att sparas automatiskt.\n" +"Du kan skapa nya anteckningar som innehåller dina idéer genom att välja " +"\"Skapa ny anteckning\" från Gnote-menyn i din GNOME-panel. Din anteckning " +"kommer att sparas automatiskt.\n" "\n" -"Organisera sedan anteckningarna som du skapar genom att länka relaterade anteckningar och idéer till varandra!\n" +"Organisera sedan anteckningarna som du skapar genom att länka relaterade " +"anteckningar och idéer till varandra!\n" "\n" -"Vi har skapat en anteckning kallad Användning av länkar i Gnote. Observera att varje gång vi skriver Användning av länkar i Gnote så blir den automatiskt understruken? Klicka på länken för att öppna anteckningen." +"Vi har skapat en anteckning kallad Användning av länkar i " +"Gnote. Observera att varje gång vi skriver Användning av länkar i Gnote så blir den " +"automatiskt understruken? Klicka på länken för att öppna anteckningen." -#: ../src/notemanager.cpp:268 +#: ../src/notemanager.cpp:152 msgid "" "Using Links in Gnote\n" "\n" -"Notes in Gnote can be linked together by highlighting text in the current note and clicking the Link button above in the toolbar. Doing so will create a new note and also underline the note's title in the current note.\n" +"Notes in Gnote can be linked together by highlighting text in the current " +"note and clicking the Link button above in the toolbar. Doing " +"so will create a new note and also underline the note's title in the current " +"note.\n" "\n" -"Changing the title of a note will update links present in other notes. This prevents broken links from occurring when a note is renamed.\n" +"Changing the title of a note will update links present in other notes. This " +"prevents broken links from occurring when a note is renamed.\n" "\n" -"Also, if you type the name of another note in your current note, it will automatically be linked for you." +"Also, if you type the name of another note in your current note, it will " +"automatically be linked for you." msgstr "" "Användning av länkar i Gnote\n" "\n" -"Anteckningar i Gnote kan länkas samman genom att markera text i den aktuella anteckningen och sedan klicka på knappen Länka ovanför i verktygsraden. Det innebär att en ny anteckning skapas samt att anteckningens titel kommer att understrykas i den aktuella anteckningen.\n" +"Anteckningar i Gnote kan länkas samman genom att markera text i den aktuella " +"anteckningen och sedan klicka på knappen Länka ovanför i " +"verktygsfältet. Det innebär att en ny anteckning skapas samt att " +"anteckningens titel kommer att understrykas i den aktuella anteckningen.\n" "\n" -"Ändring av titeln för en anteckning kommer även att uppdatera de länkar som finns i andra anteckningar. Det här förhindrar att länkarna pekar fel när en anteckning byter namn.\n" +"Ändring av titeln för en anteckning kommer även att uppdatera de länkar som " +"finns i andra anteckningar. Det här förhindrar att länkarna pekar fel när " +"en anteckning byter namn.\n" "\n" -"Om du skriver in namnet på en annan anteckning i din aktuella anteckning, kommer den automatiskt att länkas åt dig." +"Om du skriver in namnet på en annan anteckning i din aktuella anteckning, " +"kommer den automatiskt att länkas åt dig." #. Attempt to find an existing Start Here note -#: ../src/notemanager.cpp:283 -#: ../src/notemanager.cpp:336 +#: ../src/notemanager.cpp:167 ../src/notemanager.cpp:208 msgid "Start Here" msgstr "Börja här" -#: ../src/notemanager.cpp:289 +#: ../src/notemanager.cpp:173 msgid "Using Links in Gnote" msgstr "Användning av länkar i Gnote" -#: ../src/notemanager.cpp:666 -msgid "Describe your new note here." -msgstr "Beskriv din nya anteckning här." +#: ../src/notemanager.cpp:178 +#, fuzzy, c-format +#| msgid "Error printing note" +msgid "Error creating start notes: %s" +msgstr "Fel vid utskrift av anteckning" -#: ../src/noterenamedialog.cpp:121 +#. TRANSLATORS: first %s is file, second is error +#: ../src/notemanager.cpp:196 +#, c-format +msgid "Error parsing note XML, skipping \"%s\": %s" +msgstr "" + +#: ../src/noterenamedialog.cpp:123 msgid "Rename Note Links?" msgstr "Byt namn på anteckningslänkar?" -#: ../src/noterenamedialog.cpp:125 +#: ../src/noterenamedialog.cpp:127 msgid "_Don't Rename Links" msgstr "Byt _inte namn på länkar" -#: ../src/noterenamedialog.cpp:126 +#: ../src/noterenamedialog.cpp:128 msgid "_Rename Links" msgstr "_Byt namn på länkar" -#: ../src/noterenamedialog.cpp:127 +#: ../src/noterenamedialog.cpp:129 msgid "Select All" msgstr "Markera allt" -#: ../src/noterenamedialog.cpp:128 +#: ../src/noterenamedialog.cpp:130 msgid "Select None" msgstr "Markera inget" -#: ../src/noterenamedialog.cpp:129 +#: ../src/noterenamedialog.cpp:131 msgid "Always show this _window" msgstr "Visa alltid _det här fönstret" -#: ../src/noterenamedialog.cpp:130 +#: ../src/noterenamedialog.cpp:132 msgid "Alwa_ys rename links" msgstr "Byt allt_id namn på länkar" -#: ../src/noterenamedialog.cpp:132 +#: ../src/noterenamedialog.cpp:134 msgid "Never rename _links" msgstr "Byt aldrig namn på _länkar" -#: ../src/noterenamedialog.cpp:151 +#: ../src/noterenamedialog.cpp:152 +#, fuzzy +#| msgid "" +#| "Rename links in other notes from \"%1\" " +#| "to\"%2\"?\n" +#| "\n" +#| "If you do not rename the links, they will no longer link to anything." msgid "" -"Rename links in other notes from \"%1\" to\"%2\"?\n" +"Rename links in other notes from \"%1\" to " +"\"%2\"?\n" "\n" "If you do not rename the links, they will no longer link to anything." msgstr "" -"Byt namn på länkar i andra anteckningar från \"%1\" till \"%2\"?\n" +"Byt namn på länkar i andra anteckningar från \"" +"%1\" till \"%2\"?\n" "\n" -"Om du inte byter namn på länkarna så kommer de inte längre att länka till någonting." +"Om du inte byter namn på länkarna så kommer de inte längre att länka till " +"någonting." -#: ../src/noterenamedialog.cpp:184 +#: ../src/noterenamedialog.cpp:185 msgid "Rename Links" msgstr "Byt namn på länkar" -#: ../src/noterenamedialog.cpp:199 -#: ../src/synchronization/syncdialog.cpp:367 +#: ../src/noterenamedialog.cpp:200 ../src/synchronization/syncdialog.cpp:331 msgid "Note Title" msgstr "Anteckningstitel" -#: ../src/noterenamedialog.cpp:235 +#: ../src/noterenamedialog.cpp:237 msgid "Ad_vanced" msgstr "A_vancerat" -#: ../src/notewindow.cpp:84 -msgid "Find in This Note" -msgstr "Sök i den här anteckningen" - -#: ../src/notewindow.cpp:337 +#: ../src/notewindow.cpp:372 msgid "_Link to New Note" msgstr "_Länka till ny anteckning" -#: ../src/notewindow.cpp:345 +#: ../src/notewindow.cpp:380 msgid "Te_xt" msgstr "Te_xt" -#: ../src/notewindow.cpp:354 -msgid "_Find in This Note" -msgstr "_Sök i den här anteckningen" - -#: ../src/notewindow.cpp:369 -msgid "Clos_e All Notes" -msgstr "S_täng alla anteckningar" - -#: ../src/notewindow.cpp:404 -msgid "Search" -msgstr "Sök" - -#: ../src/notewindow.cpp:408 -msgid "Search your notes (Ctrl-Shift-F)" -msgstr "Sök i dina anteckningar (Ctrl-Skift-F)" - -# Hoppas detta är verbet... -#: ../src/notewindow.cpp:418 -msgid "Link" -msgstr "Länka" - -#: ../src/notewindow.cpp:424 -msgid "Link selected text to a new note (Ctrl-L)" -msgstr "Länka markerad text till en ny anteckning (Ctrl-L)" - -#: ../src/notewindow.cpp:433 -msgid "_Text" -msgstr "_Text" - -#: ../src/notewindow.cpp:439 +#: ../src/notewindow.cpp:417 msgid "Set properties of text" msgstr "Ställ in textegenskaper" -#: ../src/notewindow.cpp:443 -msgid "T_ools" -msgstr "_Verktyg" +#: ../src/notewindow.cpp:421 +msgid "Is Important" +msgstr "" + +#: ../src/notewindow.cpp:422 +msgid "Toggle notes presence in Important Notes notebook" +msgstr "" -#: ../src/notewindow.cpp:448 -msgid "Use tools on this note" -msgstr "Använd verktyg på denna anteckning." +#: ../src/notewindow.cpp:430 ../src/searchnoteswidget.cpp:144 +#: ../src/searchnoteswidget.cpp:147 +msgid "_Delete" +msgstr "_Ta bort" -#: ../src/notewindow.cpp:458 +#: ../src/notewindow.cpp:430 msgid "Delete this note" msgstr "Ta bort denna anteckning" -#: ../src/notewindow.cpp:468 -#: ../src/synchronization/syncmanager.cpp:136 -msgid "Synchronize Notes" -msgstr "Synkronisera anteckningar" - -#: ../src/notewindow.cpp:504 -msgid "This note is a template note. It determines the default content of regular notes, and will not show up in the note menu or search window." -msgstr "Denna anteckning är en mallanteckning. Den bestämmer standardinnehållet för vanliga anteckningar och kommer inte att visas i anteckningsmenyn eller sökfönster." +#: ../src/notewindow.cpp:446 +msgid "" +"This note is a template note. It determines the default content of regular " +"notes, and will not show up in the note menu or search window." +msgstr "" +"Denna anteckning är en mallanteckning. Den bestämmer standardinnehållet för " +"vanliga anteckningar och kommer inte att visas i anteckningsmenyn eller " +"sökfönster." -#: ../src/notewindow.cpp:507 +#: ../src/notewindow.cpp:449 msgid "Convert to regular note" msgstr "Konvertera till vanlig anteckning" -#: ../src/notewindow.cpp:510 +#: ../src/notewindow.cpp:452 msgid "Save Si_ze" msgstr "Spara st_orlek" -#: ../src/notewindow.cpp:514 +#: ../src/notewindow.cpp:456 msgid "Save Se_lection" msgstr "Spara ma_rkering" -#: ../src/notewindow.cpp:518 +#: ../src/notewindow.cpp:460 msgid "Save _Title" msgstr "Spara _titel" -#: ../src/notewindow.cpp:606 -msgid "_Find..." -msgstr "_Sök..." - -#: ../src/notewindow.cpp:614 -msgid "Find _Next" -msgstr "Sök _nästa" - -#: ../src/notewindow.cpp:624 -msgid "Find _Previous" -msgstr "Sök _föregående" - -#: ../src/notewindow.cpp:694 +#: ../src/notewindow.cpp:562 ../src/notewindow.cpp:1085 msgid "Cannot create note" msgstr "Kan inte skapa anteckning" -#: ../src/notewindow.cpp:749 -msgid "_Next" -msgstr "_Nästa" - -#: ../src/notewindow.cpp:750 -msgid "_Previous" -msgstr "_Föregående" - -#: ../src/notewindow.cpp:763 -msgid "_Find:" -msgstr "_Sök:" +# Hoppas detta är verbet... +#: ../src/notewindow.cpp:828 +#, fuzzy +#| msgid "Link" +msgid "_Link" +msgstr "Länka" -#: ../src/notewindow.cpp:1205 +#: ../src/notewindow.cpp:829 msgid "_Bold" msgstr "_Fet" -#: ../src/notewindow.cpp:1206 +#: ../src/notewindow.cpp:830 msgid "_Italic" msgstr "_Kursiv" -#: ../src/notewindow.cpp:1207 +#: ../src/notewindow.cpp:831 msgid "_Strikeout" msgstr "_Genomstruken" -#: ../src/notewindow.cpp:1209 +#: ../src/notewindow.cpp:833 msgid "_Highlight" msgstr "_Markera" -#: ../src/notewindow.cpp:1211 +#: ../src/notewindow.cpp:835 msgid "_Normal" msgstr "_Normal" -#: ../src/notewindow.cpp:1213 +#: ../src/notewindow.cpp:837 msgid "Hu_ge" msgstr "_Enorm" -#: ../src/notewindow.cpp:1215 +#: ../src/notewindow.cpp:839 msgid "_Large" msgstr "_Stor" -#: ../src/notewindow.cpp:1217 +#: ../src/notewindow.cpp:841 msgid "S_mall" msgstr "_Liten" -#: ../src/notewindow.cpp:1219 +#: ../src/notewindow.cpp:843 msgid "Bullets" msgstr "Punkter" -#: ../src/notewindow.cpp:1222 -msgid "Increase Font Size" -msgstr "Öka typsnittsstorlek" - -#: ../src/notewindow.cpp:1223 -msgid "Decrease Font Size" -msgstr "Minska typsnittsstorlek" - -#: ../src/notewindow.cpp:1294 -msgid "Font Size" -msgstr "Typsnittsstorlek" - -#: ../src/preferencesdialog.cpp:119 +#: ../src/preferencesdialog.cpp:121 msgid "General" msgstr "Allmänt" -#: ../src/preferencesdialog.cpp:121 -msgid "Hotkeys" -msgstr "Snabbtangenter" +# Hoppas detta är verbet... +#: ../src/preferencesdialog.cpp:122 +#, fuzzy +#| msgid "Link" +msgid "Links" +msgstr "Länka" #. TRANSLATORS: Addin category. -#: ../src/preferencesdialog.cpp:124 -#: ../src/sharp/addinstreemodel.cpp:147 +#: ../src/preferencesdialog.cpp:125 ../src/sharp/addinstreemodel.cpp:164 msgid "Synchronization" msgstr "Synkronisering" -#: ../src/preferencesdialog.cpp:126 -msgid "Add-ins" -msgstr "Tillägg" - -#. Status icon -#: ../src/preferencesdialog.cpp:228 -msgid "Use Status _Icon" -msgstr "Använd status_ikon" +#: ../src/preferencesdialog.cpp:127 +msgid "Plugins" +msgstr "Insticksmoduler" -#: ../src/preferencesdialog.cpp:241 -msgid "_Spell check while typing" -msgstr "_Stavningskontroll när text skrivs in" +#: ../src/preferencesdialog.cpp:204 +#, c-format +msgid "Plugin %s is absent" +msgstr "" -#: ../src/preferencesdialog.cpp:247 -msgid "Misspellings will be underlined in red, with correct spelling suggestions shown in the context menu." -msgstr "Felstavningar kommer att strykas under i rött, och korrekta stavningsförslag visas i sammanhangsmenyn." +#. Open in new window +#: ../src/preferencesdialog.cpp:243 +#, fuzzy +#| msgid "Always show this _window" +msgid "Always _open notes in new window" +msgstr "Visa alltid _det här fönstret" -#. WikiWords... -#: ../src/preferencesdialog.cpp:258 -msgid "Highlight _WikiWords" -msgstr "Färgmarkera _WikiOrd" +#: ../src/preferencesdialog.cpp:256 +msgid "_Spell check while typing" +msgstr "_Stavningskontroll när text skrivs in" -#: ../src/preferencesdialog.cpp:264 -msgid "Enable this option to highlight words ThatLookLikeThis. Clicking the word will create a note with that name." -msgstr "Aktivera detta alternativ för att färgmarkera ord SomSerUtSomDetta. Att klicka på ett sådant kommer att skapa en anteckning med dess namn." +#: ../src/preferencesdialog.cpp:257 +msgid "" +"Misspellings will be underlined in red, with correct spelling suggestions " +"shown in the context menu." +msgstr "" +"Felstavningar kommer att strykas under i rött, och korrekta stavningsförslag " +"visas i sammanhangsmenyn." #. Auto bulleted list -#: ../src/preferencesdialog.cpp:271 +#: ../src/preferencesdialog.cpp:267 msgid "Enable auto-_bulleted lists" msgstr "Aktivera a_utomatiska punktlistor" -#: ../src/preferencesdialog.cpp:280 +#: ../src/preferencesdialog.cpp:268 +msgid "Start new bulleted list by starting new line with character \"-\"." +msgstr "" + +#: ../src/preferencesdialog.cpp:277 msgid "Use custom _font" msgstr "Använd anpassat _typsnitt" -#: ../src/preferencesdialog.cpp:297 +#: ../src/preferencesdialog.cpp:295 msgid "When renaming a linked note: " msgstr "När en länkad anteckning byter namn: " -#: ../src/preferencesdialog.cpp:302 +#: ../src/preferencesdialog.cpp:299 msgid "Ask me what to do" msgstr "Fråga mig vad som ska göras" -#: ../src/preferencesdialog.cpp:303 +#: ../src/preferencesdialog.cpp:300 msgid "Never rename links" msgstr "Byt aldrig namn på länkar" -#: ../src/preferencesdialog.cpp:304 +#: ../src/preferencesdialog.cpp:301 msgid "Always rename links" msgstr "Byt alltid namn på länkar" -#: ../src/preferencesdialog.cpp:326 -msgid "Use the new note template to specify the text that should be used when creating a new note." -msgstr "Använd den nya anteckningsmallen för att ange texten som ska användas när en ny anteckning skapas." +#: ../src/preferencesdialog.cpp:321 +msgid "" +"Use the new note template to specify the text that should be used when " +"creating a new note." +msgstr "" +"Använd den nya anteckningsmallen för att ange texten som ska användas när en " +"ny anteckning skapas." -#: ../src/preferencesdialog.cpp:334 +#: ../src/preferencesdialog.cpp:326 msgid "Open New Note Template" msgstr "Öppna ny anteckningsmall" -#. Hotkeys... -#: ../src/preferencesdialog.cpp:396 -msgid "Listen for _Hotkeys" -msgstr "Lyssna efter _snabbtangenter" - -#: ../src/preferencesdialog.cpp:403 -msgid "Hotkeys allow you to quickly access your notes from anywhere with a keypress. Example Hotkeys: <Control><Shift>F11, <Alt>N" -msgstr "Snabbtangenter låter dig snabbt få tillgång till dina anteckningar varifrån som helst. Exempel på snabbtangenter: <Control><Shift>F11, <Alt>N" - -#. Show notes menu keybinding... -#: ../src/preferencesdialog.cpp:423 -msgid "Show notes _menu" -msgstr "Visa antecknings_meny" - -#. Open Start Here keybinding... -#: ../src/preferencesdialog.cpp:440 -msgid "Open \"_Start Here\"" -msgstr "Öppna \"_Börja här\"" - -#. Create new note keybinding... -#: ../src/preferencesdialog.cpp:456 -msgid "Create _new note" -msgstr "Skapa _ny anteckning" +#. internal links +#: ../src/preferencesdialog.cpp:383 +msgid "_Automatically link to notes" +msgstr "" + +#: ../src/preferencesdialog.cpp:384 +msgid "Enable this option to create a link when text matches note title." +msgstr "" + +#. URLs +#: ../src/preferencesdialog.cpp:390 +msgid "Create links for _URLs" +msgstr "" -#. Open Search All Notes window keybinding... -#: ../src/preferencesdialog.cpp:472 -msgid "Open \"Search _All Notes\"" -msgstr "Öppna \"Sök i _alla anteckningar\"" +#: ../src/preferencesdialog.cpp:391 +msgid "" +"Enable this option to create links for URLs. Clicking will open URL with " +"appropriate program." +msgstr "" + +#. WikiWords... +#: ../src/preferencesdialog.cpp:398 +msgid "Highlight _WikiWords" +msgstr "Färgmarkera _WikiOrd" + +#: ../src/preferencesdialog.cpp:399 +msgid "" +"Enable this option to highlight words ThatLookLikeThis. Clicking the " +"word will create a note with that name." +msgstr "" +"Aktivera detta alternativ för att färgmarkera ord SomSerUtSomDetta. " +"Att klicka på ett sådant kommer att skapa en anteckning med dess namn." -#: ../src/preferencesdialog.cpp:509 +#: ../src/preferencesdialog.cpp:431 msgid "Ser_vice:" msgstr "T_jänst:" -#: ../src/preferencesdialog.cpp:565 -#: ../src/preferencesdialog.cpp:1120 +#: ../src/preferencesdialog.cpp:487 ../src/preferencesdialog.cpp:1117 msgid "Not configurable" msgstr "Inte konfigurerbar" +#: ../src/preferencesdialog.cpp:514 +#, fuzzy +#| msgid "Automatic Background Synchronization Timeout" +msgid "Automatical background s_ync interval (minutes)" +msgstr "Tidsgräns överstegs för automatisk bakgrundssynkronisering" + #. "Advanced..." button to bring up extra sync config dialog -#: ../src/preferencesdialog.cpp:585 +#: ../src/preferencesdialog.cpp:538 msgid "_Advanced..." msgstr "_Avancerat..." -#: ../src/preferencesdialog.cpp:630 -msgid "The following add-ins are installed" +#: ../src/preferencesdialog.cpp:585 +#, fuzzy +#| msgid "The following add-ins are installed" +msgid "The following plugins are installed:" msgstr "Följande tillägg är installerade" #. TODO: In a future version, add in an "Install Add-ins..." button #. TODO: In a future version, add in a "Repositories..." button -#: ../src/preferencesdialog.cpp:661 +#: ../src/preferencesdialog.cpp:620 msgid "_Enable" msgstr "_Aktivera" -#: ../src/preferencesdialog.cpp:667 +#: ../src/preferencesdialog.cpp:626 msgid "_Disable" msgstr "_Inaktivera" -#: ../src/preferencesdialog.cpp:798 +#: ../src/preferencesdialog.cpp:784 msgid "Not Implemented" msgstr "Inte implementerad" -#: ../src/preferencesdialog.cpp:812 +#: ../src/preferencesdialog.cpp:800 msgid "%1% Preferences" msgstr "Inställningar för %1%" -#: ../src/preferencesdialog.cpp:953 +#: ../src/preferencesdialog.cpp:935 msgid "Choose Note Font" msgstr "Välj anteckningstypsnitt" #. Create dialog -#: ../src/preferencesdialog.cpp:1036 +#: ../src/preferencesdialog.cpp:1033 msgid "Other Synchronization Options" msgstr "Andra synkroniseringsalternativ" -#: ../src/preferencesdialog.cpp:1039 -msgid "When a conflict is detected between a local note and a note on the configured synchronization server:" -msgstr "När en konflikt upptäcks mellan en lokal anteckning och en anteckning på den konfigurerade synkroniseringsservern:" +#: ../src/preferencesdialog.cpp:1036 +msgid "" +"When a conflict is detected between a local note and a note on the " +"configured synchronization server:" +msgstr "" +"När en konflikt upptäcks mellan en lokal anteckning och en anteckning på den " +"konfigurerade synkroniseringsservern:" #. label.Xalign = 0; -#: ../src/preferencesdialog.cpp:1043 -msgid "Always ask me what to do." +#: ../src/preferencesdialog.cpp:1040 +#, fuzzy +#| msgid "Always ask me what to do." +msgid "Always ask me what to do" msgstr "Fråga mig vad som ska göras." -#: ../src/preferencesdialog.cpp:1047 -msgid "Rename my local note." +#: ../src/preferencesdialog.cpp:1044 +#, fuzzy +#| msgid "Rename my local note." +msgid "Rename my local note" msgstr "Byt namn på min lokala anteckning." -#: ../src/preferencesdialog.cpp:1051 -msgid "Replace my local note with the server's update." +#: ../src/preferencesdialog.cpp:1048 +#, fuzzy +#| msgid "Replace my local note with the server's update." +msgid "Replace my local note with the server's update" msgstr "Ersätt min lokal anteckning med serverns uppdatering." -#: ../src/preferencesdialog.cpp:1159 +#: ../src/preferencesdialog.cpp:1150 msgid "Are you sure?" msgstr "Är du säker?" -#: ../src/preferencesdialog.cpp:1160 -msgid "Clearing your synchronization settings is not recommended. You may be forced to synchronize all of your notes again when you save new settings." -msgstr "Tömning av dina synkroniseringsinställningar rekommenderas inte. Du kan tvingas att synkronisera alla dina anteckningar igen när du sparar nya inställningar." +#: ../src/preferencesdialog.cpp:1151 +msgid "" +"Clearing your synchronization settings is not recommended. You may be " +"forced to synchronize all of your notes again when you save new settings." +msgstr "" +"Tömning av dina synkroniseringsinställningar rekommenderas inte. Du kan " +"tvingas att synkronisera alla dina anteckningar igen när du sparar nya " +"inställningar." -#: ../src/preferencesdialog.cpp:1169 +#: ../src/preferencesdialog.cpp:1161 msgid "Resetting Synchronization Settings" msgstr "Återställer synkroniseringsinställningar" -#: ../src/preferencesdialog.cpp:1170 -msgid "You have disabled the configured synchronization service. Your synchronization settings will now be cleared. You may be forced to synchronize all of your notes again when you save new settings." -msgstr "Du har inaktiverat den konfigurerade synkroniseringstjänsten. Dina synkroniseringsinställningar kommer nu att tas bort. Du kan tvingas att synkronisera alla dina anteckningar igen när du sparar nya inställningar." +#: ../src/preferencesdialog.cpp:1162 +msgid "" +"You have disabled the configured synchronization service. Your " +"synchronization settings will now be cleared. You may be forced to " +"synchronize all of your notes again when you save new settings." +msgstr "" +"Du har inaktiverat den konfigurerade synkroniseringstjänsten. Dina " +"synkroniseringsinställningar kommer nu att tas bort. Du kan tvingas att " +"synkronisera alla dina anteckningar igen när du sparar nya inställningar." -#: ../src/preferencesdialog.cpp:1236 +#: ../src/preferencesdialog.cpp:1228 msgid "Connection successful" msgstr "Anslutningen lyckades" -#: ../src/preferencesdialog.cpp:1237 -msgid "Gnote is ready to synchronize your notes. Would you like to synchronize them now?" -msgstr "Gnote är redo att synkronisera dina anteckningar. Vill du synkronisera dem nu?" - -#: ../src/preferencesdialog.cpp:1260 -msgid "Please check your information and try again. The log file {0} may contain more information about the error." -msgstr "Kontrollera din information och försök igen. Loggfilen {0} kan innehålla mer information om felet." +#: ../src/preferencesdialog.cpp:1229 +msgid "" +"Gnote is ready to synchronize your notes. Would you like to synchronize them " +"now?" +msgstr "" +"Gnote är redo att synkronisera dina anteckningar. Vill du synkronisera dem " +"nu?" + +#: ../src/preferencesdialog.cpp:1253 +#, fuzzy +#| msgid "" +#| "Please check your information and try again. The log file {0} may " +#| "contain more information about the error." +msgid "" +"Please check your information and try again. The log file %1% may contain " +"more information about the error." +msgstr "" +"Kontrollera din information och försök igen. Loggfilen {0} kan innehålla " +"mer information om felet." -#: ../src/preferencesdialog.cpp:1267 +#: ../src/preferencesdialog.cpp:1258 msgid "Error connecting" msgstr "Fel vid anslutning" -#: ../src/preferencesdialog.cpp:1331 -msgid "Version:" -msgstr "Version:" +#: ../src/preferencesdialog.cpp:1321 +msgid "Version:" +msgstr "Version:" + +#: ../src/preferencesdialog.cpp:1324 +msgid "Author:" +msgstr "Upphovsman:" + +#: ../src/preferencesdialog.cpp:1329 +msgid "Copyright:" +msgstr "Copyright:" + +#: ../src/recentchanges.cpp:129 +msgid "All Notes" +msgstr "Alla anteckningar" + +#: ../src/recentchanges.cpp:135 +#, fuzzy +#| msgid "_New" +msgid "New" +msgstr "_Ny" + +#: ../src/recentchanges.cpp:156 +msgid "Search" +msgstr "Sök" + +#: ../src/recentchanges.cpp:197 +msgid "Find _Next" +msgstr "Sök _nästa" + +#: ../src/recentchanges.cpp:205 +msgid "Find _Previous" +msgstr "Sök _föregående" + +#: ../src/recentchanges.cpp:673 +msgid "_Close" +msgstr "S_täng" -#: ../src/preferencesdialog.cpp:1336 -msgid "Author:" -msgstr "Upphovsman:" +#: ../src/remotecontrolproxy.cpp:57 +#, c-format +msgid "Failed to load D-Bus interface %s: %s" +msgstr "" -#: ../src/preferencesdialog.cpp:1342 -msgid "Copyright:" -msgstr "Copyright:" +#: ../src/searchnoteswidget.cpp:137 +#, fuzzy +#| msgid "_Open..." +msgid "_Open" +msgstr "_Öppna..." -#: ../src/recentchanges.cpp:93 -msgid "Search All Notes" -msgstr "Sök i alla anteckningar" +#: ../src/searchnoteswidget.cpp:140 +msgid "Open In New _Window" +msgstr "" -#: ../src/recentchanges.cpp:115 -msgid "_Search:" -msgstr "_Sök:" +#: ../src/searchnoteswidget.cpp:150 +#, fuzzy +#| msgid "User_name:" +msgid "Re_name..." +msgstr "Användar_namn:" -#: ../src/recentchanges.cpp:373 +#: ../src/searchnoteswidget.cpp:659 msgid "Note" msgstr "Anteckning" -#: ../src/recentchanges.cpp:395 -msgid "Last Changed" -msgstr "Senast ändrad" +#: ../src/searchnoteswidget.cpp:681 +msgid "Modified" +msgstr "" + +#: ../src/searchnoteswidget.cpp:1000 +msgid "Notes" +msgstr "Anteckningar" + +#: ../src/searchnoteswidget.cpp:1019 +msgid "" +"No results found in the selected notebook.\n" +"Click here to search across all notes." +msgstr "" +"Inga resultat hittades i markerad anteckningsbok.\n" +"Klicka här för att söka igenom alla anteckningar." + +#: ../src/searchnoteswidget.cpp:1023 +msgid "Click here to search across all notebooks" +msgstr "Klicka här för att söka igenom alla anteckningsböcker" -#: ../src/recentchanges.cpp:580 +#: ../src/searchnoteswidget.cpp:1044 msgid "Matches" msgstr "Träffar" #. TRANSLATORS: search found a match in note title -#: ../src/recentchanges.cpp:634 +#: ../src/searchnoteswidget.cpp:1096 msgid "Title match" msgstr "Titelmatchning" -#: ../src/recentchanges.cpp:638 +#: ../src/searchnoteswidget.cpp:1100 msgid "%1% match" msgid_plural "%1% matches" msgstr[0] "%1% träff" msgstr[1] "%1% träffar" -#: ../src/recentchanges.cpp:652 -msgid "Total: %1% note" -msgid_plural "Total: %1% notes" -msgstr[0] "Totalt: %1% anteckning" -msgstr[1] "Totalt: %1% anteckningar" +#: ../src/searchnoteswidget.cpp:1311 +msgid "_New" +msgstr "_Ny" -#: ../src/recentchanges.cpp:668 -msgid "Matches: %1% note" -msgid_plural "Matches: %1% notes" -msgstr[0] "Sökträffar: %1% anteckning" -msgstr[1] "Sökträffar: %1% anteckningar" +#: ../src/searchnoteswidget.cpp:1340 +msgid "_Open Template Note" +msgstr "_Öppna anteckningsmall" -#: ../src/recentchanges.cpp:684 -msgid "" -"No results found in the selected notebook.\n" -"Click here to search across all notes." +#: ../src/searchnoteswidget.cpp:1351 +#, fuzzy +#| msgid "_New" +msgid "_New..." +msgstr "_Ny" + +#: ../src/searchnoteswidget.cpp:1487 ../src/searchnoteswidget.cpp:1500 +#: ../src/searchnoteswidget.cpp:1511 +#, c-format +msgid "Failed to parse setting %s (Value: %s):" msgstr "" -"Inga resultat hittades i markerad anteckningsbok.\n" -"Klicka här för att söka igenom alla anteckningar." -#: ../src/recentchanges.cpp:688 -msgid "Click here to search across all notebooks" -msgstr "Klicka här för att söka igenom alla anteckningsböcker" +#: ../src/searchnoteswidget.cpp:1488 +msgid "Expected format 'column:order'" +msgstr "" -#: ../src/recentchanges.cpp:863 -msgid "Notes" -msgstr "Anteckningar" +#: ../src/searchnoteswidget.cpp:1501 +#, c-format +msgid "Unrecognized column %s" +msgstr "" + +#: ../src/searchnoteswidget.cpp:1512 +#, c-format +msgid "Unrecognized order %s" +msgstr "" -#: ../src/sharp/addinstreemodel.cpp:93 +#: ../src/sharp/addinstreemodel.cpp:109 msgid "Name" msgstr "Namn" -#: ../src/sharp/addinstreemodel.cpp:105 +#: ../src/sharp/addinstreemodel.cpp:121 msgid "Version" msgstr "Version" #. TRANSLATORS: Addin category. -#: ../src/sharp/addinstreemodel.cpp:138 +#: ../src/sharp/addinstreemodel.cpp:155 msgid "Formatting" msgstr "Formatering" #. TRANSLATORS: Addin category. -#: ../src/sharp/addinstreemodel.cpp:141 +#: ../src/sharp/addinstreemodel.cpp:158 msgid "Desktop integration" msgstr "Skrivbordsintegration" #. TRANSLATORS: Addin category. -#: ../src/sharp/addinstreemodel.cpp:144 +#: ../src/sharp/addinstreemodel.cpp:161 msgid "Tools" msgstr "Verktyg" #. TRANSLATORS: Addin category is unknown. -#: ../src/sharp/addinstreemodel.cpp:151 +#: ../src/sharp/addinstreemodel.cpp:168 msgid "Unknown" msgstr "Okänd" -#: ../src/synchronization/syncdialog.cpp:110 +#: ../src/sharp/modulemanager.cpp:62 +#, fuzzy, c-format +#| msgid "Error saving icon" +msgid "Error loading %s" +msgstr "Fel vid sparandet av ikon" + +#: ../src/sharp/modulemanager.cpp:69 +#, c-format +msgid "Error getting symbol dynamic_module_instanciate: %s" +msgstr "" + +#: ../src/sharp/xmlreader.cpp:195 +#, c-format +msgid "XML error: %s" +msgstr "" + +#: ../src/sharp/xmlreader.cpp:195 +msgid "unknown parse error" +msgstr "" + +#: ../src/sharp/xmlwriter.cpp:40 +msgid "%1% failed" +msgstr "" + +#: ../src/sharp/xsltransform.cpp:67 +msgid "NULL stylesheet, please fill a bug" +msgstr "" + +#: ../src/synchronization/filesystemsyncserver.cpp:369 +#, c-format +msgid "" +"Exception during server cleanup while committing. Server integrity is OK, " +"but there may be some excess files floating around. Here's the error: %s\n" +msgstr "" + +#: ../src/synchronization/filesystemsyncserver.cpp:609 +#, fuzzy, c-format +#| msgid "Error connecting to the synchronization service. Please try again." +msgid "Error deleting the old synchronization lock \"%s\": %s" +msgstr "Fel vid anslutning till synkroniseringstjänsten. Försök igen." + +#: ../src/synchronization/fusesyncserviceaddin.cpp:115 +#, fuzzy +#| msgid "" +#| "This synchronization addin is not supported on your computer. Please make " +#| "sure you have FUSE and {0} correctly installed and configured" +msgid "" +"This synchronization addin is not supported on your computer. Please make " +"sure you have FUSE and %1% correctly installed and configured" +msgstr "" +"Det här synkroniseringstillägget stöds inte på din dator. Försäkra dig om " +"att du har FUSE och {0} korrekt installerade och konfigurerade" + +#: ../src/synchronization/fusesyncserviceaddin.cpp:158 +msgid "Could not read testfile." +msgstr "Kunde inte läsa testfilen. " + +#: ../src/synchronization/fusesyncserviceaddin.cpp:167 +msgid "Write test failed." +msgstr "Skrivtestet misslyckades." + +#: ../src/synchronization/fusesyncserviceaddin.cpp:196 +msgid "Timeout connecting to server." +msgstr "Tidsgränsen överstegs vid anslutning till server." + +#: ../src/synchronization/fusesyncserviceaddin.cpp:202 +msgid "Error connecting to server." +msgstr "Fel vid anslutning till servern." + +#: ../src/synchronization/fusesyncserviceaddin.cpp:215 +msgid "FUSE could not be enabled." +msgstr "FUSE kunde inte aktiveras." + +#: ../src/synchronization/fusesyncserviceaddin.cpp:246 +#, fuzzy +#| msgid "An error ocurred while connecting to the specified server:" +msgid "An error occurred while connecting to the specified server" +msgstr "Ett fel inträffade vid anslutning till den angivna servern:" + +#. TRANSLATORS: %s is file +#: ../src/synchronization/gnotesyncclient.cpp:165 +#, c-format +msgid "Unparsable last-sync-date element in %s" +msgstr "" + +#. TRANSLATORS: %s is file +#: ../src/synchronization/gnotesyncclient.cpp:175 +#, c-format +msgid "Unparsable last-sync-rev element in %s" +msgstr "" + +#: ../src/synchronization/syncdialog.cpp:64 msgid "Note Conflict" msgstr "Anteckningskonflikt" #. Suggest renaming note by appending " (old)" to the existing title -#: ../src/synchronization/syncdialog.cpp:115 +#: ../src/synchronization/syncdialog.cpp:69 msgid " (old)" msgstr " (gammal)" -#: ../src/synchronization/syncdialog.cpp:157 +#: ../src/synchronization/syncdialog.cpp:114 msgid "Rename local note:" msgstr "Byt namn på lokal anteckning:" -#: ../src/synchronization/syncdialog.cpp:164 +#: ../src/synchronization/syncdialog.cpp:121 msgid "Update links in referencing notes" msgstr "Uppdatera länkar i refererande anteckningar" -#: ../src/synchronization/syncdialog.cpp:171 +#: ../src/synchronization/syncdialog.cpp:127 msgid "Overwrite local note" msgstr "Skriv över lokal anteckning" -#: ../src/synchronization/syncdialog.cpp:175 +#: ../src/synchronization/syncdialog.cpp:131 msgid "Always perform this action" msgstr "Genomför alltid den här åtgärden" #. Set initial dialog text -#: ../src/synchronization/syncdialog.cpp:181 +#: ../src/synchronization/syncdialog.cpp:137 msgid "Note conflict detected" msgstr "Anteckningskonflikt upptäcktes" -#: ../src/synchronization/syncdialog.cpp:183 -msgid "The server version of \"%1%\" conflicts with your local note. What do you want to do with your local note?" -msgstr "Serverversionen av \"%1%\" står i konflikt med din lokala anteckning. Vad vill du göra med din lokala anteckning?" +#: ../src/synchronization/syncdialog.cpp:139 +msgid "" +"The server version of \"%1%\" conflicts with your local note. What do you " +"want to do with your local note?" +msgstr "" +"Serverversionen av \"%1%\" står i konflikt med din lokala anteckning. Vad " +"vill du göra med din lokala anteckning?" #. Expander containing TreeView -#: ../src/synchronization/syncdialog.cpp:337 +#: ../src/synchronization/syncdialog.cpp:296 msgid "Details" msgstr "Detaljer" -#: ../src/synchronization/syncdialog.cpp:374 +#: ../src/synchronization/syncdialog.cpp:338 msgid "Status" msgstr "Status" -#: ../src/synchronization/syncdialog.cpp:531 +#: ../src/synchronization/syncdialog.cpp:483 msgid "Acquiring sync lock..." msgstr "Tar över synkroniseringslås..." -#: ../src/synchronization/syncdialog.cpp:534 +#: ../src/synchronization/syncdialog.cpp:486 msgid "Committing changes..." msgstr "Verkställer ändringar..." -#: ../src/synchronization/syncdialog.cpp:537 +#: ../src/synchronization/syncdialog.cpp:489 msgid "Synchronizing Notes" msgstr "Synkroniserar anteckningar" -#: ../src/synchronization/syncdialog.cpp:538 +#: ../src/synchronization/syncdialog.cpp:490 msgid "Synchronizing your notes..." msgstr "Synkroniserar dina anteckningar..." -#: ../src/synchronization/syncdialog.cpp:539 +#: ../src/synchronization/syncdialog.cpp:491 msgid "This may take a while, kick back and enjoy!" msgstr "Det här kan ta en stund, luta dig tillbaka och njut!" -#: ../src/synchronization/syncdialog.cpp:541 +#: ../src/synchronization/syncdialog.cpp:493 msgid "Connecting to the server..." msgstr "Ansluter till servern..." -#: ../src/synchronization/syncdialog.cpp:547 +#: ../src/synchronization/syncdialog.cpp:499 msgid "Deleting notes off of the server..." msgstr "Tar bort anteckningar från servern..." -#: ../src/synchronization/syncdialog.cpp:551 +#: ../src/synchronization/syncdialog.cpp:503 msgid "Downloading new/updated notes..." msgstr "Hämtar nya/uppdaterade anteckningar..." -#: ../src/synchronization/syncdialog.cpp:563 +#: ../src/synchronization/syncdialog.cpp:515 msgid "Server Locked" msgstr "Servern är låst" -#: ../src/synchronization/syncdialog.cpp:564 +#: ../src/synchronization/syncdialog.cpp:516 msgid "Server is locked" msgstr "Servern är låst" -#: ../src/synchronization/syncdialog.cpp:565 -msgid "One of your other computers is currently synchronizing. Please wait 2 minutes and try again." -msgstr "En av dina andra datorer synkroniserar för tillfället. Vänta 2 minuter och försök igen." +#: ../src/synchronization/syncdialog.cpp:517 +msgid "" +"One of your other computers is currently synchronizing. Please wait 2 " +"minutes and try again." +msgstr "" +"En av dina andra datorer synkroniserar för tillfället. Vänta 2 minuter och " +"försök igen." -#: ../src/synchronization/syncdialog.cpp:569 +#: ../src/synchronization/syncdialog.cpp:521 msgid "Preparing to download updates from server..." msgstr "Förbereder att hämta uppdateringar från servern..." -#: ../src/synchronization/syncdialog.cpp:572 +#: ../src/synchronization/syncdialog.cpp:524 msgid "Preparing to upload updates to server..." msgstr "Förbereder för att skicka upp uppdateringar till servern..." -#: ../src/synchronization/syncdialog.cpp:575 +#: ../src/synchronization/syncdialog.cpp:527 msgid "Uploading notes to server..." msgstr "Skickar upp anteckningar till servern..." -#: ../src/synchronization/syncdialog.cpp:578 +#: ../src/synchronization/syncdialog.cpp:530 msgid "Synchronization Failed" msgstr "Synkroniseringen misslyckades" -#: ../src/synchronization/syncdialog.cpp:579 +#: ../src/synchronization/syncdialog.cpp:531 msgid "Failed to synchronize" msgstr "Misslyckades med att synkronisera" -#: ../src/synchronization/syncdialog.cpp:580 +#: ../src/synchronization/syncdialog.cpp:532 msgid "Could not synchronize notes. Check the details below and try again." -msgstr "Kunde inte synkronisera anteckningar. Kontrollera detaljerna nedan och försök igen." +msgstr "" +"Kunde inte synkronisera anteckningar. Kontrollera detaljerna nedan och " +"försök igen." -#: ../src/synchronization/syncdialog.cpp:586 +#: ../src/synchronization/syncdialog.cpp:538 msgid "Synchronization Complete" msgstr "Synkroniseringen är färdig" -#: ../src/synchronization/syncdialog.cpp:587 +#: ../src/synchronization/syncdialog.cpp:539 msgid "Synchronization is complete" msgstr "Synkroniseringen är färdig" -#: ../src/synchronization/syncdialog.cpp:588 +#: ../src/synchronization/syncdialog.cpp:540 msgid "%1% note updated." msgid_plural "%1% notes updated." msgstr[0] "%1% anteckning uppdaterad." msgstr[1] "%1% anteckningar uppdaterade." -#: ../src/synchronization/syncdialog.cpp:589 +#: ../src/synchronization/syncdialog.cpp:541 msgid "Your notes are now up to date." msgstr "Dina anteckningar är nu uppdaterade." -#: ../src/synchronization/syncdialog.cpp:594 +#: ../src/synchronization/syncdialog.cpp:546 msgid "Synchronization Canceled" msgstr "Synkroniseringen avbröts" -#: ../src/synchronization/syncdialog.cpp:595 +#: ../src/synchronization/syncdialog.cpp:547 msgid "Synchronization was canceled" msgstr "Synkroniseringen har avbrutits" -#: ../src/synchronization/syncdialog.cpp:596 +#: ../src/synchronization/syncdialog.cpp:548 msgid "You canceled the synchronization. You may close the window now." msgstr "Du avbröt synkroniseringen. Du kan stänga fönstret nu." -#: ../src/synchronization/syncdialog.cpp:600 +#: ../src/synchronization/syncdialog.cpp:552 msgid "Synchronization Not Configured" msgstr "Synkronisering är inte konfigurerad" -#: ../src/synchronization/syncdialog.cpp:601 +#: ../src/synchronization/syncdialog.cpp:553 msgid "Synchronization is not configured" msgstr "Synkronisering är inte konfigurerad" -#: ../src/synchronization/syncdialog.cpp:602 +#: ../src/synchronization/syncdialog.cpp:554 msgid "Please configure synchronization in the preferences dialog." msgstr "Konfigurera synkronisering i inställningsdialogrutan." -#: ../src/synchronization/syncdialog.cpp:606 +#: ../src/synchronization/syncdialog.cpp:558 msgid "Synchronization Service Error" msgstr "Fel i synkroniseringstjänsten" -#: ../src/synchronization/syncdialog.cpp:607 +#: ../src/synchronization/syncdialog.cpp:559 msgid "Service error" msgstr "Fel i tjänst" -#: ../src/synchronization/syncdialog.cpp:608 +#: ../src/synchronization/syncdialog.cpp:560 msgid "Error connecting to the synchronization service. Please try again." msgstr "Fel vid anslutning till synkroniseringstjänsten. Försök igen." -#: ../src/synchronization/syncdialog.cpp:622 +#: ../src/synchronization/syncdialog.cpp:574 msgid "Deleted locally" msgstr "Tar bort lokalt" -#: ../src/synchronization/syncdialog.cpp:625 +#: ../src/synchronization/syncdialog.cpp:577 msgid "Deleted from server" msgstr "Borttagen från servern" -#: ../src/synchronization/syncdialog.cpp:628 +#: ../src/synchronization/syncdialog.cpp:580 msgid "Updated" msgstr "Uppdaterad" -#: ../src/synchronization/syncdialog.cpp:631 +#: ../src/synchronization/syncdialog.cpp:583 msgid "Added" msgstr "Tillagd" -#: ../src/synchronization/syncdialog.cpp:634 +#: ../src/synchronization/syncdialog.cpp:586 msgid "Uploaded changes to server" msgstr "Skickade upp ändringar till servern" -#: ../src/synchronization/syncdialog.cpp:637 +#: ../src/synchronization/syncdialog.cpp:589 msgid "Uploaded new note to server" msgstr "Skickade upp ny anteckning till servern" -#: ../src/synchronization/syncmanager.cpp:135 -msgid "_Tools" -msgstr "Ver_ktyg" - -#: ../src/tray.cpp:54 -msgid "Take notes" -msgstr "Skriv anteckningar" - -#: ../src/tray.cpp:164 -msgid " (new)" -msgstr " (ny)" - -#: ../src/tray.cpp:470 -msgid "_About Gnote" -msgstr "_Om Gnote" - -#: ../src/utils.cpp:130 -msgid "The \"Gnote Manual\" could not be found. Please verify that your installation has been completed successfully." -msgstr "\"Handbok för Gnote-anteckningar\" kunde inte hittas. Verifiera att din installation har färdigställts korrekt." +#: ../src/synchronization/syncmanager.cpp:66 +msgid "Synchronize Notes" +msgstr "Synkronisera anteckningar" + +#: ../src/synchronization/syncmanager.cpp:85 +#: ../src/synchronization/syncmanager.cpp:102 +#: ../src/synchronization/syncmanager.cpp:575 +#, c-format +msgid "Report a bug. Cast failed: %s" +msgstr "" + +#: ../src/synchronization/syncmanager.cpp:148 +#, c-format +msgid "Error cleaning up addin after synchronization: %s" +msgstr "" + +#: ../src/synchronization/syncmanager.cpp:173 +#, c-format +msgid "Exception while creating SyncServer: %s" +msgstr "" + +#. top-level try +#: ../src/synchronization/syncmanager.cpp:377 +#, fuzzy, c-format +#| msgid "" +#| "Saving configuration to the GNOME keyring failed with the following " +#| "message:" +msgid "Synchronization failed with the following exception: %s" +msgstr "" +"Sparning av konfiguration till GNOME-nyckelringen misslyckades med följande " +"meddelande:" + +#: ../src/synchronization/syncutils.cpp:148 +#: ../src/synchronization/syncutils.cpp:180 +msgid "Could not enable FUSE" +msgstr "Kunde inte aktivera FUSE" + +#: ../src/synchronization/syncutils.cpp:149 +#: ../src/synchronization/syncutils.cpp:181 +msgid "" +"The FUSE module could not be loaded. Please check that it is installed " +"properly and try again." +msgstr "" +"FUSE-modulen kunde inte läsas in. Kontrollera att den är korrekt installerad " +"och försök igen." + +#: ../src/synchronization/syncutils.cpp:157 +msgid "Enable FUSE?" +msgstr "Aktivera FUSE?" + +#. TODO: This message isn't entirely accurate. +#. We should fix it. +#: ../src/synchronization/syncutils.cpp:160 +msgid "" +"The synchronization you've chosen requires the FUSE module to be loaded.\n" +"\n" +"To avoid getting this prompt in the future, you should load FUSE at " +"startup. Add \"modprobe fuse\" to /etc/init.d/boot.local or \"fuse\" to /" +"etc/modules." +msgstr "" +"Synkroniseringen som du har valt kräver att FUSE-modulen läses in.\n" +"\n" +"För att undvika att få den här prompten i framtiden bör du läsa in FUSE vid " +"uppstart. Lägg till \"modprobe fuse\" till /etc/init.d/boot.local eller " +"\"fuse\" till /etc/modules." + +#: ../src/utils.cpp:144 +msgid "" +"The \"Gnote Manual\" could not be found. Please verify that your " +"installation has been completed successfully." +msgstr "" +"\"Handbok för Gnote-anteckningar\" kunde inte hittas. Verifiera att din " +"installation har färdigställts korrekt." -#: ../src/utils.cpp:138 +#: ../src/utils.cpp:152 msgid "Help not found" msgstr "Hjälp hittades inte" -#: ../src/utils.cpp:171 +#: ../src/utils.cpp:185 msgid "Cannot open location" msgstr "Kan inte öppna plats" #. TRANSLATORS: argument is time. -#: ../src/utils.cpp:186 +#: ../src/utils.cpp:215 msgid "Today, %1%" msgstr "Idag, %1%" -#: ../src/utils.cpp:187 +#: ../src/utils.cpp:216 msgid "Today" msgstr "Idag" #. TRANSLATORS: argument is time. -#: ../src/utils.cpp:193 +#: ../src/utils.cpp:222 msgid "Yesterday, %1%" msgstr "Igår, %1%" -#: ../src/utils.cpp:194 +#: ../src/utils.cpp:223 msgid "Yesterday" msgstr "Igår" -#. TRANSLATORS: 2 or more days ago, up to one week. -#. First argument is number of days, second is time. -#: ../src/utils.cpp:203 -msgid "%1% day ago, %2%" -msgid_plural "%1% days ago, %2%" -msgstr[0] "%1% dag sedan, %2%" -msgstr[1] "%1% dagar sedan, %2%" - -#. TRANSLATORS: 2 or more days ago, up to one week. -#. Argument is number of days. -#: ../src/utils.cpp:209 -msgid "%1% day ago" -msgid_plural "%1% days ago" -msgstr[0] "%1% dag sedan" -msgstr[1] "%1% dagar sedan" - #. TRANSLATORS: argument is time. -#: ../src/utils.cpp:217 +#: ../src/utils.cpp:229 msgid "Tomorrow, %1%" msgstr "Imorgon, %1%" -#: ../src/utils.cpp:218 +#: ../src/utils.cpp:230 msgid "Tomorrow" msgstr "Imorgon" -#. TRANSLATORS: In 2 or more days, up to one week. -#. First argument is number of days, second is time. -#: ../src/utils.cpp:227 -msgid "In %1% day, %2%" -msgid_plural "In %1% days, %2%" -msgstr[0] "Inom %1% dag, %2%" -msgstr[1] "Inom %1% dagar, %2%" - -#. TRANSLATORS: In 2 or more days, up to one week. -#. Argument is number of days. -#: ../src/utils.cpp:233 -msgid "In %1% day" -msgid_plural "In %1% days" -msgstr[0] "Inom %1% dag" -msgstr[1] "Inom %1% dagar" +#. TRANSLATORS: date in current year. +#: ../src/utils.cpp:234 +msgid "%b %d" +msgstr "" + +#. TRANSLATORS: first argument is date, second is time. +#: ../src/utils.cpp:237 ../src/utils.cpp:249 +#, fuzzy +#| msgid "In %1% day, %2%" +#| msgid_plural "In %1% days, %2%" +msgid "%1%, %2%" +msgstr "Inom %1% dag, %2%" -#: ../src/utils.cpp:244 +#: ../src/utils.cpp:242 msgid "No Date" msgstr "Inget datum" -#: ../src/watchers.cpp:210 +#. TRANSLATORS: date in other than current year. +#: ../src/utils.cpp:246 +#, fuzzy +#| msgid "%A, %B %d %Y" +msgid "%b %d %Y" +msgstr "%A, %d %B %Y" + +#: ../src/watchers.cpp:200 msgid "(Untitled %1%)" msgstr "(Namnlös %1%)" -#: ../src/watchers.cpp:245 -msgid "A note with the title %1% already exists. Please choose another name for this note before continuing." -msgstr "En anteckning med titeln %1% finns redan. Välj ett annat namn för denna anteckning innan du fortsätter." +#: ../src/watchers.cpp:231 +msgid "" +"A note with the title %1% already exists. Please choose another name " +"for this note before continuing." +msgstr "" +"En anteckning med titeln %1% finns redan. Välj ett annat namn för " +"denna anteckning innan du fortsätter." -#: ../src/watchers.cpp:259 +#: ../src/watchers.cpp:246 msgid "Note title taken" msgstr "Anteckningstiteln är upptagen" -#: ../src/watchers.cpp:593 +#: ../src/watchers.cpp:309 +msgid "Check spelling" +msgstr "" + +#: ../src/watchers.cpp:310 +#, fuzzy +#| msgid "Use tools on this note" +msgid "Check spelling in this note" +msgstr "Använd verktyg på denna anteckning." + +#: ../src/watchers.cpp:674 msgid "_Copy Link Address" msgstr "_Kopiera länkadress" -#: ../src/watchers.cpp:599 +#: ../src/watchers.cpp:680 msgid "_Open Link" msgstr "_Öppna länk" +#~ msgid "Enable startup notes" +#~ msgstr "Aktivera anteckningar vid uppstart" + +#~ msgid "" +#~ "If enabled, all notes that were open when Gnote quit will automatically " +#~ "be reopened at startup." +#~ msgstr "" +#~ "Om aktiverad kommer alla anteckningar som var öppnade när Gnote " +#~ "avslutades att öppnas igen vid nästa uppstart." + +#~ msgid "Saved horizontal position of Search window" +#~ msgstr "Sparad horisontell position för sökfönstret" + +#~ msgid "Determines X coordinate of Search window; stored on Gnote exit." +#~ msgstr "Bestämmer X-koordinaten för sökfönstret; lagras när Gnote avslutas." + +#~ msgid "Saved vertical position of Search window" +#~ msgstr "Sparad vertikal position för sökfönstret" + +#~ msgid "Determines Y coordinate of Search window; stored on Gnote exit." +#~ msgstr "Bestämmer Y-koordinaten för sökfönstret; lagras när Gnote avslutas." + +#~ msgid "" +#~ "Has affect only when started as an application. When set to TRUE, shows a " +#~ "status icon. If set to FALSE, Search All Notes window is used as main " +#~ "application window, closing which makes application to exit." +#~ msgstr "" +#~ "Har endast effekt när startad som ett program. När inställd till TRUE så " +#~ "visas en statusikon. Om inställd till FALSE kommer Sök i alla " +#~ "anteckningar-fönstret att användas som huvudfönster för programmet, " +#~ "vilket gör att programmet avslutas om fönstret stängs." + +#~ msgid "" +#~ "The global keybinding for showing the Gnote applet's menu. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Den globala tangentmappningen för att öppna Gnotes panelprogramsmeny. " +#~ "Formatet ser ut som \"<Control>a\" eller \"<Shift><Alt>" +#~ "F1\". Läsaren är ganska öppen och tillåter stora och små bokstäver, " +#~ "såvälsom förkortningar såsom \"<Ctl>\" och \"<Ctrl>\". " +#~ "Ställer du in alternativet till specialsträngen \"disabled\" så blir det " +#~ "ingen tangentbordsbindning för denna handling." + +#~ msgid "" +#~ "The global keybinding for opening the \"Start Here\" note. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Den globala tangentmappningen för att öppna \"Börja Här\"-anteckningen. " +#~ "Formatet ser ut som \"<Control>a\" eller \"<Shift><Alt>" +#~ "F1\". Läsaren är ganska öppen och tillåter stora och små bokstäver, " +#~ "såvälsom förkortningar såsom \"<Ctl>\" och \"<Ctrl>\". " +#~ "Ställer du in alternativet till specialsträngen \"disabled\" så blir det " +#~ "ingen tangentbordsbindning för denna handling." + +#~ msgid "" +#~ "The global keybinding for creating and displaying a new Note. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Den globala tangentmappningen för att skapa och visa en ny anteckning. " +#~ "Formatet ser ut som \"<Control>a\" eller \"<Shift><Alt>" +#~ "F1\". Läsaren är ganska öppen och tillåter stora och små bokstäver, " +#~ "såvälsom förkortningar såsom \"<Ctl>\" och \"<Ctrl>\". " +#~ "Ställer du in alternativet till specialsträngen \"disabled\" så blir det " +#~ "ingen tangentbordsbindning för denna handling." + +#~ msgid "" +#~ "The global keybinding for opening the Note Search dialog. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Den globala tangentmappningen för att öppna Sök-dialogen. Formatet ser ut " +#~ "som \"<Control>a\" eller \"<Shift><Alt>F1\". Läsaren " +#~ "är ganska öppen och tillåter stora och små bokstäver, såvälsom " +#~ "förkortningar såsom \"<Ctl>\" och \"<Ctrl>\". Ställer du in " +#~ "alternativet till specialsträngen \"disabled\" så blir det ingen " +#~ "tangentbordsbindning för denna handling." + +#~ msgid "" +#~ "The global keybinding for opening the Recent Changes dialog. The format " +#~ "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#~ "parser is fairly liberal and allows lower or upper case, and also " +#~ "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#~ "the option to the special string \"disabled\", then there will be no " +#~ "keybinding for this action." +#~ msgstr "" +#~ "Den globala tangentmappningen för att öppna \"Senaste ändringar\"-" +#~ "dialogen. Formatet ser ut som \"<Control>a\" eller \"<Shift>" +#~ "<Alt>F1\". Läsaren är ganska öppen och tillåter stora och små " +#~ "bokstäver, såvälsom förkortningar såsom \"<Ctl>\" och \"<Ctrl>" +#~ "\". Ställer du in alternativet till specialsträngen \"disabled\" så blir " +#~ "det ingen tangentbordsbindning för denna handling." + +#~ msgid "_File" +#~ msgstr "_Arkiv" + +#~ msgid "Open the selected note" +#~ msgstr "Öppna den valda anteckningen" + +#~ msgid "Delete the selected note" +#~ msgstr "Ta bort den valda anteckningen" + +#~ msgid "Close this window" +#~ msgstr "Stäng det här fönstret" + +#~ msgid "_Edit" +#~ msgstr "R_edigera" + +#~ msgid "S_ynchronize Notes" +#~ msgstr "S_ynkronisera anteckningar" + +#~ msgid "Start synchronizing notes" +#~ msgstr "Starta synkronisering av anteckningar" + +#~ msgid "Cannot create new note" +#~ msgstr "Kan inte skapa ny anteckning" + +#~ msgid "Type the name of the notebook you'd like to create." +#~ msgstr "Ange namnet på anteckningsblocket du vill skapa." + +#~ msgid "Note_books" +#~ msgstr "Antecknings_block" + +#~ msgid "Create a new note in this notebook" +#~ msgstr "Skapa en ny anteckning i detta anteckningsblock" + +#~ msgid "Open this notebook's template note" +#~ msgstr "Öppna anteckningsmallen för detta anteckningsblock" + +#~ msgid "Delete Note_book" +#~ msgstr "Ta bort antecknings_block" + +#~ msgid "Delete the selected notebook" +#~ msgstr "Ta bort det valda anteckningsblocket" + +#~ msgid "Find in This Note" +#~ msgstr "Sök i den här anteckningen" + +#~ msgid "_Find in This Note" +#~ msgstr "_Sök i den här anteckningen" + +#~ msgid "Clos_e All Notes" +#~ msgstr "S_täng alla anteckningar" + +#~ msgid "Search your notes (Ctrl-Shift-F)" +#~ msgstr "Sök i dina anteckningar (Ctrl-Skift-F)" + +#~ msgid "Link selected text to a new note (Ctrl-L)" +#~ msgstr "Länka markerad text till en ny anteckning (Ctrl-L)" + +#~ msgid "_Text" +#~ msgstr "_Text" + +#~ msgid "T_ools" +#~ msgstr "_Verktyg" + +#~ msgid "_Find..." +#~ msgstr "_Sök..." + +#~ msgid "_Next" +#~ msgstr "_Nästa" + +#~ msgid "_Previous" +#~ msgstr "_Föregående" + +#~ msgid "_Find:" +#~ msgstr "_Sök:" + +#~ msgid "Increase Font Size" +#~ msgstr "Öka typsnittsstorlek" + +#~ msgid "Decrease Font Size" +#~ msgstr "Minska typsnittsstorlek" + +#~ msgid "Font Size" +#~ msgstr "Typsnittsstorlek" + +#~ msgid "Hotkeys" +#~ msgstr "Snabbtangenter" + +#~ msgid "Add-ins" +#~ msgstr "Tillägg" + +#~ msgid "Use Status _Icon" +#~ msgstr "Använd status_ikon" + +#~ msgid "Listen for _Hotkeys" +#~ msgstr "Lyssna efter _snabbtangenter" + +#~ msgid "" +#~ "Hotkeys allow you to quickly access your notes from anywhere with a " +#~ "keypress. Example Hotkeys: <Control><Shift>F11, <" +#~ "Alt>N" +#~ msgstr "" +#~ "Snabbtangenter låter dig snabbt få tillgång till dina anteckningar " +#~ "varifrån som helst. Exempel på snabbtangenter: <Control><" +#~ "Shift>F11, <Alt>N" + +#~ msgid "Show notes _menu" +#~ msgstr "Visa antecknings_meny" + +#~ msgid "Open \"_Start Here\"" +#~ msgstr "Öppna \"_Börja här\"" + +#~ msgid "Create _new note" +#~ msgstr "Skapa _ny anteckning" + +#~ msgid "Open \"Search _All Notes\"" +#~ msgstr "Öppna \"Sök i _alla anteckningar\"" + +#~ msgid "_Search:" +#~ msgstr "_Sök:" + +#~ msgid "Last Changed" +#~ msgstr "Senast ändrad" + +#~ msgid "Matches: %1% note" +#~ msgid_plural "Matches: %1% notes" +#~ msgstr[0] "Sökträffar: %1% anteckning" +#~ msgstr[1] "Sökträffar: %1% anteckningar" + +#~ msgid "_Tools" +#~ msgstr "Ver_ktyg" + +#~ msgid "Take notes" +#~ msgstr "Skriv anteckningar" + +#~ msgid " (new)" +#~ msgstr " (ny)" + +#~ msgid "_About Gnote" +#~ msgstr "_Om Gnote" + +#~ msgid "%1% day ago, %2%" +#~ msgid_plural "%1% days ago, %2%" +#~ msgstr[0] "%1% dag sedan, %2%" +#~ msgstr[1] "%1% dagar sedan, %2%" + +#~ msgid "%1% day ago" +#~ msgid_plural "%1% days ago" +#~ msgstr[0] "%1% dag sedan" +#~ msgstr[1] "%1% dagar sedan" + +#~ msgid "In %1% day" +#~ msgid_plural "In %1% days" +#~ msgstr[0] "Inom %1% dag" +#~ msgstr[1] "Inom %1% dagar" + #~ msgid "Editing" #~ msgstr "Redigering" @@ -1907,7 +3040,6 @@ #~ msgstr "Hanteraren för \"note://\"-url:er" #~ msgid "Really delete this note?" - #~ msgid_plural "Really delete these %1% notes?" #~ msgstr[0] "Verkligen ta bort denna anteckning?" #~ msgstr[1] "Verkligen ta bort dessa %1% anteckningar?" @@ -1924,9 +3056,6 @@ #~ msgid "Copyright © 2009 Hubert Figuiere" #~ msgstr "Copyright © 2009 Hubert Figuiere" -#~ msgid "Gnote Notes" -#~ msgstr "Gnote-anteckningar" - #~ msgid "_Fixed Width" #~ msgstr "_Fast bredd" @@ -2018,9 +3147,6 @@ #~ msgid "Se_rver:" #~ msgstr "Se_rver:" -#~ msgid "User_name:" -#~ msgstr "Användar_namn:" - #~ msgid "_Folder Path (optional):" #~ msgstr "_Mappsökväg (valfritt):" @@ -2047,43 +3173,13 @@ #~ msgid "Tasque" #~ msgstr "Tasque" -#~ msgid "All" -#~ msgstr "Alla" - #~ msgid "--- Tasque is not running ---" #~ msgstr "--- Tasque är inte igång ---" -#~ msgid "_URL:" -#~ msgstr "_Url:" - -#~ msgid "_Password:" -#~ msgstr "_Lösenord:" - -#~ msgid "URL, username, or password field is empty." -#~ msgstr "Fältet för url, användarnamn eller lösenord är tomt." - #~ msgid "WebDAV (wdfs FUSE)" #~ msgstr "WebDAV (wdfs FUSE)" -#~ msgid "" -#~ "There was an error connecting to the server. This may be caused by using " -#~ "an incorrect user name and/or password." -#~ msgstr "" -#~ "Det inträffade ett fel vid anslutning till servern. Det kan ha orsakats " -#~ "av ett felaktigt användarnamn och/eller lösenord." - -#~ msgid "" -#~ "Saving configuration to the GNOME keyring failed with the following " -#~ "message:" -#~ msgstr "" -#~ "Sparning av konfiguration till GNOME-nyckelringen misslyckades med " -#~ "följande meddelande:" - -#~ msgid "_Window" -#~ msgstr "_Fönster" - #~ msgid "Really delete this {0} note?" - #~ msgid_plural "Really delete these {0} notes?" #~ msgstr[0] "Verkligen ta bort {0} anteckning?" #~ msgstr[1] "Verkligen ta bort dessa {0} anteckningar?" @@ -2188,57 +3284,6 @@ #~ msgid "MMMM d yyyy" #~ msgstr "d MMMM yyyy" -#~ msgid "" -#~ "This synchronization addin is not supported on your computer. Please make " -#~ "sure you have FUSE and {0} correctly installed and configured" -#~ msgstr "" -#~ "Det här synkroniseringstillägget stöds inte på din dator. Försäkra dig om " -#~ "att du har FUSE och {0} korrekt installerade och konfigurerade" - -#~ msgid "Could not read testfile." -#~ msgstr "Kunde inte läsa testfilen. " - -#~ msgid "Write test failed." -#~ msgstr "Skrivtestet misslyckades." - -#~ msgid "Timeout connecting to server." -#~ msgstr "Tidsgränsen överstegs vid anslutning till server." - -#~ msgid "Error connecting to server." -#~ msgstr "Fel vid anslutning till servern." - -#~ msgid "FUSE could not be enabled." -#~ msgstr "FUSE kunde inte aktiveras." - -#~ msgid "An error ocurred while connecting to the specified server:" -#~ msgstr "Ett fel inträffade vid anslutning till den angivna servern:" - -#~ msgid "Could not enable FUSE" -#~ msgstr "Kunde inte aktivera FUSE" - -#~ msgid "" -#~ "The FUSE module could not be loaded. Please check that it is installed " -#~ "properly and try again." -#~ msgstr "" -#~ "FUSE-modulen kunde inte läsas in. Kontrollera att den är korrekt " -#~ "installerad och försök igen." - -#~ msgid "Enable FUSE?" -#~ msgstr "Aktivera FUSE?" - -#~ msgid "" -#~ "The synchronization you've chosen requires the FUSE module to be loaded.\n" -#~ "\n" -#~ "To avoid getting this prompt in the future, you should load FUSE at " -#~ "startup. Add \"modprobe fuse\" to /etc/init.d/boot.local or \"fuse\" to /" -#~ "etc/modules." -#~ msgstr "" -#~ "Synkroniseringen som du har valt kräver att FUSE-modulen läses in.\n" -#~ "\n" -#~ "För att undvika att få den här prompten i framtiden bör du läsa in FUSE " -#~ "vid uppstart. Lägg till \"modprobe fuse\" till /etc/init.d/boot.local " -#~ "eller \"fuse\" till /etc/modules." - #~ msgid "Add-in" #~ msgstr "Tillägg" @@ -2320,9 +3365,6 @@ #~ msgid "Whether to print a header in each page" #~ msgstr "Huruvida ett sidhuvud ska skrivas ut på varje sida" -#~ msgid "Print Footer" -#~ msgstr "Skriv ut sidfot" - #~ msgid "Whether to print a footer in each page" #~ msgstr "Huruvida en sidfot ska skrivas ut på varje sida" @@ -2434,7 +3476,6 @@ #~ msgstr "Hög" #~ msgid "Total: {0} task" - #~ msgid_plural "Total: {0} tasks" #~ msgstr[0] "Totalt: {0} uppgift" #~ msgstr[1] "Totalt: {0} uppgifter" @@ -2555,15 +3596,9 @@ #~ msgid "Some of the required add-ins were not found" #~ msgstr "Några av de nödvändiga tilläggen kunde inte hittas" -#~ msgid "Installation failed" -#~ msgstr "Installationen misslyckades" - #~ msgid "Url" #~ msgstr "Url" -#~ msgid "Exception occurred: {0}" -#~ msgstr "Undantag inträffade: {0}" - #~ msgid "MonoDevelop Package" #~ msgstr "MonoDevelop-paket" @@ -2715,9 +3750,6 @@ #~ "händelsehanterare. Minnesprofileraren heap-shot ({2}) kan hjälpa till att " #~ "identifiera läckande referenser." -#~ msgid "Plugins" -#~ msgstr "Insticksmoduler" - #~ msgid "Written by:" #~ msgstr "Skrivet av:" @@ -2780,15 +3812,9 @@ #~ msgid "ToC" #~ msgstr "Innehåll" -#~ msgid "Open Table of Contents" -#~ msgstr "Öppna innehållsförteckning" - #~ msgid "Open \"_Table of Contents\"" #~ msgstr "Öppna \"_Innehållsförteckning\"" -#~ msgid "Table of Contents" -#~ msgstr "Innehållsförteckning" - #~ msgid "_Table of Contents" #~ msgstr "Innehålls_förteckning" diff -Nru gnote-3.14.2/po/tr.po gnote-3.16.0/po/tr.po --- gnote-3.14.2/po/tr.po 2015-01-17 12:53:20.000000000 +0000 +++ gnote-3.16.0/po/tr.po 2015-03-07 18:13:28.000000000 +0000 @@ -1,408 +1,418 @@ # Turkish translation for gnote. # Copyright (C) 2011 gnote's COPYRIGHT HOLDER # This file is distributed under the same license as the gnote package. +# Muhammet Kara , 2011, 2014. # -# Muhammet Kara , 2011. msgid "" msgstr "" "Project-Id-Version: gnote master\n" "Report-Msgid-Bugs-To: http://bugzilla.gnome.org/enter_bug.cgi?" "product=gnote&keywords=I18N+L10N&component=general\n" -"POT-Creation-Date: 2011-10-12 20:33+0000\n" -"PO-Revision-Date: 2011-10-13 11:07+0300\n" -"Last-Translator: Muhammet Kara \n" -"Language-Team: Turkish \n" +"POT-Creation-Date: 2014-09-14 14:53+0000\n" +"PO-Revision-Date: 2014-12-13 17:31+0200\n" +"Last-Translator: Muhammet Kara \n" +"Language-Team: Türkçe \n" +"Language: tr\n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" "Plural-Forms: nplurals=1; plural=0;\n" -"Language: tr\n" -"X-Generator: Lokalize 1.2\n" +"X-Generator: Gtranslator 2.91.6\n" + +#: ../data/appdata/gnote.appdata.xml.in.h:1 +msgid "" +"Gnote is a simple note-taking application for GNOME desktop environment. It " +"allows you to capture your ideas, link them together using WikiWiki-style " +"links, group together in notebooks and some extra features for everyday use." +msgstr "" + +#: ../data/appdata/gnote.appdata.xml.in.h:2 +msgid "" +"Gnote also supports synchronization to make it possible to use on multiple " +"devices." +msgstr "" -#: ../data/gnote.desktop.in.in.h:1 -#| msgid "Note" +#: ../data/gnote.desktop.in.in.h:1 ../src/recentchanges.cpp:45 +#: ../src/recentchanges.cpp:479 msgid "Gnote" msgstr "Gnote" #: ../data/gnote.desktop.in.in.h:2 +msgid "Take notes, link ideas, and stay organized" +msgstr "Not tutun, düşünceleri bağlayın, ve düzenli kalın" + +#: ../data/gnote.desktop.in.in.h:3 msgid "Note-taker" msgstr "Not Tutucu" -#: ../data/gnote.desktop.in.in.h:3 -msgid "Take notes, link ideas, and stay organized" -msgstr "Not tutun, düşünceleri bağlayın, ve düzenli kalın" +#: ../data/gnote.desktop.in.in.h:4 +msgid "notes;idea;link;organize;" +msgstr "notlar;fikir;bağlantı;organizasyon;" #: ../data/org.gnome.gnote.gschema.xml.in.h:1 -msgid "Accept SSL Certificates" -msgstr "SSL Sertifikalarını Kabul Et" +msgid "Enable spellchecking" +msgstr "İmla denetimini etkinleştir" #: ../data/org.gnome.gnote.gschema.xml.in.h:2 -msgid "Create a new Note" -msgstr "Yeni bir not oluştur" +msgid "" +"If true, misspellings will be underlined in red, and correct spelling " +"suggestions shown in the right-click menu." +msgstr "" +"Eğer seçiliyse, imla hatalarının altı kırmızı çizilir ve doğru yazım " +"tavsiyeleri sağ tıklama menüsünde görüntülenir." #: ../data/org.gnome.gnote.gschema.xml.in.h:3 -msgid "Custom Font Face" -msgstr "Özel Yazı Tipi" +msgid "Automatically create links when typing" +msgstr "" #: ../data/org.gnome.gnote.gschema.xml.in.h:4 -#| msgid "" -#| "Determines pixel width of \"Search All Notes\" window; stored on Tomboy " -#| "exit." msgid "" -"Determines Search window splitter position in pixels; stored on Gnote exit." +"Enable this option to automatically create a link, when text matches note " +"title." msgstr "" -"Arama penceresi ayracının piksel cinsinden konumunu belirtir; Gnote " -"kapandığında saklanır." #: ../data/org.gnome.gnote.gschema.xml.in.h:5 -#| msgid "" -#| "Determines X coordinate of \"Search All Notes\" window; stored on Tomboy " -#| "exit." -msgid "Determines X coordinate of Search window; stored on Gnote exit." -msgstr "" -"Arama penceresinin X koordinatını belirtir; Gnote kapandığında saklanır." +#, fuzzy +#| msgid "Update links in referencing notes" +msgid "Create links for URLs in notes" +msgstr "Referans notlardaki bağları güncelle" #: ../data/org.gnome.gnote.gschema.xml.in.h:6 -#| msgid "" -#| "Determines Y coordinate of \"Search All Notes\" window; stored on Tomboy " -#| "exit." -msgid "Determines Y coordinate of Search window; stored on Gnote exit." +msgid "Enable this option to create links for URLs in notes." msgstr "" -"Arama penceresinin Y koordinatını belirtir; Gnote kapandığında saklanır." #: ../data/org.gnome.gnote.gschema.xml.in.h:7 -#| msgid "" -#| "Determines pixel height of \"Search All Notes\" window; stored on Tomboy " -#| "exit." -msgid "Determines pixel height of Search window; stored on Gnote exit." -msgstr "" -"Arama penceresinin piksel yüksekliğini belirtir; Gnote kapandığında saklanır." +msgid "Enable WikiWord highlighting" +msgstr "WikiWord belirtecini etkinleştir" #: ../data/org.gnome.gnote.gschema.xml.in.h:8 -#| msgid "" -#| "Determines pixel width of \"Search All Notes\" window; stored on Tomboy " -#| "exit." -msgid "Determines pixel width of Search window; stored on Gnote exit." +msgid "" +"Enable this option to highlight words ThatLookLikeThis. Clicking the word " +"will create a note with that name." msgstr "" -"Arama penceresinin piksel genişliğini belirtir; Gnote kapandığında saklanır." +"BöyleGörünenSözcükler'in aydınlatılmasını isterseniz bu seçeneği " +"etkinleştirin. Bu sözcüğü tıklatmak bu adla yeni bir not oluşturulmasını " +"sağlayacaktır." #: ../data/org.gnome.gnote.gschema.xml.in.h:9 -#| msgid "Enable auto-_bulleted lists" msgid "Enable Auto bulleted lists" msgstr "Kendiliğinden işaretli listeleri etkinleştir" #: ../data/org.gnome.gnote.gschema.xml.in.h:10 -#| msgid "Enable Middle-Click Paste On Icon." -msgid "Enable Middle-Click Paste On Icon" -msgstr "Simge Üzerine Orta Tuşla Tıklandığında Yapıştırmayı Etkinleştir" +msgid "" +"Enable this option if you want bulleted lists to be automatic when you place " +"- or * at the beginning of a line." +msgstr "" +"Bu seçeneği işaretli listelerin satır başında - ya da * kullanıldığında " +"kendiliğinden etkinleşmesi için etkinleştirin." #: ../data/org.gnome.gnote.gschema.xml.in.h:11 -msgid "Enable WikiWord highlighting" -msgstr "WikiWord belirtecini etkinleştir" +msgid "Enable Middle-Click Paste On Icon" +msgstr "Simge Üzerine Orta Tuşla Tıklandığında Yapıştırmayı Etkinleştir" #: ../data/org.gnome.gnote.gschema.xml.in.h:12 -#| msgid "Enable closing notes with escape." -msgid "Enable closing notes with escape" -msgstr "Esc tuşu ile notları kapatmayı etkinleştir" +msgid "" +"Enable this option if you want to be able to middle-click the Gnote icon to " +"paste timestamped content into the Start Here note." +msgstr "" +"Bu seçeneği Gnote simgesine orta tuşla bastığında Buradan Başla notuna zaman " +"belirtici yapıştırılmasını mümkün kılabilmek için etkinleştirin." #: ../data/org.gnome.gnote.gschema.xml.in.h:13 msgid "Enable custom font" msgstr "Özel yazı tiplerini etkinleştir" #: ../data/org.gnome.gnote.gschema.xml.in.h:14 -msgid "Enable global keybindings" -msgstr "Genel tuş bağlarını etkinleştir" +#, fuzzy +#| msgid "" +#| "If true, the font name set in custom_font_face will be used as the font " +#| "when displaying notes. Otherwise the desktop default font will be used." +msgid "" +"If true, the font name set in custom-font-face will be used as the font when " +"displaying notes. Otherwise the desktop default font will be used." +msgstr "" +"Eğer seçiliyse, notlar gösterilirken custom_font_face'de ayarlı olan yazı " +"tipi kullanılacak. Aksi taktirde masaüstünde öntanımlı yazıtipi kullanılacak." #: ../data/org.gnome.gnote.gschema.xml.in.h:15 -msgid "Enable spellchecking" -msgstr "İmla denetimini etkinleştir" +msgid "Custom Font Face" +msgstr "Özel Yazı Tipi" #: ../data/org.gnome.gnote.gschema.xml.in.h:16 -msgid "Enable startup notes" -msgstr "Başlangıç notlarını etkinleştir" - -#: ../data/org.gnome.gnote.gschema.xml.in.h:17 +#, fuzzy +#| msgid "" +#| "If enable_custom_font is true, the font name set here will be used as the " +#| "font when displaying notes." msgid "" -"Enable this option if you want bulleted lists to be automatic when you place " -"- or * at the beginning of a line." +"If enable-custom-font is true, the font name set here will be used as the " +"font when displaying notes." msgstr "" -"Bu seçeneği işaretli listelerin satır başında - ya da * kullanıldığında " -"kendiliğinden etkinleşmesi için etkinleştirin." +"Eğer enable_custom_font seçiliyse, burada ayarlanan yazı tipi ismi notlar " +"gösterilirken kullanılacak." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:17 +msgid "Enable global keybindings" +msgstr "Genel tuş bağlarını etkinleştir" #: ../data/org.gnome.gnote.gschema.xml.in.h:18 +#, fuzzy #| msgid "" -#| "Enable this option if you want to be able to middle-click the Tomboy icon " -#| "to paste timestamped content into the Start Here note." +#| "If true, the desktop-global keybindings set in /apps/gnote/" +#| "global_keybindings will be enabled, allowing for useful Gnote actions to " +#| "be available from any application." msgid "" -"Enable this option if you want to be able to middle-click the Gnote icon to " -"paste timestamped content into the Start Here note." +"If true, the desktop-global keybindings set in /org/gnome/gnote/global-" +"keybindings will be enabled, allowing for useful Gnote actions to be " +"available from any application." msgstr "" -"Bu seçeneği Gnote simgesine orta tuşla bastığında Buradan Başla notuna " -"zaman belirtici yapıştırılmasını mümkün kılabilmek için etkinleştirin." +"Eğer etkinse, /apps/gnote/global_keybindings içinde ayarlanmış olan genel " +"tuş bağları etkinleştirilecek. Bu, kullanışlı Gnote eylemlerinin her " +"uygulamalamada kullanılabilir olmasına olanak sağlayacak. " #: ../data/org.gnome.gnote.gschema.xml.in.h:19 -msgid "" -"Enable this option to highlight words ThatLookLikeThis. Clicking the word " -"will create a note with that name." -msgstr "" -"BöyleGörünenSözcükler'in aydınlatılmasını isterseniz bu seçeneği " -"etkinleştirin. Bu sözcüğü tıklatmak bu adla yeni bir not oluşturulmasını " -"sağlayacaktır." +msgid "Start Here Note" +msgstr "Buradan Başla Notu" #: ../data/org.gnome.gnote.gschema.xml.in.h:20 -msgid "FUSE Mounting Timeout (ms)" -msgstr "FUSE Bağlama Zaman Aşımı (ms)" +#, fuzzy +#| msgid "" +#| "The note URI of the note that should be considered the \"Start Here\" " +#| "note, which is always placed at the bottom of the Tomboy note menu and " +#| "also accessible by hotkey." +msgid "" +"The note URI of the note that should be considered the \"Start Here\" note, " +"which is always placed at the bottom of the Gnote note menu and also " +"accessible by hotkey." +msgstr "" +"Her zaman Tomboy not menüsünün en altına yerleşecek ve bir tuş ile " +"erişilebilecek \"Buradan Başla\" notu için not URI'si." #: ../data/org.gnome.gnote.gschema.xml.in.h:21 -msgid "HTML Export All Linked Notes" -msgstr "Tüm Bağlı Notları HTML Olarak Aktar" +msgid "Minimum number of notes to show in menu" +msgstr "Menüde gösterilecek azami not sayısı" #: ../data/org.gnome.gnote.gschema.xml.in.h:22 -msgid "HTML Export Last Directory" -msgstr "HTML Olarak Dışa Aktarma Son Dizini" +msgid "" +"Integer determining the minimum number of notes to show in the Gnote note " +"menu." +msgstr "" +"Gnote not menüsünde gösterilecek asgari not sayısını belirleyen tamsayı." #: ../data/org.gnome.gnote.gschema.xml.in.h:23 -msgid "HTML Export Linked Notes" -msgstr "Bağlı Notları HTML Olarak Dışa Aktar" +msgid "List of pinned notes" +msgstr "İğnelenmiş notlar listesi" #: ../data/org.gnome.gnote.gschema.xml.in.h:24 msgid "" -"Has affect only when started as an application. When set to TRUE, shows a " -"status icon. If set to FALSE, Search All Notes window is used as main " -"application window, closing which makes application to exit." +"Whitespace-separated list of note URIs for notes that should always appear " +"in the Gnote note menu." msgstr "" -"Sadece uygulama olarak başlatıldığında etkilidir. DOĞRU (TRUE) olarak " -"ayarlandığında, " -"bir durum simgesi gösterir. Eğer YANLIŞ (FALSE) olarak ayarlanırsa, Tüm " -"Notlarda Ara penceresi " -"ana uygulama penceresi olarak kullanılır ve bu pencereyi kapatmak uygulamayı " -"da kapatır." +"Gnote not menüsünde her zaman görünmesi gereken not URI'lerinin boşluk " +"karakterleri ile ayırılmış listesi." #: ../data/org.gnome.gnote.gschema.xml.in.h:25 -msgid "" -"If enable_custom_font is true, the font name set here will be used as the " -"font when displaying notes." +msgid "Is main window maximized" msgstr "" -"Eğer enable_custom_font seçiliyse, burada ayarlanan yazı tipi ismi notlar " -"gösterilirken kullanılacak." #: ../data/org.gnome.gnote.gschema.xml.in.h:26 -#| msgid "" -#| "If enabled, all notes that were open when Tomboy quit will automatically " -#| "be reopened at startup." -msgid "" -"If enabled, all notes that were open when Gnote quit will automatically be " -"reopened at startup." +msgid "If true, Gnote window will be maximized." msgstr "" -"Eğer etkinse, Gnote'dan çıkışta açık olan tüm notlar başlangıçta " -"kendiliğinden tekrar açılacak." #: ../data/org.gnome.gnote.gschema.xml.in.h:27 -msgid "If enabled, an opened note can be closed by hitting the escape key." -msgstr "" -"Eğer etkinse, açık olan bir not esc tuşuna basıldığında kapatılabilecek." +msgid "Saved height of Search window" +msgstr "Arama penceresinin kaydedilmiş yüksekliği" #: ../data/org.gnome.gnote.gschema.xml.in.h:28 -msgid "" -"If true, misspellings will be underlined in red, and correct spelling " -"suggestions shown in the right-click menu." +msgid "Determines pixel height of Search window; stored on Gnote exit." msgstr "" -"Eğer seçiliyse, imla hatalarının altı kırmızı çizilir ve doğru yazım " -"tavsiyeleri sağ tıklama menüsünde görüntülenir." +"Arama penceresinin piksel yüksekliğini belirtir; Gnote kapandığında saklanır." #: ../data/org.gnome.gnote.gschema.xml.in.h:29 -#| msgid "" -#| "If true, the desktop-global keybindings set in /apps/tomboy/" -#| "global_keybindings will be enabled, allowing for useful Tomboy actions to " -#| "be available from any application." -msgid "" -"If true, the desktop-global keybindings set in /apps/gnote/" -"global_keybindings will be enabled, allowing for useful Gnote actions to be " -"available from any application." -msgstr "" -"Eğer etkinse, /apps/gnote/global_keybindings içinde ayarlanmış olan genel " -"tuş bağları etkinleştirilecek. Bu, kullanışlı Gnote eylemlerinin her " -"uygulamalamada kullanılabilir olmasına olanak sağlayacak. " +msgid "Saved width of Search window" +msgstr "Arama penceresinin kaydedilmiş genişliği" #: ../data/org.gnome.gnote.gschema.xml.in.h:30 -msgid "" -"If true, the font name set in custom_font_face will be used as the font when " -"displaying notes. Otherwise the desktop default font will be used." +msgid "Determines pixel width of Search window; stored on Gnote exit." msgstr "" -"Eğer seçiliyse, notlar gösterilirken custom_font_face'de ayarlı olan yazı " -"tipi kullanılacak. Aksi taktirde masaüstünde öntanımlı yazıtipi kullanılacak." +"Arama penceresinin piksel genişliğini belirtir; Gnote kapandığında saklanır." #: ../data/org.gnome.gnote.gschema.xml.in.h:31 -#| msgid "" -#| "Integer determining the minimum number of notes to show in the Tomboy " -#| "note menu." -msgid "" -"Integer determining the minimum number of notes to show in the Gnote note " -"menu." -msgstr "" -"Gnote not menüsünde gösterilecek asgari not sayısını belirleyen tamsayı." +msgid "Saved splitter position of Search window splitter." +msgstr "Arama penceresi ayracının kaydedilmiş ayraç konumu." #: ../data/org.gnome.gnote.gschema.xml.in.h:32 msgid "" -"Integer value indicating if there is a preference to always perform a " -"specific behavior when a conflict is detected, instead of prompting the " -"user. The values map to an internal enumeration. 0 indicates that the user " -"wishes to be prompted when a conflict occurs, so that they may handle each " -"conflict situation on a case-by-case basis." +"Determines Search window splitter position in pixels; stored on Gnote exit." msgstr "" -"Bir çakışma meydana geldiğinde kullanıcıya sormak yerine her zaman belirli " -"bir işleyişi yerine getirmek yönünde bir tercih olup olmadığını belirten " -"tamsayı değeri. Değerler dahili değerlendirme ile eşleşirler. 0 kullanıcının " -"bir çakışma olduğunda sorulmasını istediği anlamına gelir, böylelikle her " -"çakışmayı durumdan duruma değerlendirebilirler." +"Arama penceresi ayracının piksel cinsinden konumunu belirtir; Gnote " +"kapandığında saklanır." #: ../data/org.gnome.gnote.gschema.xml.in.h:33 -msgid "" -"Integer value indicating if there is a preference to always perform a " -"specific link updating behavior when a note is renamed, instead of prompting " -"the user. The values map to an internal enumeration. 0 indicates that the " -"user wishes to be prompted when renaming a note may impact links that exist " -"in other notes. 1 indicates that links should automatically be removed. 2 " -"indicates that link text should be updated to the new note name so that it " -"will continue linking to the renamed note." -msgstr "" -"Bir bağlantının adı değiştirildiğinde kullanıcıya sormak yerine her zaman " -"belirli bir işleyişi yerine getirmek yönünde bir tercih olup olmadığını " -"belirten tamsayı değeri. Değerler dahili değerlendirme ile eşleşirler. 0 " -"kullanıcının bir ad değiştirme olduğunda her zaman sorulmasını istediği " -"anlamına gelir, böylelikle her çakışmayı durumdan duruma " -"değerlendirebilirler. 1 bağlantıların otomatik olarak kaldırılması " -"gerektiğini belirtir. 2 bağlantı metninin yeni not adına göre güncellenmesi " -"gerektiğini böylece adı değiştirilen notu göstermeye devam edeceğini " -"belirtir." +#, fuzzy +#| msgid "Saved height of Search window" +msgid "Saved sorting of the Search window." +msgstr "Arama penceresinin kaydedilmiş yüksekliği" #: ../data/org.gnome.gnote.gschema.xml.in.h:34 -msgid "Link Updating Behavior on Note Rename" -msgstr "Notların Yeniden Adlandırılmasında Bağlantı Güncelleme Davranışı" +#, fuzzy +#| msgid "" +#| "Determines Search window splitter position in pixels; stored on Gnote " +#| "exit." +msgid "Determines Search window initial sorting." +msgstr "" +"Arama penceresi ayracının piksel cinsinden konumunu belirtir; Gnote " +"kapandığında saklanır." #: ../data/org.gnome.gnote.gschema.xml.in.h:35 -#| msgid "List of pinned notes." -msgid "List of pinned notes" -msgstr "İğnelenmiş notlar listesi" +msgid "FUSE Mounting Timeout (ms)" +msgstr "FUSE Bağlama Zaman Aşımı (ms)" #: ../data/org.gnome.gnote.gschema.xml.in.h:36 -msgid "Minimum number of notes to show in menu" -msgstr "Menüde gösterilecek azami not sayısı" +msgid "" +"Time (in milliseconds) Gnote should wait for a response when using FUSE to " +"mount a sync share." +msgstr "" +"Bir eşzamanlama paylaşımına FUSE kullanarak bağlandığında Gnote'un bir cevap " +"için beklemesi gereken zaman (milisaniye olarak)." #: ../data/org.gnome.gnote.gschema.xml.in.h:37 -msgid "Note Synchronization Conflict Saved Behavior" -msgstr "Not Eşzamanlandırma Kaydetme Çakışması İşleyişi" +msgid "SSHFS Remote Synchronization Folder" +msgstr "SSHFS Uzak Eşzamanlama Klasörü" #: ../data/org.gnome.gnote.gschema.xml.in.h:38 -msgid "Open Recent Changes" -msgstr "Son Yapılan Değişiklikleri Aç" +msgid "Path on SSH server to Gnote synchronization directory (optional)." +msgstr "SSH sunucusundaki Gnote eşzamanlama dizininin yolu (isteğe bağlı)." #: ../data/org.gnome.gnote.gschema.xml.in.h:39 -msgid "Open Search Dialog" -msgstr "Arama Penceresini Aç" +msgid "SSHFS Synchronization Server URL" +msgstr "SSHFS Eşzamanlama Sunucusu Adresi (URL)" #: ../data/org.gnome.gnote.gschema.xml.in.h:40 -msgid "Open Start Here" -msgstr "Buradan Başla'yı Aç" +msgid "URL of SSH server containing Gnote synchronization directory." +msgstr "Gnote eşzamanlama dizinini içeren SSH sunucusunun adresi (URL)." #: ../data/org.gnome.gnote.gschema.xml.in.h:41 -#| msgid "Path on SSH server to Tomboy synchronization directory (optional)." -msgid "Path on SSH server to Gnote synchronization directory (optional)." -msgstr "SSH sunucusundaki Gnote eşzamanlama dizininin yolu (isteğe bağlı)." +msgid "SSHFS Remote Synchronization User Name" +msgstr "SSHFS Uzak Eşzamanlama Kullanıcı Adı" #: ../data/org.gnome.gnote.gschema.xml.in.h:42 -msgid "" -"Path to the synchronization server when using the filesystem synchronization " -"service addin." +msgid "User name to use when connecting to the synchronization server via SSH." msgstr "" -"Dosya sistemi eşzamanlandırma servis eklentisi kullanılırken eşzamanladırma " -"sunucusunun yolu." +"Eşzamanlama hizmetine SSH aracılığıyla bağlanılırken kullanılacak kullanıcı " +"adı." #: ../data/org.gnome.gnote.gschema.xml.in.h:43 -msgid "SSHFS Remote Synchronization Folder" -msgstr "SSHFS Uzak Eşzamanlama Klasörü" +msgid "SSHFS Synchronization Server Port" +msgstr "SSHFS Eşzamanlama Sunucu Portu" #: ../data/org.gnome.gnote.gschema.xml.in.h:44 -msgid "SSHFS Remote Synchronization User Name" -msgstr "SSHFS Uzak Eşzamanlama Kullanıcı Adı" +msgid "The port to use when connecting to the synchronization server via SSH." +msgstr "" +"Eşzamanlama sunucusuna SSH aracılığıyla bağlanılırken kullanılacak liman " +"(port)." #: ../data/org.gnome.gnote.gschema.xml.in.h:45 -msgid "SSHFS Synchronization Server Port" -msgstr "SSHFS Eşzamanlama Sunucu Portu" +msgid "Link Updating Behavior on Note Rename" +msgstr "Notların Yeniden Adlandırılmasında Bağlantı Güncelleme Davranışı" #: ../data/org.gnome.gnote.gschema.xml.in.h:46 -msgid "SSHFS Synchronization Server URL" -msgstr "SSHFS Eşzamanlama Sunucusu Adresi (URL)" +msgid "" +"Integer value indicating if there is a preference to always perform a " +"specific link updating behavior when a note is renamed, instead of prompting " +"the user. The values map to an internal enumeration. 0 indicates that the " +"user wishes to be prompted when renaming a note may impact links that exist " +"in other notes. 1 indicates that links should automatically be removed. 2 " +"indicates that link text should be updated to the new note name so that it " +"will continue linking to the renamed note." +msgstr "" +"Bir bağlantının adı değiştirildiğinde kullanıcıya sormak yerine her zaman " +"belirli bir işleyişi yerine getirmek yönünde bir tercih olup olmadığını " +"belirten tamsayı değeri. Değerler dahili değerlendirme ile eşleşirler. 0 " +"kullanıcının bir ad değiştirme olduğunda her zaman sorulmasını istediği " +"anlamına gelir, böylelikle her çakışmayı durumdan duruma " +"değerlendirebilirler. 1 bağlantıların otomatik olarak kaldırılması " +"gerektiğini belirtir. 2 bağlantı metninin yeni not adına göre güncellenmesi " +"gerektiğini böylece adı değiştirilen notu göstermeye devam edeceğini " +"belirtir." #: ../data/org.gnome.gnote.gschema.xml.in.h:47 -#| msgid "Saved height of \"Search All Notes\" window" -msgid "Saved height of Search window" -msgstr "Arama penceresinin kaydedilmiş yüksekliği" +msgid "Enable closing notes with escape" +msgstr "Esc tuşu ile notları kapatmayı etkinleştir" #: ../data/org.gnome.gnote.gschema.xml.in.h:48 -#| msgid "Saved horizontal position of \"Search All Notes\" window" -msgid "Saved horizontal position of Search window" -msgstr "Arama penceresinin kaydedilmiş yatay konumu" +msgid "If enabled, an opened note can be closed by hitting the escape key." +msgstr "" +"Eğer etkinse, açık olan bir not esc tuşuna basıldığında kapatılabilecek." #: ../data/org.gnome.gnote.gschema.xml.in.h:49 -#| msgid "Saved vertical position of \"Search All Notes\" window" -msgid "Saved splitter position of Search window splitter." -msgstr "Arama penceresi ayracının kaydedilmiş ayraç konumu." +msgid "Use status icon, when started as an application" +msgstr "Uygulama olarak başlatıldığında durum simgesi kullan" #: ../data/org.gnome.gnote.gschema.xml.in.h:50 -#| msgid "Saved vertical position of \"Search All Notes\" window" -msgid "Saved vertical position of Search window" -msgstr "Arama penceresinin kaydedilmiş dikey konumu" +msgid "" +"Has affect only when started as an application. When set to TRUE, shows a " +"status icon. If set to FALSE, Search All Notes window is used as main " +"application window, closing which makes application to exit." +msgstr "" +"Sadece uygulama olarak başlatıldığında etkilidir. DOĞRU (TRUE) olarak " +"ayarlandığında, bir durum simgesi gösterir. Eğer YANLIŞ (FALSE) olarak " +"ayarlanırsa, Tüm Notlarda Ara penceresi ana uygulama penceresi olarak " +"kullanılır ve bu pencereyi kapatmak uygulamayı da kapatır." #: ../data/org.gnome.gnote.gschema.xml.in.h:51 -#| msgid "Saved width of \"Search All Notes\" window" -msgid "Saved width of Search window" -msgstr "Arama penceresinin kaydedilmiş genişliği" +#, fuzzy +#| msgid "Open the Search All Notes window" +msgid "Open notes in new window" +msgstr "Tüm Notları Ara penceresini aç" #: ../data/org.gnome.gnote.gschema.xml.in.h:52 -msgid "Selected Synchronization Service Addin" -msgstr "Seçili Eşzamanlandırma Servis Eklentisi" +msgid "" +"Open notes in new window instead of replacing active content of the same " +"window" +msgstr "" #: ../data/org.gnome.gnote.gschema.xml.in.h:53 -msgid "Show applet menu" -msgstr "Uygulamacık menüsünü göster" +msgid "Save note window size and autosize note window to it" +msgstr "" #: ../data/org.gnome.gnote.gschema.xml.in.h:54 -msgid "Start Here Note" -msgstr "Buradan Başla Notu" +msgid "" +"Saves note window size and automatically resizes main window to this size, " +"when note is opened." +msgstr "" #: ../data/org.gnome.gnote.gschema.xml.in.h:55 -msgid "Synchronization Client ID" -msgstr "Eşzamanlandırma İstemci Kimliği" +msgid "Show applet menu" +msgstr "Uygulamacık menüsünü göster" #: ../data/org.gnome.gnote.gschema.xml.in.h:56 -msgid "Synchronization Local Server Path" -msgstr "Eşzamanlandırma Yerel Sunucu Yolu" - -#: ../data/org.gnome.gnote.gschema.xml.in.h:57 -#| msgid "The date format that is used for the timestamp." -msgid "" -"The date format that is used for the timestamp. It follows the format of " -"strftime(3)." -msgstr "" -"Zaman damgası için kullanılan tarih biçimi. strftime(3) biçimine göre yazılır." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:58 +#, fuzzy +#| msgid "" +#| "The global keybinding for showing the Tomboy applet's menu. The format " +#| "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +#| "parser is fairly liberal and allows lower or upper case, and also " +#| "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " +#| "the option to the special string \"disabled\", then there will be no " +#| "keybinding for this action." msgid "" -"The global keybinding for creating and displaying a new Note. The format " -"looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " -"parser is fairly liberal and allows lower or upper case, and also " -"abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the " -"option to the special string \"disabled\", then there will be no keybinding " -"for this action." +"The global keybinding for showing the Gnote applet's menu. The format looks " +"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " +"fairly liberal and allows lower or upper case, and also abbreviations such " +"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " +"special string \"disabled\", then there will be no keybinding for this " +"action." msgstr "" -"Yeni bir not gösterilmesi ve oluşturulması için genel tuş bağı. Biçim \"<" +"Tomboy uygulamacık menüsünü açmak için genel tuş bağı. Biçim \"<" "Control>a\" ve \"<Shift><Alt>F1\" şeklinde görünür. " "Ayrıştırıcı oldukça esnektir, büyük küçük harflere ve \"<Ctl>\" ve " "\"<Ctrl>\" gibi kısaltmalara izin verir. Eğer seçenek özel dizgi " "\"disabled\" olarak atandıysa bu eylem için tuş bağı olmayacak." -#: ../data/org.gnome.gnote.gschema.xml.in.h:59 +#: ../data/org.gnome.gnote.gschema.xml.in.h:57 +msgid "Open Start Here" +msgstr "Buradan Başla'yı Aç" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:58 msgid "" "The global keybinding for opening the \"Start Here\" note. The format looks " "like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " @@ -417,8 +427,31 @@ "\"<Ctrl>\" gibi kısaltmalara izin verir. Eğer seçenek özel dizgi " "\"disabled\" olarak atandıysa bu eylem için tuş bağı olmayacak." +#: ../data/org.gnome.gnote.gschema.xml.in.h:59 +msgid "Create a new Note" +msgstr "Yeni bir not oluştur" + #: ../data/org.gnome.gnote.gschema.xml.in.h:60 msgid "" +"The global keybinding for creating and displaying a new Note. The format " +"looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " +"parser is fairly liberal and allows lower or upper case, and also " +"abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set the " +"option to the special string \"disabled\", then there will be no keybinding " +"for this action." +msgstr "" +"Yeni bir not gösterilmesi ve oluşturulması için genel tuş bağı. Biçim \"<" +"Control>a\" ve \"<Shift><Alt>F1\" şeklinde görünür. " +"Ayrıştırıcı oldukça esnektir, büyük küçük harflere ve \"<Ctl>\" ve " +"\"<Ctrl>\" gibi kısaltmalara izin verir. Eğer seçenek özel dizgi " +"\"disabled\" olarak atandıysa bu eylem için tuş bağı olmayacak." + +#: ../data/org.gnome.gnote.gschema.xml.in.h:61 +msgid "Open Search Dialog" +msgstr "Arama Penceresini Aç" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:62 +msgid "" "The global keybinding for opening the Note Search dialog. The format looks " "like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " "fairly liberal and allows lower or upper case, and also abbreviations such " @@ -432,7 +465,11 @@ "kısaltmalara izin verir. Eğer seçenek özel dizgi \"disabled\" olarak " "atandıysa bu eylem için tuş bağı olmayacak." -#: ../data/org.gnome.gnote.gschema.xml.in.h:61 +#: ../data/org.gnome.gnote.gschema.xml.in.h:63 +msgid "Open Recent Changes" +msgstr "Son Yapılan Değişiklikleri Aç" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:64 msgid "" "The global keybinding for opening the Recent Changes dialog. The format " "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " @@ -447,37 +484,22 @@ "\"<Ctrl>\" gibi kısaltmalara izin verir. Eğer seçenek özel dizgi " "\"disabled\" olarak atandıysa bu eylem için tuş bağı olmayacak." -#: ../data/org.gnome.gnote.gschema.xml.in.h:62 -#, fuzzy -#| msgid "" -#| "The global keybinding for showing the Tomboy applet's menu. The format " -#| "looks like \"<Control>a\" or \"<Shift><Alt>F1\". The " -#| "parser is fairly liberal and allows lower or upper case, and also " -#| "abbreviations such as \"<Ctl>\" and \"<Ctrl>\". If you set " -#| "the option to the special string \"disabled\", then there will be no " -#| "keybinding for this action." -msgid "" -"The global keybinding for showing the Gnote applet's menu. The format looks " -"like \"<Control>a\" or \"<Shift><Alt>F1\". The parser is " -"fairly liberal and allows lower or upper case, and also abbreviations such " -"as \"<Ctl>\" and \"<Ctrl>\". If you set the option to the " -"special string \"disabled\", then there will be no keybinding for this " -"action." -msgstr "" -"Tomboy uygulamacık menüsünü açmak için genel tuş bağı. Biçim \"<" -"Control>a\" ve \"<Shift><Alt>F1\" şeklinde görünür. " -"Ayrıştırıcı oldukça esnektir, büyük küçük harflere ve \"<Ctl>\" ve " -"\"<Ctrl>\" gibi kısaltmalara izin verir. Eğer seçenek özel dizgi " -"\"disabled\" olarak atandıysa bu eylem için tuş bağı olmayacak." +#: ../data/org.gnome.gnote.gschema.xml.in.h:65 +msgid "HTML Export Last Directory" +msgstr "HTML Olarak Dışa Aktarma Son Dizini" -#: ../data/org.gnome.gnote.gschema.xml.in.h:63 +#: ../data/org.gnome.gnote.gschema.xml.in.h:66 msgid "" "The last directory a note was exported to using the Export To HTML plugin." msgstr "" "Bir notun HTML Dışa Aktarım Eklentisi kullanılarak dışa aktarıldığı en son " "dizin." -#: ../data/org.gnome.gnote.gschema.xml.in.h:64 +#: ../data/org.gnome.gnote.gschema.xml.in.h:67 +msgid "HTML Export Linked Notes" +msgstr "Bağlı Notları HTML Olarak Dışa Aktar" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:68 msgid "" "The last setting for the 'Export linked notes' checkbox in the Export to " "HTML plugin." @@ -485,7 +507,11 @@ "HTML Dışa Aktarım Eklentisi içindeki 'Bağlı Notlar Dışa Aktar' seçeneği için " "son ayar." -#: ../data/org.gnome.gnote.gschema.xml.in.h:65 +#: ../data/org.gnome.gnote.gschema.xml.in.h:69 +msgid "HTML Export All Linked Notes" +msgstr "Tüm Bağlı Notları HTML Olarak Aktar" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:70 msgid "" "The last setting for the 'Include all other linked notes' checkbox in the " "Export to HTML plugin. This setting is used in conjunction with the 'HTML " @@ -497,49 +523,35 @@ "ve tüm notların (iç içe bulunan) HTML aktarmada dahil edilip edilmeyeceğini " "belirler." -#: ../data/org.gnome.gnote.gschema.xml.in.h:66 -#, fuzzy -#| msgid "" -#| "The note URI of the note that should be considered the \"Start Here\" " -#| "note, which is always placed at the bottom of the Tomboy note menu and " -#| "also accessible by hotkey." +#: ../data/org.gnome.gnote.gschema.xml.in.h:71 +msgid "Synchronization Client ID" +msgstr "Eşzamanlandırma İstemci Kimliği" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:72 msgid "" -"The note URI of the note that should be considered the \"Start Here\" note, " -"which is always placed at the bottom of the Gnote note menu and also " -"accessible by hotkey." +"Unique identifier for this Gnote client, used when communicating with a " +"sychronization server." msgstr "" -"Her zaman Tomboy not menüsünün en altına yerleşecek ve bir tuş ile " -"erişilebilecek \"Buradan Başla\" notu için not URI'si." +"Bu Gnote istemcisi için, bir eşzamanlama sunucusu ile iletişime geçilirken " +"kullanılacak benzersiz tanımlayıcı." -#: ../data/org.gnome.gnote.gschema.xml.in.h:67 -#| msgid "" -#| "User name to use when connecting to the synchronization server via SSH." -msgid "The port to use when connecting to the synchronization server via SSH." -msgstr "" -"Eşzamanlama sunucusuna SSH aracılığıyla bağlanılırken kullanılacak liman " -"(port)." +#: ../data/org.gnome.gnote.gschema.xml.in.h:73 +msgid "Synchronization Local Server Path" +msgstr "Eşzamanlandırma Yerel Sunucu Yolu" -#: ../data/org.gnome.gnote.gschema.xml.in.h:68 -#| msgid "" -#| "Time (in milliseconds) Tomboy should wait for a response when using FUSE " -#| "to mount a sync share." +#: ../data/org.gnome.gnote.gschema.xml.in.h:74 msgid "" -"Time (in milliseconds) Gnote should wait for a response when using FUSE to " -"mount a sync share." +"Path to the synchronization server when using the filesystem synchronization " +"service addin." msgstr "" -"Bir eşzamanlama paylaşımına FUSE kullanarak bağlandığında Gnote'un bir " -"cevap için beklemesi gereken zaman (milisaniye olarak)." - -#: ../data/org.gnome.gnote.gschema.xml.in.h:69 -msgid "Timestamp format" -msgstr "Zaman etiketi biçimi" +"Dosya sistemi eşzamanlandırma servis eklentisi kullanılırken eşzamanladırma " +"sunucusunun yolu." -#: ../data/org.gnome.gnote.gschema.xml.in.h:70 -#| msgid "URL of SSH server containing Tomboy synchronization directory." -msgid "URL of SSH server containing Gnote synchronization directory." -msgstr "Gnote eşzamanlama dizinini içeren SSH sunucusunun adresi (URL)." +#: ../data/org.gnome.gnote.gschema.xml.in.h:75 +msgid "Selected Synchronization Service Addin" +msgstr "Seçili Eşzamanlandırma Servis Eklentisi" -#: ../data/org.gnome.gnote.gschema.xml.in.h:71 +#: ../data/org.gnome.gnote.gschema.xml.in.h:76 msgid "" "Unique identifier for the currently configured note synchronization service " "addin." @@ -547,22 +559,45 @@ "Yapılandırılmış mevcut not eşzamanlandırma servisi eklentisi için tekil " "belirteç." -#: ../data/org.gnome.gnote.gschema.xml.in.h:72 -#| msgid "" -#| "Unique identifier for this Tomboy client, used when communicating with a " -#| "sychronization server." +#: ../data/org.gnome.gnote.gschema.xml.in.h:77 +msgid "Note Synchronization Conflict Saved Behavior" +msgstr "Not Eşzamanlandırma Kaydetme Çakışması İşleyişi" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:78 msgid "" -"Unique identifier for this Gnote client, used when communicating with a " -"sychronization server." +"Integer value indicating if there is a preference to always perform a " +"specific behavior when a conflict is detected, instead of prompting the " +"user. The values map to an internal enumeration. 0 indicates that the user " +"wishes to be prompted when a conflict occurs, so that they may handle each " +"conflict situation on a case-by-case basis." msgstr "" -"Bu Gnote istemcisi için, bir eşzamanlama sunucusu ile iletişime geçilirken " -"kullanılacak benzersiz tanımlayıcı." +"Bir çakışma meydana geldiğinde kullanıcıya sormak yerine her zaman belirli " +"bir işleyişi yerine getirmek yönünde bir tercih olup olmadığını belirten " +"tamsayı değeri. Değerler dahili değerlendirme ile eşleşirler. 0 kullanıcının " +"bir çakışma olduğunda sorulmasını istediği anlamına gelir, böylelikle her " +"çakışmayı durumdan duruma değerlendirebilirler." -#: ../data/org.gnome.gnote.gschema.xml.in.h:73 -msgid "Use status icon, when started as an application" -msgstr "Uygulama olarak başlatıldığında durum simgesi kullan" +#: ../data/org.gnome.gnote.gschema.xml.in.h:79 +msgid "Automatic Background Synchronization Timeout" +msgstr "Otomatik Arkaplan Eşzamanlamasında Zaman Aşımı" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:80 +msgid "" +"Integer value indicating how frequently to perform a background sync of your " +"notes (when sync is configured). Any value less than 1 indicates that " +"autosync is disabled. The lowest acceptable positive value is 5. Value is in " +"minutes." +msgstr "" +"Notlarınızın (eşzamanlama yapılandırılmışsa) ne sıklıkla arkaplanda " +"eşzamanlanacağını gösteren tam sayı değeri. 1'den küçük herhangi bir değer, " +"otomatik eşzamanlamanın devre dışı bırakıldığını gösterir. Kabul edilebilir " +"en küçük pozitif sayı 5'dir. Bu değer, dakika cinsindendir." -#: ../data/org.gnome.gnote.gschema.xml.in.h:74 +#: ../data/org.gnome.gnote.gschema.xml.in.h:81 +msgid "Accept SSL Certificates" +msgstr "SSL Sertifikalarını Kabul Et" + +#: ../data/org.gnome.gnote.gschema.xml.in.h:82 msgid "" "Use wdfs option \"-ac\" to accept SSL certificates without prompting the " "user." @@ -570,1421 +605,2537 @@ "SSL sertifikalarını kullanıcıya sormadan kabul etmek için \"-ac\" wdfs " "seçeneğini kullanın." -#: ../data/org.gnome.gnote.gschema.xml.in.h:75 -msgid "User name to use when connecting to the synchronization server via SSH." +#: ../data/org.gnome.gnote.gschema.xml.in.h:83 +msgid "Share URL" msgstr "" -"Eşzamanlama hizmetine SSH aracılığıyla bağlanılırken kullanılacak kullanıcı " -"adı." -#: ../data/org.gnome.gnote.gschema.xml.in.h:76 -#| msgid "" -#| "Whitespace-separated list of note URIs for notes that should always " -#| "appear in the Tomboy note menu." -msgid "" -"Whitespace-separated list of note URIs for notes that should always appear " -"in the Gnote note menu." +#: ../data/org.gnome.gnote.gschema.xml.in.h:84 +msgid "WebDAV share URL where notes are synchronized to." msgstr "" -"Gnote not menüsünde her zaman görünmesi gereken not URI'lerinin boşluk " -"karakterleri ile ayırılmış listesi." - -#: ../src/sharp/addinstreemodel.cpp:93 -#| msgid "Host Name" -msgid "Name" -msgstr "İsim" - -#: ../src/sharp/addinstreemodel.cpp:105 -msgid "Version" -msgstr "Sürüm" - -#. TRANSLATORS: Addin category. -#: ../src/sharp/addinstreemodel.cpp:138 -msgid "Formatting" -msgstr "Biçimlendirme" - -#. TRANSLATORS: Addin category. -#: ../src/sharp/addinstreemodel.cpp:141 -msgid "Desktop integration" -msgstr "Masaüstü bütünleştirmesi" - -#. TRANSLATORS: Addin category. -#: ../src/sharp/addinstreemodel.cpp:144 -#| msgid "_Tools" -msgid "Tools" -msgstr "Araçlar" - -#. TRANSLATORS: Addin category is unknown. -#: ../src/sharp/addinstreemodel.cpp:148 -#| msgid "Unknown error." -msgid "Unknown" -msgstr "Bilinmiyor" - -#: ../src/actionmanager.cpp:174 -msgid "_File" -msgstr "_Dosya" - -#: ../src/actionmanager.cpp:178 -msgid "_New" -msgstr "_Yeni" -#: ../src/actionmanager.cpp:179 ../src/actionmanager.cpp:230 -msgid "Create a new note" -msgstr "Yeni bir not oluştur" +#: ../data/org.gnome.gnote.gschema.xml.in.h:85 +msgid "Share username" +msgstr "" -#: ../src/actionmanager.cpp:184 -msgid "_Open..." -msgstr "_Aç..." - -#: ../src/actionmanager.cpp:184 -msgid "Open the selected note" -msgstr "Seçilen notu aç" +#: ../data/org.gnome.gnote.gschema.xml.in.h:86 +msgid "Username to access WebDAV share." +msgstr "" -#: ../src/actionmanager.cpp:190 -msgid "_Delete" -msgstr "_Sil" +#: ../data/org.gnome.gnote.gschema.xml.in.h:87 +msgid "Timestamp format" +msgstr "Zaman etiketi biçimi" -#: ../src/actionmanager.cpp:190 -msgid "Delete the selected note" -msgstr "Seçilen notu sil" +#: ../data/org.gnome.gnote.gschema.xml.in.h:88 +msgid "" +"The date format that is used for the timestamp. It follows the format of " +"strftime(3)." +msgstr "" +"Zaman damgası için kullanılan tarih biçimi. strftime(3) biçimine göre " +"yazılır." -#: ../src/actionmanager.cpp:196 ../src/notewindow.cpp:368 -msgid "_Close" -msgstr "_Kapat" +#: ../data/org.gnome.gnote.gschema.xml.in.h:89 +msgid "Time between checks" +msgstr "" -#: ../src/actionmanager.cpp:196 -msgid "Close this window" -msgstr "Bu pencereyi kapat" +#: ../data/org.gnome.gnote.gschema.xml.in.h:90 +msgid "" +"Time interval between note directory checks (in seconds). Min value is 5." +msgstr "" -#: ../src/actionmanager.cpp:201 ../src/tray.cpp:477 +#: ../src/actionmanager.cpp:84 ../src/actionmanager.cpp:171 +#: ../src/tray.cpp:465 msgid "_Quit" msgstr "Çı_k" -#: ../src/actionmanager.cpp:201 +#: ../src/actionmanager.cpp:84 msgid "Quit Gnote" msgstr "Gnote'u Kapat" -#: ../src/actionmanager.cpp:204 -msgid "_Edit" -msgstr "_Düzenle" - -#: ../src/actionmanager.cpp:209 ../src/applet.cpp:383 ../src/tray.cpp:460 +#: ../src/actionmanager.cpp:89 ../src/actionmanager.cpp:168 +#: ../src/tray.cpp:448 msgid "_Preferences" msgstr "_Tercihler" -#: ../src/actionmanager.cpp:209 ../src/preferencesdialog.cpp:88 -#| msgid "_Preferences" +#: ../src/actionmanager.cpp:89 ../src/preferencesdialog.cpp:103 msgid "Gnote Preferences" msgstr "Gnote Tercihleri" -#: ../src/actionmanager.cpp:212 ../src/applet.cpp:384 ../src/tray.cpp:465 -msgid "_Help" -msgstr "_Yardım" - -#: ../src/actionmanager.cpp:216 +#: ../src/actionmanager.cpp:93 msgid "_Contents" msgstr "İçi_ndekiler" -#: ../src/actionmanager.cpp:216 +#: ../src/actionmanager.cpp:93 msgid "Gnote Help" msgstr "Gnote Yardımı" -#: ../src/actionmanager.cpp:221 ../src/applet.cpp:385 +#: ../src/actionmanager.cpp:98 ../src/actionmanager.cpp:170 msgid "_About" msgstr "_Hakkında" -#: ../src/actionmanager.cpp:221 -#| msgid "About Tomboy" +#: ../src/actionmanager.cpp:98 msgid "About Gnote" msgstr "Gnote Hakkında" -#: ../src/actionmanager.cpp:225 +#: ../src/actionmanager.cpp:102 msgid "TrayIcon" msgstr "UyarıAlanıSimgesi" -#: ../src/actionmanager.cpp:230 +#: ../src/actionmanager.cpp:107 ../src/tray.cpp:225 msgid "Create _New Note" msgstr "Yeni _Not Oluştur" -#: ../src/actionmanager.cpp:235 ../src/notewindow.cpp:320 +#: ../src/actionmanager.cpp:107 ../src/tray.cpp:227 +msgid "Create a new note" +msgstr "Yeni bir not oluştur" + +#: ../src/actionmanager.cpp:112 ../src/tray.cpp:234 msgid "_Search All Notes" msgstr "_Tüm Notları Ara" -#: ../src/actionmanager.cpp:235 +#: ../src/actionmanager.cpp:112 ../src/tray.cpp:236 msgid "Open the Search All Notes window" msgstr "Tüm Notları Ara penceresini aç" -#: ../src/actionmanager.cpp:240 -msgid "S_ynchronize Notes" -msgstr "Notları _Eşzamanlandır" - -#: ../src/actionmanager.cpp:240 -msgid "Start synchronizing notes" -msgstr "Notları eşzamanlandırmayı başlat" - -#: ../src/gnote.cpp:296 -msgid "Cannot create new note" -msgstr "Yeni not oluşturulamıyor" +#: ../src/actionmanager.cpp:166 +msgid "_New Note" +msgstr "_Yeni Not" -#: ../src/gnote.cpp:345 -msgid "and Tomboy original authors." -msgstr "ve Tomboy'un özgün yazarları." +#: ../src/actionmanager.cpp:167 +#, fuzzy +#| msgid "_Window" +msgid "New _Window" +msgstr "_Pencere" -#: ../src/gnote.cpp:354 -msgid "translator-credits" -msgstr "Muhammet Kara " +#: ../src/actionmanager.cpp:169 ../src/tray.cpp:453 +msgid "_Help" +msgstr "_Yardım" -#: ../src/gnote.cpp:363 -msgid "" -"Copyright © 2010-2011 Aurimas Cernius\n" -"Copyright © 2009-2011 Debarshi Ray\n" -"Copyright © 2009 Hubert Figuiere\n" -"Copyright © 2004-2009 the Tomboy original authors." +#: ../src/addininfo.cpp:74 +msgid "Failed to load plugin information!" msgstr "" -"Telif Hakkı © 2010-2011 Aurimas Cernius\n" -"Telif Hakkı © 2009-2011 Debarshi Ray\n" -"Telif Hakkı © 2009 Hubert Figuiere\n" -"Telif Hakkı © 2004-2009 Tomboy'un özgün yazarları." - -#: ../src/gnote.cpp:367 -msgid "A simple and easy to use desktop note-taking application." -msgstr "Basit ve kullanışlı bir not tutucu uygulaması." - -#: ../src/gnote.cpp:378 -msgid "Homepage" -msgstr "Web Sitesi" -#: ../src/gnote.cpp:453 -msgid "Run Gnote as a GNOME panel applet." -msgstr "Gnote'u bir GNOME panel uygulamacığı olarak çalıştır." +#: ../src/addininfo.cpp:124 +#, c-format +msgid "Incompatible plug-in %s: expected %s, got %s" +msgstr "" -#: ../src/gnote.cpp:454 -msgid "Specify the path of the directory containing the notes." -msgstr "Notları içeren dizin yolunu belirtin." +#: ../src/addinmanager.cpp:133 +#, c-format +msgid "Note plugin info %s already present" +msgstr "" -#: ../src/gnote.cpp:454 -msgid "path" -msgstr "yol" +#: ../src/addinmanager.cpp:141 +#, c-format +msgid "%s does not implement %s" +msgstr "" -#: ../src/gnote.cpp:455 -#, fuzzy -#| msgid "Open the Search All Notes window" -msgid "Open the search all notes window with the search text." -msgstr "Tüm Notları Ara penceresini aç" +#: ../src/addinmanager.cpp:156 +#, c-format +msgid "Note plugin %s already present" +msgstr "" -#: ../src/gnote.cpp:455 ../src/gnote.cpp:460 -#| msgid "Te_xt" -msgid "text" -msgstr "metin" +#: ../src/addinmanager.cpp:174 +#, c-format +msgid "Note plugin info %s is absent" +msgstr "" -#: ../src/gnote.cpp:456 -msgid "Print version information." -msgstr "Sürüm bilgisini yazdır." +#: ../src/addinmanager.cpp:187 +#, c-format +msgid "Note plugin %s is absent" +msgstr "" -#: ../src/gnote.cpp:457 -msgid "Create and display a new note, with a optional title." -msgstr "İsteğe bağlı bir başlıkla yeni bir not oluştur ve görüntüle." +#: ../src/addinmanager.cpp:224 +#, c-format +msgid "Failed to find module %s for addin %s" +msgstr "" -#: ../src/gnote.cpp:457 -#| msgid "Untitled" -msgid "title" -msgstr "başlık" +#: ../src/addinmanager.cpp:228 +#, c-format +msgid "Failed to load addin info for %s: %s" +msgstr "" -#: ../src/gnote.cpp:458 -msgid "Display the existing note matching title." +#: ../src/addinmanager.cpp:352 +msgid "Trying to load addins when they are already loaded" msgstr "" -#: ../src/gnote.cpp:458 -msgid "title/url" -msgstr "başlık/url" +#: ../src/addins/backlinks/backlinkmenuitem.cpp:41 +msgid "What links here?" +msgstr "Buraya ne bağlı?" -#: ../src/gnote.cpp:459 -#| msgid "Start Here Note" -msgid "Display the 'Start Here' note." -msgstr "'Buradan Başla' notunu görüntüle." +#: ../src/addins/backlinks/backlinkmenuitem.cpp:42 +#, fuzzy +#| msgid "What links here?" +msgid "Which notes have links to here?" +msgstr "Buraya ne bağlı?" -#: ../src/gnote.cpp:460 -msgid "Search and highlight text in the opened note." +#: ../src/addins/backlinks/backlinks.desktop.in.in.h:1 +msgid "Backlinks" msgstr "" -#: ../src/gnote.cpp:464 -msgid "A note taking application" -msgstr "Not alma uygulaması" - -#: ../src/gnote.cpp:464 -msgid "Gnote options at launch" -msgstr "Başlangıçtaki Gnote seçenekleri" +#: ../src/addins/backlinks/backlinks.desktop.in.in.h:2 +msgid "See which notes link to the one you're currently viewing." +msgstr "" -#: ../src/gnote.cpp:657 -#| msgid "Version" -msgid "Version %1%" -msgstr "Sürüm %1%" +#: ../src/addins/backlinks/backlinks.desktop.in.in.h:3 +#: ../src/addins/inserttimestamp/inserttimestamp.desktop.in.in.h:3 +msgid "Hubert Figuiere and Tomboy Project" +msgstr "Hubert Figuiere ve Tomboy Projesi" -#: ../src/preferencesdialog.cpp:106 -msgid "Editing" -msgstr "Düzenleme" +#: ../src/addins/backlinks/backlinksnoteaddin.cpp:86 +msgid "(none)" +msgstr "(hiçbiri)" -#: ../src/preferencesdialog.cpp:108 -msgid "Hotkeys" -msgstr "Kısayollar" +#: ../src/addins/bugzilla/bugzilla.desktop.in.in.h:1 +msgid "Bugzilla Links" +msgstr "Bugzilla Bağlantıları" -#: ../src/preferencesdialog.cpp:113 -msgid "Add-ins" -msgstr "Eklentiler" +#: ../src/addins/bugzilla/bugzilla.desktop.in.in.h:2 +msgid "" +"Allows you to drag a Bugzilla URL from your browser directly into a Gnote " +"note. The bug number is inserted as a link with a little bug icon next to " +"it." +msgstr "" -#: ../src/preferencesdialog.cpp:221 -msgid "_Spell check while typing" -msgstr "_Yazarken imla denetimi yap" +#: ../src/addins/bugzilla/bugzilla.desktop.in.in.h:3 +#: ../src/addins/exporttohtml/exporttohtml.desktop.in.in.h:3 +#: ../src/addins/fixedwidth/fixedwidth.desktop.in.in.h:3 +#: ../src/addins/printnotes/printnotes.desktop.in.in.h:3 +#: ../src/addins/stickynoteimport/stickynoteimport.desktop.in.in.h:3 +msgid "Hubert Figuiere and the Tomboy Project" +msgstr "Hubert Figuiere ve Tomboy Projesi" -#: ../src/preferencesdialog.cpp:227 +#: ../src/addins/bugzilla/bugzillapreferences.cpp:64 msgid "" -"Misspellings will be underlined in red, with correct spelling suggestions " -"shown in the context menu." +"You can use any bugzilla just by dragging links into notes. If you want a " +"special icon for certain hosts, add them here." msgstr "" -"İmla hatalarının altı kırmızı çizilir ve doğru yazım önerileri içerik " -"menüsünde görüntülenir." +"Sadece bağları notlara taşıyarak herhangibir bugzilla kullanabilirsiniz. " +"Eğer belirli makinalar için özel simgeler istiyorsanız, onları buraya " +"ekleyin." -#. WikiWords... -#: ../src/preferencesdialog.cpp:238 -msgid "Highlight _WikiWords" -msgstr "_WikiSözcükleri aydınlat" +#: ../src/addins/bugzilla/bugzillapreferences.cpp:81 +msgid "Host Name" +msgstr "Makina İsmi" -#: ../src/preferencesdialog.cpp:244 -msgid "" -"Enable this option to highlight words ThatLookLikeThis. Clicking the " -"word will create a note with that name." +#: ../src/addins/bugzilla/bugzillapreferences.cpp:94 +msgid "Icon" +msgstr "Simge" + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:229 +msgid "Select an icon..." +msgstr "Bir simge seçin..." + +#. Extra Widget +#: ../src/addins/bugzilla/bugzillapreferences.cpp:244 +msgid "_Host name:" +msgstr "_Makina ismi:" + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:278 +msgid "Host name invalid" +msgstr "Makine adı geçersiz" + +#: ../src/addins/bugzilla/bugzillapreferences.cpp:279 +msgid "You must specify a valid Bugzilla host name to use with this icon." msgstr "" -"BöyleGörünenSözcükler'in aydınlatılmasını isterseniz bu seçeneği " -"etkinleştirin. Bu sözcüğü tıklatmak bu adla yeni bir not oluşturulmasını " -"sağlayacaktır." +"Bu simge ile kullanmak için, geçerli bir Bugzilla makine adı belirtmelisiniz." -#. Auto bulleted list -#: ../src/preferencesdialog.cpp:251 -msgid "Enable auto-_bulleted lists" -msgstr "_Kendiliğinden işaretli listeleri etkinleştir" +#: ../src/addins/bugzilla/bugzillapreferences.cpp:298 +msgid "Error saving icon" +msgstr "Simge kaydedilirken hata" -#: ../src/preferencesdialog.cpp:260 -msgid "Use custom _font" -msgstr "Özel _yazı tipi kullan" +#: ../src/addins/bugzilla/bugzillapreferences.cpp:299 +msgid "Could not save the icon file." +msgstr "Simge dosyası kaydedilemedi." -#: ../src/preferencesdialog.cpp:277 -msgid "When renaming a linked note: " -msgstr "Bağlantılı bir notu yeniden adlandırırken: " +#: ../src/addins/bugzilla/bugzillapreferences.cpp:371 +msgid "Really remove this icon?" +msgstr "Bu simgeyi silmek istediğinizden emin misiniz?" -#: ../src/preferencesdialog.cpp:282 -msgid "Ask me what to do" -msgstr "Ne yapılacağını bana sor" +#: ../src/addins/bugzilla/bugzillapreferences.cpp:372 +msgid "If you remove an icon it is permanently lost." +msgstr "Eğer bir simgeyi silerseniz kalıcı olarak kaybolacaktır." -#: ../src/preferencesdialog.cpp:283 -msgid "Never rename links" -msgstr "Bağlantıları hiçbir zaman yeniden adlandırma" +#: ../src/addins/bugzilla/bugzillapreferences.cpp:394 +#, fuzzy, c-format +#| msgid "Error saving icon" +msgid "Error removing icon %s: %s" +msgstr "Simge kaydedilirken hata" -#: ../src/preferencesdialog.cpp:284 -msgid "Always rename links" -msgstr "Bağlantıları her zaman yeniden adlandır" +#: ../src/addins/exporttogtg/exporttogtg.desktop.in.in.h:1 +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:71 +msgid "Export to Getting Things GNOME" +msgstr "" -#. New Note Template -#. Translators: This is 'New Note' Template, not New 'Note Template' -#: ../src/preferencesdialog.cpp:303 ../src/notemanager.cpp:112 -msgid "New Note Template" -msgstr "Yeni Not Şablomu" +#: ../src/addins/exporttogtg/exporttogtg.desktop.in.in.h:2 +#, fuzzy +#| msgid "Export linked notes" +msgid "Exports individual notes as Getting Things GNOME tasks" +msgstr "Bağlı notları dışa aktar" -#: ../src/preferencesdialog.cpp:306 -msgid "" -"Use the new note template to specify the text that should be used when " -"creating a new note." +#: ../src/addins/exporttogtg/exporttogtg.desktop.in.in.h:3 +#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:3 +#: ../src/addins/statistics/statistics.desktop.in.in.h:3 +msgid "Aurimas Černius" msgstr "" -"Yeni bir not oluştururken kullanılacak metni yeni not şablomu olarak belirt." -#: ../src/preferencesdialog.cpp:314 -msgid "Open New Note Template" -msgstr "Yeni Not Şablomu Aç" +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:72 +msgid "Export note as Getting Things GNOME task" +msgstr "" -#. Hotkeys... -#: ../src/preferencesdialog.cpp:376 -msgid "Listen for _Hotkeys" -msgstr "Kısayol _tuşlarını dinle" +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:86 +msgid "GTG XML loaded, but interface not found" +msgstr "" -#: ../src/preferencesdialog.cpp:383 -msgid "" -"Hotkeys allow you to quickly access your notes from anywhere with a " -"keypress. Example Hotkeys: <Control><Shift>F11, <" -"Alt>N" +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:92 +#, c-format +msgid "Failed to create GTG interface from XML: %s" msgstr "" -"Kısayol tuşları notlarınıza tek tuşla herhangi bir uygulamada çalışırken " -"ulaşmanızı sağlar. Örnek kısayol tuşları: <Control><Shift>" -"F11, <Alt>N" -#. Show notes menu keybinding... -#: ../src/preferencesdialog.cpp:403 -msgid "Show notes _menu" -msgstr "Notlar _menüsünü görüntüle" +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:100 +msgid "Failed to create D-Bus proxy for GTG" +msgstr "" + +#: ../src/addins/exporttogtg/exporttogtgnoteaddin.cpp:116 +#, c-format +msgid "Failed to call GTG: %s" +msgstr "" + +#: ../src/addins/exporttohtml/exporttohtml.desktop.in.in.h:1 +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:76 +msgid "Export to HTML" +msgstr "HTML olarak Dışa Aktar" + +#: ../src/addins/exporttohtml/exporttohtml.desktop.in.in.h:2 +#, fuzzy +#| msgid "Export linked notes" +msgid "Exports individual notes to HTML." +msgstr "Bağlı notları dışa aktar" + +#: ../src/addins/exporttohtml/exporttohtmldialog.cpp:41 +msgid "Destination for HTML Export" +msgstr "HTML Dışa Aktarımı İçin Konum" + +#: ../src/addins/exporttohtml/exporttohtmldialog.cpp:43 +msgid "Export linked notes" +msgstr "Bağlı notları dışa aktar" + +#: ../src/addins/exporttohtml/exporttohtmldialog.cpp:44 +msgid "Include all other linked notes" +msgstr "Bağlı notları içer" + +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:77 +#, fuzzy +#| msgid "Export to HTML" +msgid "Export note to HTML" +msgstr "HTML olarak Dışa Aktar" + +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:117 +#, c-format +msgid "Could not open exported note in a web browser: %s" +msgstr "" + +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:121 +#, fuzzy +#| msgid "Your note was exported to \"{0}\"." +msgid "Your note was exported to \"%1%\"." +msgstr "Notunuz \"{0}\" konumuna aktarıldı." + +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:130 +msgid "Note exported successfully" +msgstr "Not başarıyla dışa aktarıldı" + +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:144 +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:152 +#, fuzzy, c-format +#| msgid "Could not export: {0}" +msgid "Could not export: %s" +msgstr "Dışa aktarılamadı: {0}" + +#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:155 +#, c-format +msgid "Could not save the file \"%s\"" +msgstr "\"%s\" dosyası kaydedilemedi" + +#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:102 +msgid "_Folder Path:" +msgstr "_Klasör Yolu:" + +#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:109 +msgid "Select Synchronization Folder..." +msgstr "Eşzamanlandırma Klasörü Seç..." + +#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:134 +msgid "Folder path field is empty." +msgstr "Klasör yol alanı boş." + +#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:141 +#, fuzzy +#| msgid "" +#| "Specified folder path does not exist, and Tomboy was unable to create it." +msgid "" +"Specified folder path does not exist, and Gnote was unable to create it." +msgstr "Belirtilen klasör yolu mevcut değil, ve Tomboy onu oluşturamadı." + +#: ../src/addins/filesystemsyncservice/filesystemsyncserviceaddin.cpp:217 +msgid "Local Folder" +msgstr "Yerel Klasör" + +#: ../src/addins/filesystemsyncservice/filesystemsyncservice.desktop.in.in.h:1 +msgid "Local Directory Sync Service Plugin" +msgstr "" + +#: ../src/addins/filesystemsyncservice/filesystemsyncservice.desktop.in.in.h:2 +msgid "Synchronize Gnote Notes to a local file system path" +msgstr "" + +#: ../src/addins/filesystemsyncservice/filesystemsyncservice.desktop.in.in.h:3 +#: ../src/addins/webdavsyncservice/webdavsyncservice.desktop.in.in.h:3 +#, fuzzy +#| msgid "Hubert Figuiere and the Tomboy Project" +msgid "Aurimas Černius and the Tomboy Project" +msgstr "Hubert Figuiere ve Tomboy Projesi" + +#: ../src/addins/fixedwidth/fixedwidth.desktop.in.in.h:1 +msgid "Fixed Width" +msgstr "Sabit Genişlik" + +#: ../src/addins/fixedwidth/fixedwidth.desktop.in.in.h:2 +msgid "Adds fixed-width font style." +msgstr "" + +#: ../src/addins/fixedwidth/fixedwidthmenuitem.cpp:35 +msgid "Fixed Wid_th" +msgstr "_Sabit Genişlik" + +#: ../src/addins/inserttimestamp/inserttimestamp.desktop.in.in.h:1 +#: ../src/addins/inserttimestamp/inserttimestampnoteaddin.cpp:45 +msgid "Insert Timestamp" +msgstr "Zaman Etiketi Ekle" + +#: ../src/addins/inserttimestamp/inserttimestamp.desktop.in.in.h:2 +msgid "Inserts current date and time at the cursor position." +msgstr "" + +#: ../src/addins/inserttimestamp/inserttimestampnoteaddin.cpp:46 +#, fuzzy +#| msgid "Insert Timestamp" +msgid "Insert Timestamp into note" +msgstr "Zaman Etiketi Ekle" + +#. Label +#: ../src/addins/inserttimestamp/inserttimestamppreferences.cpp:70 +msgid "Choose one of the predefined formats or use your own." +msgstr "" +"Önceden tanımlanmış biçimlerin bir tanesini seçin ya da sizinkini kullanın." + +#: ../src/addins/inserttimestamp/inserttimestamppreferences.cpp:78 +msgid "Use _Selected Format" +msgstr "_Seçili Biçimi Kullan" + +#: ../src/addins/inserttimestamp/inserttimestamppreferences.cpp:110 +msgid "_Use Custom Format" +msgstr "Özel _Biçim Kullan" + +#. TRANSLATORS: first %s is file name, second is error +#: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:236 +#, c-format +msgid "NoteDirectoryWatcher: Update aborted, error reading %s: %s" +msgstr "" + +#. TRANSLATORS: %s is file +#: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:263 +#, c-format +msgid "NoteDirectoryWatcher: Error reading note title from %s" +msgstr "" + +#. TRANSLATORS: %s is file +#: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:271 +#, c-format +msgid "NoteDirectoryWatcher: Unknown error creating note from %s" +msgstr "" + +#. TRANSLATORS: first %s is file, second is error +#: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:277 +#, c-format +msgid "NoteDirectoryWatcher: Error creating note from %s: %s" +msgstr "" + +#. TRANSLATORS: first %s is file, second is error +#: ../src/addins/notedirectorywatcher/notedirectorywatcherapplicationaddin.cpp:290 +#, c-format +msgid "NoteDirectoryWatcher: Update aborted, error parsing %s: %s" +msgstr "" + +#: ../src/addins/notedirectorywatcher/notedirectorywatcherpreferences.cpp:35 +msgid "_Directory check interval:" +msgstr "" + +#: ../src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in.in.h:1 +msgid "Note Directory Watcher" +msgstr "" + +#: ../src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in.in.h:2 +msgid "Watch your Gnote note directory for changes to your notes." +msgstr "" + +#: ../src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in.in.h:3 +#, fuzzy +#| msgid "and Tomboy original authors." +msgid "Aurimas Černius and Tomboy original authors" +msgstr "ve Tomboy'un özgün yazarları." + +#: ../src/addins/noteoftheday/noteoftheday.cpp:33 +msgid "Today: Template" +msgstr "Bugün: Şablom" + +#: ../src/addins/noteoftheday/noteoftheday.cpp:35 +msgid "Today: " +msgstr "Bugün: " + +#. TRANSLATORS: first %s is note title, second is error +#. TRANSLATORS: first %s is template note title, second is error +#: ../src/addins/noteoftheday/noteoftheday.cpp:49 +#: ../src/addins/noteoftheday/noteofthedaypreferences.cpp:72 +#, c-format +msgid "NoteOfTheDay could not create %s: %s" +msgstr "" + +#: ../src/addins/noteoftheday/noteoftheday.cpp:155 +msgid "Tasks" +msgstr "Görevler" + +#: ../src/addins/noteoftheday/noteoftheday.cpp:156 +msgid "Appointments" +msgstr "Randevular" + +#. Format: "Today: Friday, July 01 2005" +#: ../src/addins/noteoftheday/noteoftheday.cpp:162 +msgid "%A, %B %d %Y" +msgstr "" + +#: ../src/addins/noteoftheday/noteoftheday.desktop.in.in.h:1 +msgid "Note of the Day" +msgstr "Günün Notu" + +#: ../src/addins/noteoftheday/noteoftheday.desktop.in.in.h:2 +msgid "" +"Automatically creates a \"Today\" note for easily jotting down daily thoughts" +msgstr "" + +#: ../src/addins/noteoftheday/noteoftheday.desktop.in.in.h:3 +msgid "Debarshi Ray and the Tomboy Project" +msgstr "" + +#: ../src/addins/noteoftheday/noteofthedaypreferences.cpp:34 +msgid "_Open Today: Template" +msgstr "Bugün: Şablom _Aç" + +#: ../src/addins/noteoftheday/noteofthedaypreferences.cpp:35 +#, fuzzy +#| msgid "" +#| "Change the Today: Template note to customize the text that new " +#| "Today notes have." +msgid "" +"Change the Today: Template note to customize " +"the text that new Today notes have." +msgstr "" +"Yeni Bugün notlarının içereceği metni özelleştirmek için Bugün: Şablon notunu değiştirin." + +#: ../src/addins/printnotes/printnotes.desktop.in.in.h:1 +msgid "Printing Support" +msgstr "" + +#: ../src/addins/printnotes/printnotes.desktop.in.in.h:2 +msgid "Allows you to print a note." +msgstr "" + +#: ../src/addins/printnotes/printnotesnoteaddin.cpp:61 +msgid "Print" +msgstr "Yazdır" + +#: ../src/addins/printnotes/printnotesnoteaddin.cpp:61 +#, fuzzy +#| msgid "Print Footer" +msgid "Print note" +msgstr "Soneki Yazdır" + +#: ../src/addins/printnotes/printnotesnoteaddin.cpp:136 +msgid "Error printing note" +msgstr "Not yazdırılırken hata oluştu" + +#. %1% is the page number, %2% is the total number of pages +#: ../src/addins/printnotes/printnotesnoteaddin.cpp:303 +#, fuzzy +#| msgid "Page {0} of {1}" +msgid "Page %1% of %2%" +msgstr "{1} sayfadan {0}" + +#: ../src/addins/readonly/readonly.desktop.in.in.h:1 +#: ../src/addins/readonly/readonlynoteaddin.cpp:53 +msgid "Read Only" +msgstr "" + +#: ../src/addins/readonly/readonly.desktop.in.in.h:2 +msgid "Mark certain notes as read only" +msgstr "" + +#: ../src/addins/readonly/readonly.desktop.in.in.h:3 +msgid "Aurimas Černius, Debarshi Ray and Arief Bayu Purwanto" +msgstr "" + +#: ../src/addins/readonly/readonlynoteaddin.cpp:54 +msgid "Make this note read-only" +msgstr "" + +#: ../src/addins/replacetitle/replacetitle.desktop.in.in.h:1 +#: ../src/addins/replacetitle/replacetitlenoteaddin.cpp:51 +msgid "Replace title" +msgstr "" + +#: ../src/addins/replacetitle/replacetitle.desktop.in.in.h:2 +#, fuzzy +#| msgid "Delete the selected note" +msgid "Replace title with selection." +msgstr "Seçilen notu sil" + +#: ../src/addins/replacetitle/replacetitle.desktop.in.in.h:3 +msgid "Pierre-Yves Luyten" +msgstr "Pierre-Yves Luyten" + +#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:1 +#: ../src/addins/specialnotes/specialnotesapplicationaddin.cpp:38 +#, fuzzy +#| msgid "Search All Notes" +msgid "Special Notes" +msgstr "Tüm Notları Ara" + +#: ../src/addins/specialnotes/specialnotes.desktop.in.in.h:2 +msgid "Show special notes, that are otherwise hidden" +msgstr "" + +#: ../src/addins/statistics/statisticsapplicationaddin.cpp:50 +msgid "Show Statistics" +msgstr "" + +#: ../src/addins/statistics/statistics.desktop.in.in.h:1 +#: ../src/addins/statistics/statisticswidget.cpp:171 +#, fuzzy +#| msgid "Status" +msgid "Statistics" +msgstr "Durum" + +#: ../src/addins/statistics/statistics.desktop.in.in.h:2 +msgid "Show various statistics about notes." +msgstr "" + +#: ../src/addins/statistics/statisticswidget.cpp:91 +#, fuzzy +#| msgid "All Notes" +msgid "Total Notes:" +msgstr "Tüm Notlar" + +#: ../src/addins/statistics/statisticswidget.cpp:97 +#, fuzzy +#| msgid "Notebooks" +msgid "Total Notebooks:" +msgstr "Not Defterleri" + +#: ../src/addins/statistics/statisticswidget.cpp:127 +#, fuzzy +#| msgid "Total: %1% note" +#| msgid_plural "Total: %1% notes" +msgid "%1% note" +msgid_plural "%1% notes" +msgstr[0] "Toplam: %1% not" + +#: ../src/addins/stickynoteimport/stickynoteimport.desktop.in.in.h:1 +#, fuzzy +#| msgid "Sticky Note Importer First Run" +msgid "Sticky Notes Importer" +msgstr "En Başta Yapışkan Not İçe Aktarıcısını Çalıştır" + +#: ../src/addins/stickynoteimport/stickynoteimport.desktop.in.in.h:2 +#, fuzzy +#| msgid "Import from Sticky Notes" +msgid "Import your notes from the Sticky Notes applet." +msgstr "Yapışkan Not'lardan İçe Aktar" + +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:87 +msgid "Import from Sticky Notes" +msgstr "Yapışkan Not'lardan İçe Aktar" + +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:214 +msgid "No Sticky Notes found" +msgstr "Yapışkan Not bulunamadı" + +#. %1% is a the file name +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:216 +#, fuzzy +#| msgid "No suitable Sticky Notes file was found at \"{0}\"." +msgid "No suitable Sticky Notes file was found at \"%1%\"." +msgstr "\"{0}\" konumunda uygun olmayayan Yapışkan Not dosyaları bulundu." + +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:224 +msgid "Sticky Notes import completed" +msgstr "Yapışkan Not içe aktarımı tamamlandı" + +#. here %1% is the number of notes imported, %2% the total number of notes. +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:226 +msgid "%1% of %2% Sticky Notes were successfully imported." +msgstr "%1% / %2% Yapışkan Not başarıyla içe aktarıldı." + +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:245 +msgid "Untitled" +msgstr "Başlıksız" + +#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:283 +msgid "Sticky Note: " +msgstr "Yapışkan Not: " + +#. namespace +#: ../src/addins/tableofcontents/tableofcontentsaction.cpp:37 +#: ../src/addins/tableofcontents/tableofcontentsaction.cpp:38 +#: ../src/addins/tableofcontents/tableofcontents.desktop.in.in.h:1 +#: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:66 +#, fuzzy +#| msgid "_Contents" +msgid "Table of Contents" +msgstr "İçi_ndekiler" + +#: ../src/addins/tableofcontents/tableofcontents.desktop.in.in.h:2 +msgid "" +"Navigate long structured notes. Set section and subsection headings in your " +"note, and the Table of Contents will show in a menu." +msgstr "" + +#: ../src/addins/tableofcontents/tableofcontents.desktop.in.in.h:3 +msgid "Luc Pionchon" +msgstr "" + +#: ../src/addins/tableofcontents/tableofcontents.desktop.in.in.h:4 +msgid "© 2013 Luc Pionchon" +msgstr "" + +#. no toc items, and no action entries = empty menu +#: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:140 +msgid "(empty table of contents)" +msgstr "" + +#: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:155 +msgid "Heading 1" +msgstr "" + +#: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:161 +msgid "Heading 2" +msgstr "" + +#: ../src/addins/tableofcontents/tableofcontentsnoteaddin.cpp:167 +msgid "Table of Contents Help" +msgstr "" + +#. namespace +#: ../src/addins/todo/todo.desktop.in.in.h:1 +msgid "TODO" +msgstr "" + +#: ../src/addins/todo/todo.desktop.in.in.h:2 +msgid "Highlight FIXME, TODO and XXX patterns in notes." +msgstr "" + +#: ../src/addins/todo/todo.desktop.in.in.h:3 +msgid "Aurimas Černius, Romain Tartière" +msgstr "" + +#: ../src/addins/tomboyimport/tomboyimport.desktop.in.in.h:1 +msgid "Tomboy Importer" +msgstr "Tomboy İçe Aktarıcı" + +#: ../src/addins/tomboyimport/tomboyimport.desktop.in.in.h:2 +msgid "Import your notes from Tomboy." +msgstr "Tomboy'daki notlarınızı içe aktarın." + +#: ../src/addins/tomboyimport/tomboyimport.desktop.in.in.h:3 +msgid "Hubert Figuiere" +msgstr "Hubert Figuiere" + +#: ../src/addins/underline/underline.desktop.in.in.h:1 +#, fuzzy +#| msgid "_Underline" +msgid "Underline" +msgstr "_Altı çizili" + +#: ../src/addins/underline/underline.desktop.in.in.h:2 +msgid "Adds ability to underline text." +msgstr "" + +#: ../src/addins/underline/underline.desktop.in.in.h:3 +msgid "Hubert Figuière and the Tomboy Project" +msgstr "Hubert Figuière ve Tomboy Projesi" + +#: ../src/addins/underline/underlinemenuitem.cpp:35 +msgid "_Underline" +msgstr "_Altı çizili" + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:70 +msgid "_URL:" +msgstr "_URL:" + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:75 +msgid "User_name:" +msgstr "_Kullanıcı adı:" + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:81 +msgid "_Password:" +msgstr "_Parola:" + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:105 +msgid "WebDAV" +msgstr "WebDAV" + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:117 +msgid "" +"There was an error connecting to the server. This may be caused by using an " +"incorrect user name and/or password." +msgstr "" +"Sunucuya bağlanırken hata oluştu. Bu yanlış kullanıcı ismi ve/veya parola " +"kullanılmasından kaynaklanabilir." + +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:173 +msgid "URL, username, or password field is empty." +msgstr "URL, kullanıcı ismi ya da parola alanı boş." + +#. TODO: If the above fails (no keyring daemon), save all but password +#. to GConf, and notify user. +#. Save configuration into GConf +#. Preferences.Set ("/apps/tomboy/sync_wdfs_url", url ?? string.Empty); +#. Preferences.Set ("/apps/tomboy/sync_wdfs_username", username ?? string.Empty); +#: ../src/addins/webdavsyncservice/webdavsyncserviceaddin.cpp:262 +#, fuzzy +#| msgid "" +#| "Saving configuration to the GNOME keyring failed with the following " +#| "message:" +msgid "" +"Saving configuration to the GNOME keyring failed with the following " +"message:\n" +"\n" +"%1%" +msgstr "" +"Yapılandırmanın GNOME anahtarlığına kaydedilmesi aşağıdaki ileti ile " +"başarısız oldu:" + +#: ../src/addins/webdavsyncservice/webdavsyncservice.desktop.in.in.h:1 +msgid "WebDAV Sync Service Plugin" +msgstr "" + +#: ../src/addins/webdavsyncservice/webdavsyncservice.desktop.in.in.h:2 +msgid "Synchronize Gnote Notes to a WebDAV URL." +msgstr "" + +#: ../src/dbus/remotecontrol-client-glue.cpp:138 +#, c-format +msgid "Remote call to %s failed" +msgstr "" + +#: ../src/dbus/remotecontrol.cpp:82 +#, c-format +msgid "Exception thrown when creating note: %s" +msgstr "" + +#: ../src/gnote.cpp:200 +msgid "Gnote is already running. Exiting..." +msgstr "" + +#: ../src/gnote.cpp:365 +msgid "and Tomboy original authors." +msgstr "ve Tomboy'un özgün yazarları." + +#: ../src/gnote.cpp:371 +msgid "translator-credits" +msgstr "Muhammet Kara " + +#: ../src/gnote.cpp:380 +#, fuzzy +#| msgid "" +#| "Copyright © 2010-2011 Aurimas Cernius\n" +#| "Copyright © 2009-2011 Debarshi Ray\n" +#| "Copyright © 2009 Hubert Figuiere\n" +#| "Copyright © 2004-2009 the Tomboy original authors." +msgid "" +"Copyright © 2010-2014 Aurimas Cernius\n" +"Copyright © 2009-2011 Debarshi Ray\n" +"Copyright © 2009 Hubert Figuiere\n" +"Copyright © 2004-2009 the Tomboy original authors." +msgstr "" +"Telif Hakkı © 2010-2011 Aurimas Cernius\n" +"Telif Hakkı © 2009-2011 Debarshi Ray\n" +"Telif Hakkı © 2009 Hubert Figuiere\n" +"Telif Hakkı © 2004-2009 Tomboy'un özgün yazarları." + +#: ../src/gnote.cpp:384 +msgid "A simple and easy to use desktop note-taking application." +msgstr "Basit ve kullanışlı bir not tutucu uygulaması." + +#: ../src/gnote.cpp:395 +msgid "Homepage" +msgstr "Web Sitesi" + +#: ../src/gnote.cpp:570 +msgid "Run Gnote in background." +msgstr "" + +#: ../src/gnote.cpp:571 +#, fuzzy +#| msgid "Run Gnote as a GNOME panel applet." +msgid "Run Gnote as GNOME Shell search provider." +msgstr "Gnote'u bir GNOME panel uygulamacığı olarak çalıştır." + +#: ../src/gnote.cpp:572 +msgid "Specify the path of the directory containing the notes." +msgstr "Notları içeren dizin yolunu belirtin." + +#: ../src/gnote.cpp:572 +msgid "path" +msgstr "yol" + +#: ../src/gnote.cpp:573 +#, fuzzy +#| msgid "Open the Search All Notes window" +msgid "Open the search all notes window with the search text." +msgstr "Tüm Notları Ara penceresini aç" + +#: ../src/gnote.cpp:573 ../src/gnote.cpp:578 +msgid "text" +msgstr "metin" + +#: ../src/gnote.cpp:574 +msgid "Print version information." +msgstr "Sürüm bilgisini yazdır." + +#: ../src/gnote.cpp:575 +msgid "Create and display a new note, with a optional title." +msgstr "İsteğe bağlı bir başlıkla yeni bir not oluştur ve görüntüle." + +#: ../src/gnote.cpp:575 +msgid "title" +msgstr "başlık" + +#: ../src/gnote.cpp:576 +msgid "Display the existing note matching title." +msgstr "" + +#: ../src/gnote.cpp:576 +msgid "title/url" +msgstr "başlık/url" + +#: ../src/gnote.cpp:577 +msgid "Display the 'Start Here' note." +msgstr "'Buradan Başla' notunu görüntüle." + +#: ../src/gnote.cpp:578 +msgid "Search and highlight text in the opened note." +msgstr "" + +#: ../src/gnote.cpp:582 +msgid "A note taking application" +msgstr "Not alma uygulaması" + +#: ../src/gnote.cpp:582 +msgid "Gnote options at launch" +msgstr "Başlangıçtaki Gnote seçenekleri" + +#: ../src/gnote.cpp:659 +msgid "Could not connect to remote instance." +msgstr "" + +#: ../src/gnote.cpp:775 +msgid "Version %1%" +msgstr "Sürüm %1%" + +#. TRANSLATORS: the first %s is icon name, %d is for size, last %s is error description +#: ../src/iconmanager.cpp:66 +#, c-format +msgid "Failed to load icon (%s, %d): %s" +msgstr "" + +#: ../src/noteaddin.cpp:108 ../src/noteaddin.cpp:122 ../src/noteaddin.cpp:135 +msgid "Plugin is disposing already" +msgstr "" + +#: ../src/noteaddin.cpp:139 +msgid "Window is not embedded" +msgstr "" + +#: ../src/notebooks/createnotebookdialog.cpp:41 +#, fuzzy +#| msgid "Create a new notebook" +msgid "Create Notebook" +msgstr "Yeni bir not defteri oluştur" + +#: ../src/notebooks/createnotebookdialog.cpp:45 +msgid "N_otebook name:" +msgstr "_Not defteri ismi:" + +#: ../src/notebooks/createnotebookdialog.cpp:58 +msgid "Name already taken" +msgstr "İsim zaten alınmış" + +#. Translation note: This is the Create button in the Create +#. New Note Dialog. +#: ../src/notebooks/createnotebookdialog.cpp:71 +msgid "C_reate" +msgstr "_Oluştur" + +#: ../src/notebooks/notebookapplicationaddin.cpp:66 +#: ../src/searchnoteswidget.cpp:229 +msgid "Notebooks" +msgstr "Not Defterleri" + +#: ../src/notebooks/notebookapplicationaddin.cpp:67 +msgid "Create a new note in a notebook" +msgstr "Bir not defteri içerisinde yeni bir not oluştur" + +#: ../src/notebooks/notebookapplicationaddin.cpp:96 +#: ../src/notebooks/notebookapplicationaddin.cpp:146 +msgid "New Note_book..." +msgstr "Yeni _Not Defteri..." + +#. The templateNoteTite should show the name of the +#. notebook. For example, if the name of the notebooks +#. "Meetings", the templateNoteTitle should be "Meetings +#. Notebook Template". Translators should place the +#. name of the notebook accordingly using "%1%". +#: ../src/notebooks/notebook.cpp:109 +msgid "%1% Notebook Template" +msgstr "%1% Not Defteri Şablonu" + +#: ../src/notebooks/notebook.cpp:185 ../src/notemanagerbase.cpp:301 +msgid "New Note" +msgstr "Yeni Not" + +#: ../src/notebooks/notebookmanager.cpp:364 +msgid "Really delete this notebook?" +msgstr "Bu not defterini silmek istediğinizden emin misiniz?" + +#: ../src/notebooks/notebookmanager.cpp:365 +msgid "" +"The notes that belong to this notebook will not be deleted, but they will no " +"longer be associated with this notebook. This action cannot be undone." +msgstr "" +"Bu not defterine ait olan notlar silinmeyecek, ancak artık bu not defteri " +"ile ilişkilendirilmeyecekler. Bu eylem geri alınamaz." + +#: ../src/notebooks/notebookmenuitem.cpp:35 +msgid "No notebook" +msgstr "Not defteri yok" + +#: ../src/notebooks/notebooknewnotemenuitem.cpp:40 +msgid "New \"%1%\" Note" +msgstr "Yeni \"%1%\" Not" + +#: ../src/notebooks/notebooknoteaddin.cpp:81 +msgid "Place this note into a notebook" +msgstr "Bu notu not defteri içerisine yerleştir" + +#: ../src/notebooks/notebooknoteaddin.cpp:191 +msgid "Notebook" +msgstr "Not defteri" + +#: ../src/notebooks/notebooknoteaddin.cpp:214 +msgid "_New notebook..." +msgstr "Yeni _not defteri..." + +#: ../src/notebooks/specialnotebooks.cpp:46 +msgid "All" +msgstr "Hepsi" + +#: ../src/notebooks/specialnotebooks.cpp:75 +#, fuzzy +#| msgid "Unfiled Notes" +msgid "Unfiled" +msgstr "Dosyalanmamış Notlar" + +#: ../src/notebooks/specialnotebooks.cpp:106 +msgid "Important" +msgstr "" + +#: ../src/notebooks/specialnotebooks.cpp:133 +msgid "Active" +msgstr "" + +#: ../src/notebuffer.cpp:1498 +msgid " tag mismatch" +msgstr "" + +#: ../src/notebuffer.cpp:1577 +#, c-format +msgid "Exception: %s" +msgstr "" + +#. TRANSLATORS: %1% will be replaced by note title +#: ../src/note.cpp:59 +#, fuzzy +#| msgid "Really delete this {0} note?" +#| msgid_plural "Really delete these {0} notes?" +msgid "Really delete \"%1%\"?" +msgstr "Bu {0} not gerçekten silinsin mi?" + +#. TRANSLATORS: %1% is number of notes +#: ../src/note.cpp:63 +msgid "Really delete %1% note?" +msgid_plural "Really delete %1% notes?" +msgstr[0] "%1% adet not gerçekten silinsin mi?" + +#: ../src/note.cpp:70 +msgid "If you delete a note it is permanently lost." +msgstr "Eğer bir notu silerseniz kalıcı olarak kaybolacaktır." + +#: ../src/note.cpp:106 +msgid "Error saving note data." +msgstr "Not bilgisi kaydedilirken hata." + +#: ../src/note.cpp:107 +#, fuzzy +#| msgid "" +#| "An error occurred while saving your notes. Please check that you have " +#| "sufficient disk space, and that you have appropriate rights on {0}. Error " +#| "details can be found in {1}." +msgid "" +"An error occurred while saving your notes. Please check that you have " +"sufficient disk space, and that you have appropriate rights on ~/.local/" +"share/gnote. Error details can be found in ~/.gnote.log." +msgstr "" +"Notlarınız kaydedilirken bir hata oluştu. Lütfen yeterli disk alanınız " +"olduğundan ve {0} üzerinde yeterli haklara sahip olduğunuzdan emin olun. " +"Hata ayrıntılarını {1} konumunda bulabilirsiniz." + +#. Probably IOException or UnauthorizedAccessException? +#: ../src/note.cpp:382 ../src/notebase.cpp:200 +#, c-format +msgid "Exception while saving note: %s" +msgstr "" + +#: ../src/note.cpp:474 +#, fuzzy, c-format +#| msgid "Error saving icon" +msgid "Error while saving: %s" +msgstr "Simge kaydedilirken hata" + +#: ../src/note.cpp:699 +msgid "Setting text content for closed notes not supported" +msgstr "" + +#. write failure, but not critical +#: ../src/notebase.cpp:444 +#, c-format +msgid "Failed to update note format: %s" +msgstr "" + +#: ../src/notebase.cpp:568 +#, c-format +msgid "Filesystem error: %s" +msgstr "" + +#: ../src/notemanager.cpp:133 +#, fuzzy +#| msgid "" +#| "Start Here\n" +#| "\n" +#| "Welcome to Tomboy!\n" +#| "\n" +#| "Use this \"Start Here\" note to begin organizing your ideas and " +#| "thoughts.\n" +#| "\n" +#| "You can create new notes to hold your ideas by selecting the \"Create New " +#| "Note\" item from the Tomboy Notes menu in your GNOME Panel. Your note " +#| "will be saved automatically.\n" +#| "\n" +#| "Then organize the notes you create by linking related notes and ideas " +#| "together!\n" +#| "\n" +#| "We've created a note called Using Links in Tomboy. Notice how each time we type Using Links in " +#| "Tomboy it automatically gets underlined? Click on the " +#| "link to open the note." +msgid "" +"Start " +"Here\n" +"\n" +"Welcome to Gnote!\n" +"\n" +"Use this \"Start Here\" note to begin organizing your ideas and thoughts.\n" +"\n" +"You can create new notes to hold your ideas by selecting the \"Create New " +"Note\" item from the Gnote menu in your GNOME Panel. Your note will be saved " +"automatically.\n" +"\n" +"Then organize the notes you create by linking related notes and ideas " +"together!\n" +"\n" +"We've created a note called Using Links in Gnote. Notice how each time we type Using Links in " +"Gnote it automatically gets underlined? Click on the link " +"to open the note." +msgstr "" +"Buradan Başla\n" +"\n" +"Tomboy'a Hoşgeldiniz!\n" +"\n" +"Bu \"Buradan Başla\" notunu fikirlerinizi ve düşüncelerinizi organize etmeye " +"başlamak için kullanın.\n" +"\n" +"GNOME Panel'de bulunan Tomboy Notlar menüsündeki \"Yeni Not Oluştur\" " +"öğesini seçerek fikirlerinizi saklayacak yeni notlar oluşturabilirsiniz. " +"Notunuz kendiliğinden kaydedilecektir.\n" +"\n" +"Daha sonra notlarınızı ilişkili fikirlere ve notlarlara bağlar oluşturarak " +"organize edin.\n" +"\n" +"Tomboy'da Bağları Kullanmak notunu " +"oluşturduk. Her Tomboy'da Bağları Kullanmak " +"yazışımızda kendiliğinden altının çizildiğini farkettiniz mi? Notu açmak " +"için bağın üzerine tıklayın." + +#: ../src/notemanager.cpp:152 +#, fuzzy +#| msgid "" +#| "Using Links in Tomboy\n" +#| "\n" +#| "Notes in Tomboy can be linked together by highlighting text in the " +#| "current note and clicking the Link button above in the " +#| "toolbar. Doing so will create a new note and also underline the note's " +#| "title in the current note.\n" +#| "\n" +#| "Changing the title of a note will update links present in other notes. " +#| "This prevents broken links from occurring when a note is renamed.\n" +#| "\n" +#| "Also, if you type the name of another note in your current note, it will " +#| "automatically be linked for you." +msgid "" +"Using Links in Gnote\n" +"\n" +"Notes in Gnote can be linked together by highlighting text in the current " +"note and clicking the Link button above in the toolbar. Doing " +"so will create a new note and also underline the note's title in the current " +"note.\n" +"\n" +"Changing the title of a note will update links present in other notes. This " +"prevents broken links from occurring when a note is renamed.\n" +"\n" +"Also, if you type the name of another note in your current note, it will " +"automatically be linked for you." +msgstr "" +"Tomboy'da Bağları Kullanmak\n" +"\n" +"Tomboy'daki notlar birbirlerine mevcut nottaki metni seçip yukarıdaki araç " +"çubuğundaki Bağ düğmesine tıklanarak bağlanabilir. Bunu yapmak " +"yeni bir not oluşturur ve aynı zamanda oluşturulan notun başlığını mevcut " +"notta altı çizili olarak gösterir.\n" +"\n" +"Bir notun başlığını değiştirmek diğer notlarda bulunan notun bağlarını da " +"günceller. Bu bir notun ismi değiştiğinde bağların bozulmasını engeller.\n" +"\n" +"Ayrıca eğer mevcut notunuzda başka bir notun ismini yazarsanız, o " +"kendiliğinden sizin için bağlanmış olur." + +#. Attempt to find an existing Start Here note +#: ../src/notemanager.cpp:167 ../src/notemanager.cpp:208 +msgid "Start Here" +msgstr "Buradan Başla" + +#: ../src/notemanager.cpp:173 +#, fuzzy +#| msgid "Using Links in Tomboy" +msgid "Using Links in Gnote" +msgstr "Tomboy'da Bağları Kullanmak" + +#: ../src/notemanager.cpp:178 +#, fuzzy, c-format +#| msgid "Error printing note" +msgid "Error creating start notes: %s" +msgstr "Not yazdırılırken hata oluştu" + +#. TRANSLATORS: first %s is file, second is error +#: ../src/notemanager.cpp:196 +#, c-format +msgid "Error parsing note XML, skipping \"%s\": %s" +msgstr "" + +#: ../src/notemanagerbase.cpp:105 ../src/preferencesdialog.cpp:332 +msgid "New Note Template" +msgstr "Yeni Not Şablomu" + +#: ../src/notemanagerbase.cpp:359 +msgid "Describe your new note here." +msgstr "Yeni notunuzu burada açıklayın." + +#: ../src/noterenamedialog.cpp:123 +msgid "Rename Note Links?" +msgstr "Not Bağlantıları Yeniden Adlandırılsın Mı?" + +#: ../src/noterenamedialog.cpp:127 +msgid "_Don't Rename Links" +msgstr "Bağlantıları _Yeniden Adlandırma" + +#: ../src/noterenamedialog.cpp:128 +msgid "_Rename Links" +msgstr "_Bağlantıları Yeniden Adlandır" + +#: ../src/noterenamedialog.cpp:129 +msgid "Select All" +msgstr "Tümünü Seç" + +#: ../src/noterenamedialog.cpp:130 +msgid "Select None" +msgstr "Hiçbirini Seçme" + +#: ../src/noterenamedialog.cpp:131 +msgid "Always show this _window" +msgstr "Bu _pencereyi herzaman göster" + +#: ../src/noterenamedialog.cpp:132 +msgid "Alwa_ys rename links" +msgstr "Bağlantıları her _zaman yeniden adlandır" + +#: ../src/noterenamedialog.cpp:134 +msgid "Never rename _links" +msgstr "_Bağlantıları hiçbir zaman yeniden adlandırma" + +#: ../src/noterenamedialog.cpp:152 +#, fuzzy +#| msgid "" +#| "Rename links in other notes from \"{0}" +#| "\" to \"{1}\"?\n" +#| "\n" +#| "If you do not rename the links, they will no longer link to anything." +msgid "" +"Rename links in other notes from \"%1\" to " +"\"%2\"?\n" +"\n" +"If you do not rename the links, they will no longer link to anything." +msgstr "" +"Diğer notlardaki bağlantıların adları \"{0}" +"\"dan \"{1}\"a değiştirilsin mi?\n" +"\n" +"Eğer bağlantıları yeniden adlandırmazsanız, bundan sonra herhani bir yeri " +"göstermeyecekler." + +#: ../src/noterenamedialog.cpp:185 +msgid "Rename Links" +msgstr "Bağlantıları Yeniden Adlandır" -#. Open Start Here keybinding... -#: ../src/preferencesdialog.cpp:420 -msgid "Open \"_Start Here\"" -msgstr "\"_Buradan Başla\" notunu aç" +#: ../src/noterenamedialog.cpp:200 ../src/synchronization/syncdialog.cpp:331 +msgid "Note Title" +msgstr "Not Başlığı" -#. Create new note keybinding... -#: ../src/preferencesdialog.cpp:436 -msgid "Create _new note" -msgstr "Yeni _not oluştur" +#: ../src/noterenamedialog.cpp:237 +msgid "Ad_vanced" +msgstr "_Gelişmiş" -#. Open Search All Notes window keybinding... -#: ../src/preferencesdialog.cpp:452 -msgid "Open \"Search _All Notes\"" -msgstr "\"Tüm Notları Ara\" _Aç" +#: ../src/notewindow.cpp:372 +msgid "_Link to New Note" +msgstr "Yeni notla _bağla" -#: ../src/preferencesdialog.cpp:479 -msgid "Ser_vice:" -msgstr "_Servis:" +#: ../src/notewindow.cpp:380 +msgid "Te_xt" +msgstr "M_etin" -#: ../src/preferencesdialog.cpp:536 -msgid "Not configurable" -msgstr "Yapılandırılamaz" +#: ../src/notewindow.cpp:417 +msgid "Set properties of text" +msgstr "Metin özelliklerini ayarla" -#. "Advanced..." button to bring up extra sync config dialog -#: ../src/preferencesdialog.cpp:556 -msgid "_Advanced..." -msgstr "_Gelişmiş..." +#: ../src/notewindow.cpp:421 +msgid "Is Important" +msgstr "" -#: ../src/preferencesdialog.cpp:603 -msgid "The following add-ins are installed" -msgstr "Aşağıdaki eklentiler kurulmuş" +#: ../src/notewindow.cpp:422 +msgid "Toggle notes presence in Important Notes notebook" +msgstr "" -#. TODO: In a future version, add in an "Install Add-ins..." button -#. TODO: In a future version, add in a "Repositories..." button -#: ../src/preferencesdialog.cpp:634 -msgid "_Enable" -msgstr "_Etkinleştir" +#: ../src/notewindow.cpp:430 ../src/searchnoteswidget.cpp:144 +#: ../src/searchnoteswidget.cpp:147 +msgid "_Delete" +msgstr "_Sil" -#: ../src/preferencesdialog.cpp:640 -msgid "_Disable" -msgstr "_Etkisizleştir" +#: ../src/notewindow.cpp:430 +msgid "Delete this note" +msgstr "Bu notu sil" -#: ../src/preferencesdialog.cpp:771 -msgid "Not Implemented" -msgstr "UygulanmamışIugul" +#: ../src/notewindow.cpp:446 +msgid "" +"This note is a template note. It determines the default content of regular " +"notes, and will not show up in the note menu or search window." +msgstr "" -#: ../src/preferencesdialog.cpp:785 -#| msgid "_Preferences" -msgid "%1% Preferences" -msgstr "%1% Tercihleri" +#: ../src/notewindow.cpp:449 +#, fuzzy +#| msgid "Connect to Server" +msgid "Convert to regular note" +msgstr "Sunucuya Bağlan" -#: ../src/preferencesdialog.cpp:926 -msgid "Choose Note Font" -msgstr "Not Yazıtipi Seçin" +#: ../src/notewindow.cpp:452 +#, fuzzy +#| msgid "Note Title" +msgid "Save Si_ze" +msgstr "Not Başlığı" -#: ../src/preferencesdialog.cpp:1048 -msgid "Version:" -msgstr "Sürüm:" +#: ../src/notewindow.cpp:456 +#, fuzzy +#| msgid "Select None" +msgid "Save Se_lection" +msgstr "Hiçbirini Seçme" -#: ../src/preferencesdialog.cpp:1053 -msgid "Author:" -msgstr "Yazan:" +#: ../src/notewindow.cpp:460 +#, fuzzy +#| msgid "Note Title" +msgid "Save _Title" +msgstr "Not Başlığı" -#: ../src/preferencesdialog.cpp:1059 -msgid "Copyright:" -msgstr "Telif Hakkı:" +#: ../src/notewindow.cpp:562 ../src/notewindow.cpp:1084 +msgid "Cannot create note" +msgstr "Not oluşturulamıyor" + +#: ../src/notewindow.cpp:827 +#, fuzzy +#| msgid "Link" +msgid "_Link" +msgstr "Bağ" + +#: ../src/notewindow.cpp:828 +msgid "_Bold" +msgstr "_Kalın" + +#: ../src/notewindow.cpp:829 +msgid "_Italic" +msgstr "_Eğik" + +#: ../src/notewindow.cpp:830 +msgid "_Strikeout" +msgstr "_Üstü çizili" + +#: ../src/notewindow.cpp:832 +msgid "_Highlight" +msgstr "_Aydınlat" + +#: ../src/notewindow.cpp:834 +msgid "_Normal" +msgstr "_Normal" + +#: ../src/notewindow.cpp:836 +msgid "Hu_ge" +msgstr "Çok _büyük" + +#: ../src/notewindow.cpp:838 +msgid "_Large" +msgstr "Bü_yük" + +#: ../src/notewindow.cpp:840 +msgid "S_mall" +msgstr "_Küçük" + +#: ../src/notewindow.cpp:842 +msgid "Bullets" +msgstr "İşaretler" + +#: ../src/preferencesdialog.cpp:121 +msgid "General" +msgstr "" + +#: ../src/preferencesdialog.cpp:122 +#, fuzzy +#| msgid "Link" +msgid "Links" +msgstr "Bağ" + +#: ../src/preferencesdialog.cpp:125 +msgid "Hotkeys" +msgstr "Kısayollar" + +#. TRANSLATORS: Addin category. +#: ../src/preferencesdialog.cpp:129 ../src/sharp/addinstreemodel.cpp:164 +msgid "Synchronization" +msgstr "Eşzamanlandırma" + +#: ../src/preferencesdialog.cpp:131 +msgid "Plugins" +msgstr "" + +#: ../src/preferencesdialog.cpp:208 +#, c-format +msgid "Plugin %s is absent" +msgstr "" + +#. Status icon +#: ../src/preferencesdialog.cpp:247 +#, fuzzy +#| msgid "Use custom _font" +msgid "Use status _icon" +msgstr "Özel _yazı tipi kullan" + +#: ../src/preferencesdialog.cpp:248 +msgid "Show icon in tray, which is the central place of control." +msgstr "" + +#. Open in new window +#: ../src/preferencesdialog.cpp:255 +#, fuzzy +#| msgid "Always show this _window" +msgid "Always _open notes in new window" +msgstr "Bu _pencereyi herzaman göster" + +#: ../src/preferencesdialog.cpp:268 +msgid "_Spell check while typing" +msgstr "_Yazarken imla denetimi yap" + +#: ../src/preferencesdialog.cpp:269 +msgid "" +"Misspellings will be underlined in red, with correct spelling suggestions " +"shown in the context menu." +msgstr "" +"İmla hatalarının altı kırmızı çizilir ve doğru yazım önerileri içerik " +"menüsünde görüntülenir." + +#. Auto bulleted list +#: ../src/preferencesdialog.cpp:279 +msgid "Enable auto-_bulleted lists" +msgstr "_Kendiliğinden işaretli listeleri etkinleştir" + +#: ../src/preferencesdialog.cpp:280 +msgid "Start new bulleted list by starting new line with character \"-\"." +msgstr "" + +#: ../src/preferencesdialog.cpp:289 +msgid "Use custom _font" +msgstr "Özel _yazı tipi kullan" + +#: ../src/preferencesdialog.cpp:307 +msgid "When renaming a linked note: " +msgstr "Bağlantılı bir notu yeniden adlandırırken: " + +#: ../src/preferencesdialog.cpp:311 +msgid "Ask me what to do" +msgstr "Ne yapılacağını bana sor" + +#: ../src/preferencesdialog.cpp:312 +msgid "Never rename links" +msgstr "Bağlantıları hiçbir zaman yeniden adlandırma" + +#: ../src/preferencesdialog.cpp:313 +msgid "Always rename links" +msgstr "Bağlantıları her zaman yeniden adlandır" + +#: ../src/preferencesdialog.cpp:333 +msgid "" +"Use the new note template to specify the text that should be used when " +"creating a new note." +msgstr "" +"Yeni bir not oluştururken kullanılacak metni yeni not şablomu olarak belirt." + +#: ../src/preferencesdialog.cpp:338 +msgid "Open New Note Template" +msgstr "Yeni Not Şablomu Aç" + +#. internal links +#: ../src/preferencesdialog.cpp:395 +msgid "_Automatically link to notes" +msgstr "" + +#: ../src/preferencesdialog.cpp:396 +msgid "Enable this option to create a link when text matches note title." +msgstr "" -#: ../src/notemanager.cpp:249 +#. URLs +#: ../src/preferencesdialog.cpp:402 +msgid "Create links for _URLs" +msgstr "" + +#: ../src/preferencesdialog.cpp:403 #, fuzzy #| msgid "" -#| "Start Here\n" -#| "\n" -#| "Welcome to Tomboy!\n" -#| "\n" -#| "Use this \"Start Here\" note to begin organizing your ideas and " -#| "thoughts.\n" -#| "\n" -#| "You can create new notes to hold your ideas by selecting the \"Create New " -#| "Note\" item from the Tomboy Notes menu in your GNOME Panel. Your note " -#| "will be saved automatically.\n" -#| "\n" -#| "Then organize the notes you create by linking related notes and ideas " -#| "together!\n" -#| "\n" -#| "We've created a note called Using Links in Tomboy. Notice how each time we type Using Links in " -#| "Tomboy it automatically gets underlined? Click on the " -#| "link to open the note." +#| "Enable this option to highlight words ThatLookLikeThis. Clicking the word " +#| "will create a note with that name." msgid "" -"Start " -"Here\n" -"\n" -"Welcome to Gnote!\n" -"\n" -"Use this \"Start Here\" note to begin organizing your ideas and thoughts.\n" -"\n" -"You can create new notes to hold your ideas by selecting the \"Create New " -"Note\" item from the Gnote menu in your GNOME Panel. Your note will be saved " -"automatically.\n" -"\n" -"Then organize the notes you create by linking related notes and ideas " -"together!\n" -"\n" -"We've created a note called Using Links in Gnote. Notice how each time we type Using Links in " -"Gnote it automatically gets underlined? Click on the link " -"to open the note." +"Enable this option to create links for URLs. Clicking will open URL with " +"apropriate program." msgstr "" -"Buradan Başla\n" -"\n" -"Tomboy'a Hoşgeldiniz!\n" -"\n" -"Bu \"Buradan Başla\" notunu fikirlerinizi ve düşüncelerinizi organize etmeye " -"başlamak için kullanın.\n" -"\n" -"GNOME Panel'de bulunan Tomboy Notlar menüsündeki \"Yeni Not Oluştur\" " -"öğesini seçerek fikirlerinizi saklayacak yeni notlar oluşturabilirsiniz. " -"Notunuz kendiliğinden kaydedilecektir.\n" -"\n" -"Daha sonra notlarınızı ilişkili fikirlere ve notlarlara bağlar oluşturarak " -"organize edin.\n" -"\n" -"Tomboy'da Bağları Kullanmak notunu " -"oluşturduk. Her Tomboy'da Bağları Kullanmak " -"yazışımızda kendiliğinden altının çizildiğini farkettiniz mi? Notu açmak " -"için bağın üzerine tıklayın." +"BöyleGörünenSözcükler'in aydınlatılmasını isterseniz bu seçeneği " +"etkinleştirin. Bu sözcüğü tıklatmak bu adla yeni bir not oluşturulmasını " +"sağlayacaktır." + +#. WikiWords... +#: ../src/preferencesdialog.cpp:410 +msgid "Highlight _WikiWords" +msgstr "_WikiSözcükleri aydınlat" + +#: ../src/preferencesdialog.cpp:411 +msgid "" +"Enable this option to highlight words ThatLookLikeThis. Clicking the " +"word will create a note with that name." +msgstr "" +"BöyleGörünenSözcükler'in aydınlatılmasını isterseniz bu seçeneği " +"etkinleştirin. Bu sözcüğü tıklatmak bu adla yeni bir not oluşturulmasını " +"sağlayacaktır." + +#. Hotkeys... +#: ../src/preferencesdialog.cpp:441 +#, fuzzy +#| msgid "Listen for _Hotkeys" +msgid "Listen for _hotkeys" +msgstr "Kısayol _tuşlarını dinle" + +#: ../src/preferencesdialog.cpp:442 +msgid "" +"Hotkeys allow you to quickly access your notes from anywhere with a " +"keypress. Example Hotkeys: <Control><Shift>F11, <" +"Alt>N" +msgstr "" +"Kısayol tuşları notlarınıza tek tuşla herhangi bir uygulamada çalışırken " +"ulaşmanızı sağlar. Örnek kısayol tuşları: <Control><Shift>" +"F11, <Alt>N" + +#. Show notes menu keybinding... +#: ../src/preferencesdialog.cpp:464 +msgid "Show notes _menu" +msgstr "Notlar _menüsünü görüntüle" + +#. Open Start Here keybinding... +#: ../src/preferencesdialog.cpp:481 +msgid "Open \"_Start Here\"" +msgstr "\"_Buradan Başla\" notunu aç" + +#. Create new note keybinding... +#: ../src/preferencesdialog.cpp:497 +msgid "Create _new note" +msgstr "Yeni _not oluştur" -#: ../src/notemanager.cpp:268 +#. Open Search window keybinding... +#: ../src/preferencesdialog.cpp:513 #, fuzzy -#| msgid "" -#| "Using Links in Tomboy\n" -#| "\n" -#| "Notes in Tomboy can be linked together by highlighting text in the " -#| "current note and clicking the Link button above in the " -#| "toolbar. Doing so will create a new note and also underline the note's " -#| "title in the current note.\n" -#| "\n" -#| "Changing the title of a note will update links present in other notes. " -#| "This prevents broken links from occurring when a note is renamed.\n" -#| "\n" -#| "Also, if you type the name of another note in your current note, it will " -#| "automatically be linked for you." -msgid "" -"Using Links in Gnote\n" -"\n" -"Notes in Gnote can be linked together by highlighting text in the current " -"note and clicking the Link button above in the toolbar. Doing " -"so will create a new note and also underline the note's title in the current " -"note.\n" -"\n" -"Changing the title of a note will update links present in other notes. This " -"prevents broken links from occurring when a note is renamed.\n" -"\n" -"Also, if you type the name of another note in your current note, it will " -"automatically be linked for you." -msgstr "" -"Tomboy'da Bağları Kullanmak\n" -"\n" -"Tomboy'daki notlar birbirlerine mevcut nottaki metni seçip yukarıdaki araç " -"çubuğundaki Bağ düğmesine tıklanarak bağlanabilir. Bunu yapmak " -"yeni bir not oluşturur ve aynı zamanda oluşturulan notun başlığını mevcut " -"notta altı çizili olarak gösterir.\n" -"\n" -"Bir notun başlığını değiştirmek diğer notlarda bulunan notun bağlarını da " -"günceller. Bu bir notun ismi değiştiğinde bağların bozulmasını engeller.\n" -"\n" -"Ayrıca eğer mevcut notunuzda başka bir notun ismini yazarsanız, o " -"kendiliğinden sizin için bağlanmış olur." +#| msgid "Open Search Dialog" +msgid "Open Search _Window" +msgstr "Arama Penceresini Aç" -#. Attempt to find an existing Start Here note -#: ../src/notemanager.cpp:283 ../src/notemanager.cpp:336 -msgid "Start Here" -msgstr "Buradan Başla" +#: ../src/preferencesdialog.cpp:553 +msgid "Ser_vice:" +msgstr "_Servis:" + +#: ../src/preferencesdialog.cpp:609 ../src/preferencesdialog.cpp:1239 +msgid "Not configurable" +msgstr "Yapılandırılamaz" -#: ../src/notemanager.cpp:289 +#: ../src/preferencesdialog.cpp:636 #, fuzzy -#| msgid "Using Links in Tomboy" -msgid "Using Links in Gnote" -msgstr "Tomboy'da Bağları Kullanmak" +#| msgid "Automatic Background Synchronization Timeout" +msgid "Automatical background s_ync interval (minutes)" +msgstr "Otomatik Arkaplan Eşzamanlamasında Zaman Aşımı" -#: ../src/notemanager.cpp:554 -#| msgid "_New Note" -msgid "New Note" -msgstr "Yeni Not" +#. "Advanced..." button to bring up extra sync config dialog +#: ../src/preferencesdialog.cpp:660 +msgid "_Advanced..." +msgstr "_Gelişmiş..." -#: ../src/notemanager.cpp:682 -msgid "Describe your new note here." -msgstr "Yeni notunuzu burada açıklayın." +#: ../src/preferencesdialog.cpp:707 +#, fuzzy +#| msgid "The following add-ins are installed" +msgid "The following plugins are installed:" +msgstr "Aşağıdaki eklentiler kurulmuş" -#: ../src/noterenamedialog.cpp:121 -msgid "Rename Note Links?" -msgstr "Not Bağlantıları Yeniden Adlandırılsın Mı?" +#. TODO: In a future version, add in an "Install Add-ins..." button +#. TODO: In a future version, add in a "Repositories..." button +#: ../src/preferencesdialog.cpp:742 +msgid "_Enable" +msgstr "_Etkinleştir" -#: ../src/noterenamedialog.cpp:125 -msgid "_Don't Rename Links" -msgstr "Bağlantıları _Yeniden Adlandırma" +#: ../src/preferencesdialog.cpp:748 +msgid "_Disable" +msgstr "_Etkisizleştir" -#: ../src/noterenamedialog.cpp:126 -msgid "_Rename Links" -msgstr "_Bağlantıları Yeniden Adlandır" +#: ../src/preferencesdialog.cpp:906 +msgid "Not Implemented" +msgstr "UygulanmamışIugul" -#: ../src/noterenamedialog.cpp:127 -msgid "Select All" -msgstr "Tümünü Seç" +#: ../src/preferencesdialog.cpp:922 +msgid "%1% Preferences" +msgstr "%1% Tercihleri" -#: ../src/noterenamedialog.cpp:128 -msgid "Select None" -msgstr "Hiçbirini Seçme" +#: ../src/preferencesdialog.cpp:1057 +msgid "Choose Note Font" +msgstr "Not Yazıtipi Seçin" -#: ../src/noterenamedialog.cpp:129 -msgid "Always show this _window" -msgstr "Bu _pencereyi herzaman göster" +#. Create dialog +#: ../src/preferencesdialog.cpp:1155 +msgid "Other Synchronization Options" +msgstr "Diğer Eşzamanlandırma Seçenekleri" -#: ../src/noterenamedialog.cpp:130 -msgid "Alwa_ys rename links" -msgstr "Bağlantıları her _zaman yeniden adlandır" +#: ../src/preferencesdialog.cpp:1158 +msgid "" +"When a conflict is detected between a local note and a note on the " +"configured synchronization server:" +msgstr "" +"Yerel bir not ile yapılandırılmış eşzamanlandırma sunucusu üzerindeki not " +"arasında çakışma tespit edildiğinde:" -#: ../src/noterenamedialog.cpp:132 -msgid "Never rename _links" -msgstr "_Bağlantıları hiçbir zaman yeniden adlandırma" +#. label.Xalign = 0; +#: ../src/preferencesdialog.cpp:1162 +#, fuzzy +#| msgid "Always ask me what to do." +msgid "Always ask me what to do" +msgstr "Ne yapılacağını her zaman bana sor." + +#: ../src/preferencesdialog.cpp:1166 +#| msgid "Rename my local note." +msgid "Rename my local note" +msgstr "Yerel notumu yeniden adlandır" + +#: ../src/preferencesdialog.cpp:1170 +#, fuzzy +#| msgid "Replace my local note with the server's update." +msgid "Replace my local note with the server's update" +msgstr "Sunucudaki güncel olaranı ile beni notumu yer değiştir." + +#: ../src/preferencesdialog.cpp:1272 +msgid "Are you sure?" +msgstr "Emin misiniz?" + +#: ../src/preferencesdialog.cpp:1273 +msgid "" +"Clearing your synchronization settings is not recommended. You may be " +"forced to synchronize all of your notes again when you save new settings." +msgstr "" +"Eşzamanlandırma ayarlarınızı temizlemek tavsiye edilmiyor. Yeni ayarları " +"kaydettiğinizde tüm notlarınızı tekrar eşzamanlandırmaya zorlanabilrisiniz." -#: ../src/noterenamedialog.cpp:151 +#: ../src/preferencesdialog.cpp:1283 +msgid "Resetting Synchronization Settings" +msgstr "Eşzamanlandırma Ayarları Sıfırlanıyor" + +#: ../src/preferencesdialog.cpp:1284 +msgid "" +"You have disabled the configured synchronization service. Your " +"synchronization settings will now be cleared. You may be forced to " +"synchronize all of your notes again when you save new settings." +msgstr "" +"Yapılandırılmış eşzamanlandırma servisini etkinsizleştirdiniz. Şimdi " +"eşzamanlandırma ayarlarını temizlenecek. Yeni ayarları kaydettiğinizde " +"terkar tüm notlarınızı eşzamanlandırmaya zorlanabilirsiniz." + +#: ../src/preferencesdialog.cpp:1350 +msgid "Connection successful" +msgstr "Bağlantı başarılı" + +#: ../src/preferencesdialog.cpp:1351 #, fuzzy #| msgid "" -#| "Rename links in other notes from \"{0}" -#| "\" to \"{1}\"?\n" -#| "\n" -#| "If you do not rename the links, they will no longer link to anything." +#| "Tomboy is ready to synchronize your notes. Would you like to synchronize " +#| "them now?" msgid "" -"Rename links in other notes from \"%1\" to" -"\"%2\"?\n" -"\n" -"If you do not rename the links, they will no longer link to anything." +"Gnote is ready to synchronize your notes. Would you like to synchronize them " +"now?" msgstr "" -"Diğer notlardaki bağlantıların adları \"{0}" -"\"dan \"{1}\"a değiştirilsin mi?\n" -"\n" -"Eğer bağlantıları yeniden adlandırmazsanız, bundan sonra herhani bir yeri " -"göstermeyecekler." +"Tomboy notlarınızı eşzamanlandırmak için hazır. Notlarınızı şimdi " +"eşzamanlandırmak istiyor musunuz?" -#: ../src/noterenamedialog.cpp:184 -msgid "Rename Links" -msgstr "Bağlantıları Yeniden Adlandır" +#: ../src/preferencesdialog.cpp:1375 +#, fuzzy +#| msgid "" +#| "Please check your information and try again. The log file {0} may " +#| "contain more information about the error." +msgid "" +"Please check your information and try again. The log file %1% may contain " +"more information about the error." +msgstr "" +"Lütfen bilgilerinizi kontrol edip tekrar deneyin. Günlük dosyası {0}, hata " +"hakkında daha fazla bilgi içeriyor olabilir." -#: ../src/noterenamedialog.cpp:199 -msgid "Note Title" -msgstr "Not Başlığı" +#: ../src/preferencesdialog.cpp:1380 +msgid "Error connecting" +msgstr "Bağlanırken hata oluştu" -#: ../src/noterenamedialog.cpp:235 -msgid "Ad_vanced" -msgstr "_Gelişmiş" +#: ../src/preferencesdialog.cpp:1443 +msgid "Version:" +msgstr "Sürüm:" -#: ../src/notewindow.cpp:78 -msgid "Find in This Note" -msgstr "Bu Not İçinde Bul" +#: ../src/preferencesdialog.cpp:1446 +msgid "Author:" +msgstr "Yazan:" -#: ../src/notewindow.cpp:328 -msgid "_Link to New Note" -msgstr "Yeni notla _bağla" +#: ../src/preferencesdialog.cpp:1451 +msgid "Copyright:" +msgstr "Telif Hakkı:" -#: ../src/notewindow.cpp:336 -msgid "Te_xt" -msgstr "M_etin" +#: ../src/recentchanges.cpp:129 +msgid "All Notes" +msgstr "Tüm Notlar" -#: ../src/notewindow.cpp:345 -msgid "_Find in This Note" -msgstr "_Bu Not İçinde Bul" - -#: ../src/notewindow.cpp:360 -msgid "Clos_e All Notes" -msgstr "Tü_m Notları Kapat" +#: ../src/recentchanges.cpp:135 +#| msgid "_New" +msgid "New" +msgstr "Yeni" -#: ../src/notewindow.cpp:395 +#: ../src/recentchanges.cpp:156 msgid "Search" msgstr "Ara" -#: ../src/notewindow.cpp:399 -msgid "Search your notes (Ctrl-Shift-F)" -msgstr "Notlarınızı arayın (Ctrl-Shift-F)" +#: ../src/recentchanges.cpp:197 +msgid "Find _Next" +msgstr "So_nrakini Bul" -#: ../src/notewindow.cpp:409 -msgid "Link" -msgstr "Bağ" +#: ../src/recentchanges.cpp:205 +msgid "Find _Previous" +msgstr "Ön_cekini Bul" -#: ../src/notewindow.cpp:415 -#, fuzzy -#| msgid "Link selected text to a new note" -msgid "Link selected text to a new note (Ctrl-L)" -msgstr "Seçilen metni yeni bir nota bağla" - -#: ../src/notewindow.cpp:424 -msgid "_Text" -msgstr "_Metin" +#: ../src/recentchanges.cpp:673 +msgid "_Close" +msgstr "_Kapat" -#: ../src/notewindow.cpp:430 -msgid "Set properties of text" -msgstr "Metin özelliklerini ayarla" +#: ../src/remotecontrolproxy.cpp:57 +#, c-format +msgid "Failed to load D-Bus interface %s: %s" +msgstr "" -#: ../src/notewindow.cpp:434 -msgid "T_ools" -msgstr "_Araçlar" - -#: ../src/notewindow.cpp:439 -msgid "Use tools on this note" -msgstr "Bu notta araçları kullan" +#: ../src/searchnoteswidget.cpp:137 +#| msgid "_Open..." +msgid "_Open" +msgstr "_Aç" -#: ../src/notewindow.cpp:449 -msgid "Delete this note" -msgstr "Bu notu sil" +#: ../src/searchnoteswidget.cpp:140 +msgid "Open In New _Window" +msgstr "Ye_ni Pencerede Aç" -#: ../src/notewindow.cpp:459 -msgid "Synchronize Notes" -msgstr "Notları Eşzamanlandır" +#: ../src/searchnoteswidget.cpp:150 +#| msgid "User_name:" +msgid "Re_name..." +msgstr "Ye_niden Adlandır..." -#: ../src/notewindow.cpp:502 -msgid "_Find..." -msgstr "_Bul..." +#: ../src/searchnoteswidget.cpp:659 +msgid "Note" +msgstr "Not" -#: ../src/notewindow.cpp:510 -msgid "Find _Next" -msgstr "So_nrakini Bul" +#: ../src/searchnoteswidget.cpp:681 +msgid "Modified" +msgstr "Değiştirildi" -#: ../src/notewindow.cpp:520 -msgid "Find _Previous" -msgstr "Ön_cekini Bul" +#: ../src/searchnoteswidget.cpp:1000 +msgid "Notes" +msgstr "Notlar" -#: ../src/notewindow.cpp:590 -msgid "Cannot create note" -msgstr "Not oluşturulamıyor" +#: ../src/searchnoteswidget.cpp:1019 +msgid "" +"No results found in the selected notebook.\n" +"Click here to search across all notes." +msgstr "" +"Seçilen not defterinde sonuç bulunamadı.\n" +"Tüm notlarda aramak için buraya tıklayın." -#: ../src/notewindow.cpp:645 -msgid "_Next" -msgstr "_Sonraki" - -#: ../src/notewindow.cpp:646 -msgid "_Previous" -msgstr "Ö_nceki" - -#: ../src/notewindow.cpp:659 -msgid "_Find:" -msgstr "_Bul:" +#: ../src/searchnoteswidget.cpp:1023 +msgid "Click here to search across all notebooks" +msgstr "Tüm not defterlerinde aramak için buraya tıklayın" -#: ../src/notewindow.cpp:1101 -msgid "_Bold" -msgstr "_Kalın" +#: ../src/searchnoteswidget.cpp:1044 +msgid "Matches" +msgstr "Eşleşmeler" -#: ../src/notewindow.cpp:1102 -#| msgid "_Italic" -msgid "_Italic" -msgstr "_Eğik" +#. TRANSLATORS: search found a match in note title +#: ../src/searchnoteswidget.cpp:1096 +msgid "Title match" +msgstr "Başlık eşleşmesi" -#: ../src/notewindow.cpp:1103 -#| msgid "_Strikeout" -msgid "_Strikeout" -msgstr "_Üstü çizili" +#: ../src/searchnoteswidget.cpp:1100 +msgid "%1% match" +msgid_plural "%1% matches" +msgstr[0] "%1% eşleşme" -#: ../src/notewindow.cpp:1105 -msgid "_Highlight" -msgstr "_Aydınlat" +#: ../src/searchnoteswidget.cpp:1311 +msgid "_New" +msgstr "_Yeni" -#: ../src/notewindow.cpp:1107 -msgid "_Normal" -msgstr "_Normal" +#: ../src/searchnoteswidget.cpp:1340 +msgid "_Open Template Note" +msgstr "Şablom Notunu _Aç" -#: ../src/notewindow.cpp:1109 -msgid "Hu_ge" -msgstr "Çok _büyük" +#: ../src/searchnoteswidget.cpp:1351 +#| msgid "_New" +msgid "_New..." +msgstr "_Yeni..." -#: ../src/notewindow.cpp:1111 -msgid "_Large" -msgstr "Bü_yük" +#: ../src/searchnoteswidget.cpp:1487 ../src/searchnoteswidget.cpp:1500 +#: ../src/searchnoteswidget.cpp:1511 +#, c-format +msgid "Failed to parse setting %s (Value: %s):" +msgstr "" -#: ../src/notewindow.cpp:1113 -msgid "S_mall" -msgstr "_Küçük" +#: ../src/searchnoteswidget.cpp:1488 +msgid "Expected format 'column:order'" +msgstr "" -#: ../src/notewindow.cpp:1115 -msgid "Bullets" -msgstr "İşaretler" +#: ../src/searchnoteswidget.cpp:1501 +#, c-format +msgid "Unrecognized column %s" +msgstr "" -#: ../src/notewindow.cpp:1118 -msgid "Increase Font Size" -msgstr "Yazıtipi Boyutunu Büyüt" - -#: ../src/notewindow.cpp:1119 -msgid "Decrease Font Size" -msgstr "Yazıtipi Boyutunu Küçült" - -#: ../src/notewindow.cpp:1190 -msgid "Font Size" -msgstr "Yazıtipi Boyutu" +#: ../src/searchnoteswidget.cpp:1512 +#, c-format +msgid "Unrecognized order %s" +msgstr "" -#. TRANSLATORS: %1% is number of notes -#: ../src/note.cpp:73 -#| msgid "Really delete this note?" -msgid "Really delete %1% note?" -msgid_plural "Really delete %1% notes?" -msgstr[0] "%1% adet not gerçekten silinsin mi?" +#: ../src/sharp/addinstreemodel.cpp:109 +msgid "Name" +msgstr "İsim" -#: ../src/note.cpp:80 -msgid "If you delete a note it is permanently lost." -msgstr "Eğer bir notu silerseniz kalıcı olarak kaybolacaktır." +#: ../src/sharp/addinstreemodel.cpp:121 +msgid "Version" +msgstr "Sürüm" + +#. TRANSLATORS: Addin category. +#: ../src/sharp/addinstreemodel.cpp:155 +msgid "Formatting" +msgstr "Biçimlendirme" + +#. TRANSLATORS: Addin category. +#: ../src/sharp/addinstreemodel.cpp:158 +msgid "Desktop integration" +msgstr "Masaüstü bütünleştirmesi" + +#. TRANSLATORS: Addin category. +#: ../src/sharp/addinstreemodel.cpp:161 +msgid "Tools" +msgstr "Araçlar" + +#. TRANSLATORS: Addin category is unknown. +#: ../src/sharp/addinstreemodel.cpp:168 +msgid "Unknown" +msgstr "Bilinmiyor" + +#: ../src/sharp/modulemanager.cpp:62 +#, c-format +#| msgid "Error saving icon" +msgid "Error loading %s" +msgstr "%s yüklenirken hata oluştu" + +#: ../src/sharp/modulemanager.cpp:69 +#, c-format +msgid "Error getting symbol dynamic_module_instanciate: %s" +msgstr "" + +#: ../src/sharp/xmlreader.cpp:195 +#, c-format +msgid "XML error: %s" +msgstr "XML hatası: %s" + +#: ../src/sharp/xmlreader.cpp:195 +msgid "unknown parse error" +msgstr "bilinmeyen ayrıştırma hatası" + +#: ../src/sharp/xmlwriter.cpp:40 +msgid "%1% failed" +msgstr "" + +#: ../src/sharp/xsltransform.cpp:67 +msgid "NULL stylesheet, please fill a bug" +msgstr "" + +#: ../src/synchronization/filesystemsyncserver.cpp:369 +#, c-format +msgid "" +"Exception during server cleanup while committing. Server integrity is OK, " +"but there may be some excess files floating around. Here's the error: %s\n" +msgstr "" -#: ../src/note.cpp:116 -msgid "Error saving note data." -msgstr "Not bilgisi kaydedilirken hata." +#: ../src/synchronization/filesystemsyncserver.cpp:609 +#, fuzzy, c-format +#| msgid "Error connecting to the synchronization service. Please try again." +msgid "Error deleting the old synchronization lock \"%s\": %s" +msgstr "Eşzamanlandırma servisine bağlanırken hata. Lütfen tekrar deneyin." -#: ../src/note.cpp:117 +#: ../src/synchronization/fusesyncserviceaddin.cpp:115 #, fuzzy #| msgid "" -#| "An error occurred while saving your notes. Please check that you have " -#| "sufficient disk space, and that you have appropriate rights on {0}. Error " -#| "details can be found in {1}." +#| "This synchronization addin is not supported on your computer. Please make " +#| "sure you have FUSE and {0} correctly installed and configured" msgid "" -"An error occurred while saving your notes. Please check that you have " -"sufficient disk space, and that you have appropriate rights on ~/.gnote. " -"Error details can be found in ~/.gnote.log." +"This synchronization addin is not supported on your computer. Please make " +"sure you have FUSE and %1% correctly installed and configured" msgstr "" -"Notlarınız kaydedilirken bir hata oluştu. Lütfen yeterli disk alanınız " -"olduğundan ve {0} üzerinde yeterli haklara sahip olduğunuzdan emin olun. " -"Hata ayrıntılarını {1} konumunda bulabilirsiniz." - -#: ../src/recentchanges.cpp:93 -msgid "Search All Notes" -msgstr "Tüm Notları Ara" +"Eşzamanlandırma eklentisi bilgisayarınızda desteklenmiyor. Lütfen FUSE'ün " +"bulunduğundan ve {0} kurulumunun doğru yapılıp yapılandırıldığından emin olun" -#: ../src/recentchanges.cpp:114 -msgid "_Search:" -msgstr "_Ara:" +#: ../src/synchronization/fusesyncserviceaddin.cpp:158 +msgid "Could not read testfile." +msgstr "Test dosyası okunamadı." -#: ../src/recentchanges.cpp:288 -#: ../src/notebooks/notebookapplicationaddin.cpp:128 -msgid "Notebooks" -msgstr "Not Defterleri" +#: ../src/synchronization/fusesyncserviceaddin.cpp:167 +msgid "Write test failed." +msgstr "Yazma testi başarısız oldu." -#: ../src/recentchanges.cpp:365 -msgid "Note" -msgstr "Not" +#: ../src/synchronization/fusesyncserviceaddin.cpp:196 +msgid "Timeout connecting to server." +msgstr "Sunucuya bağlanırken zaman aşımı." -#: ../src/recentchanges.cpp:387 -msgid "Last Changed" -msgstr "Son Değiştirilme" +#: ../src/synchronization/fusesyncserviceaddin.cpp:202 +msgid "Error connecting to server." +msgstr "Sunucuya bağlanırken hata." -#: ../src/recentchanges.cpp:572 -msgid "Matches" -msgstr "Eşleşmeler" +#: ../src/synchronization/fusesyncserviceaddin.cpp:215 +msgid "FUSE could not be enabled." +msgstr "FUSE etkinleştirilemedi." -#. TRANSLATORS: search found a match in note title -#: ../src/recentchanges.cpp:626 -msgid "Title match" -msgstr "Başlık eşleşmesi" +#: ../src/synchronization/fusesyncserviceaddin.cpp:246 +#, fuzzy +#| msgid "An error ocurred while connecting to the specified server:" +msgid "An error ocurred while connecting to the specified server" +msgstr "Belirtilen sunucuya bağlanılırken bir hata oluştu:" -#: ../src/recentchanges.cpp:630 -#| msgid "{0} match" -#| msgid_plural "{0} matches" -msgid "%1% match" -msgid_plural "%1% matches" -msgstr[0] "%1% eşleşme" +#. TRANSLATORS: %s is file +#: ../src/synchronization/gnotesyncclient.cpp:165 +#, c-format +msgid "Unparsable last-sync-date element in %s" +msgstr "" -#: ../src/recentchanges.cpp:644 -#| msgid "Total: {0} note" -#| msgid_plural "Total: {0} notes" -msgid "Total: %1% note" -msgid_plural "Total: %1% notes" -msgstr[0] "Toplam: %1% not" +#. TRANSLATORS: %s is file +#: ../src/synchronization/gnotesyncclient.cpp:175 +#, c-format +msgid "Unparsable last-sync-rev element in %s" +msgstr "" -#: ../src/recentchanges.cpp:660 -#| msgid "Matches: {0} note" -#| msgid_plural "Matches: {0} notes" -msgid "Matches: %1% note" -msgid_plural "Matches: %1% notes" -msgstr[0] "Eşleşmeler: %1% not" +#: ../src/synchronization/syncdialog.cpp:64 +msgid "Note Conflict" +msgstr "Not Çakışması" -#: ../src/recentchanges.cpp:676 -msgid "" -"No results found in the selected notebook.\n" -"Click here to search across all notes." -msgstr "" -"Seçilen not defterinde sonuç bulunamadı.\n" -"Tüm notlarda aramak için buraya tıklayın." +#. Suggest renaming note by appending " (old)" to the existing title +#: ../src/synchronization/syncdialog.cpp:69 +msgid " (old)" +msgstr " (eski)" -#: ../src/recentchanges.cpp:680 -msgid "Click here to search across all notebooks" -msgstr "Tüm not defterlerinde aramak için buraya tıklayın" +#: ../src/synchronization/syncdialog.cpp:114 +msgid "Rename local note:" +msgstr "Yerel notu yeniden adlandır:" -#: ../src/recentchanges.cpp:855 -msgid "Notes" -msgstr "Notlar" +#: ../src/synchronization/syncdialog.cpp:121 +msgid "Update links in referencing notes" +msgstr "Referans notlardaki bağları güncelle" -#: ../src/tray.cpp:54 -msgid "Take notes" -msgstr "Not alın" +#: ../src/synchronization/syncdialog.cpp:127 +msgid "Overwrite local note" +msgstr "Yerel notun üzerine yaz" -#: ../src/tray.cpp:164 -msgid " (new)" -msgstr " (yeni)" +#: ../src/synchronization/syncdialog.cpp:131 +msgid "Always perform this action" +msgstr "Her zaman bu eylemi uygula" -#: ../src/tray.cpp:470 -#| msgid "_About" -msgid "_About Gnote" -msgstr "_Gnote Hakkında" +#. Set initial dialog text +#: ../src/synchronization/syncdialog.cpp:137 +msgid "Note conflict detected" +msgstr "Not çakışması tespit edildi" -#: ../src/utils.cpp:130 +#: ../src/synchronization/syncdialog.cpp:139 +#, fuzzy #| msgid "" -#| "The \"Tomboy Notes Manual\" could not be found. Please verify that your " -#| "installation has been completed successfully." +#| "The server version of \"{0}\" conflicts with your local note. What do " +#| "you want to do with your local note?" msgid "" -"The \"Gnote Manual\" could not be found. Please verify that your " -"installation has been completed successfully." +"The server version of \"%1%\" conflicts with your local note. What do you " +"want to do with your local note?" msgstr "" -"\"Gnote Kılavuzu\" bulunamadı. Lütfen kurulumunuzun başarıyla " -"tamamlandığından emin olun." +"Sunucu sürümü \"{0}\" yerel notunuzla çakışıyor. Yerel notla ne yapmak " +"istiyor sunuz?" -#: ../src/utils.cpp:138 -msgid "Help not found" -msgstr "Yardım bulunamadı" +#. Expander containing TreeView +#: ../src/synchronization/syncdialog.cpp:296 +msgid "Details" +msgstr "Ayrıntılar" -#: ../src/utils.cpp:171 -msgid "Cannot open location" -msgstr "Konum açılamıyor" +#: ../src/synchronization/syncdialog.cpp:338 +msgid "Status" +msgstr "Durum" -#. TRANSLATORS: argument is time. -#: ../src/utils.cpp:186 -#| msgid "Today: " -msgid "Today, %1%" -msgstr "Bugün, %1%" +#: ../src/synchronization/syncdialog.cpp:483 +msgid "Acquiring sync lock..." +msgstr "Eşzamanlama kilidi alınıyor..." -#: ../src/utils.cpp:187 -msgid "Today" -msgstr "Bugün" +#: ../src/synchronization/syncdialog.cpp:486 +msgid "Committing changes..." +msgstr "Değişiklikler gönderiliyor..." -#. TRANSLATORS: argument is time. -#: ../src/utils.cpp:193 -#| msgid "Yesterday, {0}" -msgid "Yesterday, %1%" -msgstr "Dün, %1%" +#: ../src/synchronization/syncdialog.cpp:489 +msgid "Synchronizing Notes" +msgstr "Notlar Eşzamanlandırılıyor" -#: ../src/utils.cpp:194 -msgid "Yesterday" -msgstr "Dün" +#: ../src/synchronization/syncdialog.cpp:490 +msgid "Synchronizing your notes..." +msgstr "Notlarınız eşzamanlandırılıyor..." -#. TRANSLATORS: 2 or more days ago, up to one week. -#. First argument is number of days, second is time. -#: ../src/utils.cpp:203 -#| msgid "{0} day ago, {1}" -#| msgid_plural "{0} days ago, {1}" -msgid "%1% day ago, %2%" -msgid_plural "%1% days ago, %2%" -msgstr[0] "%1% gün önce, %2%" - -#. TRANSLATORS: 2 or more days ago, up to one week. -#. Argument is number of days. -#: ../src/utils.cpp:209 -#| msgid "{0} day ago" -#| msgid_plural "{0} days ago" -msgid "%1% day ago" -msgid_plural "%1% days ago" -msgstr[0] "%1% gün önce" +#: ../src/synchronization/syncdialog.cpp:491 +msgid "This may take a while, kick back and enjoy!" +msgstr "Bu biraz zaman alabilir, arkaya yaslanın ve keyfini çıkartın!" -#. TRANSLATORS: argument is time. -#: ../src/utils.cpp:217 -#| msgid "Tomorrow, {0}" -msgid "Tomorrow, %1%" -msgstr "Yarın, %1%" +#: ../src/synchronization/syncdialog.cpp:493 +msgid "Connecting to the server..." +msgstr "Sunucuya bağlanılıyor..." -#: ../src/utils.cpp:218 -msgid "Tomorrow" -msgstr "Yarın" +#: ../src/synchronization/syncdialog.cpp:499 +msgid "Deleting notes off of the server..." +msgstr "Notlar sunucudan siliniyor..." -#. TRANSLATORS: In 2 or more days, up to one week. -#. First argument is number of days, second is time. -#: ../src/utils.cpp:227 -#| msgid "In {0} day, {1}" -#| msgid_plural "In {0} days, {1}" -msgid "In %1% day, %2%" -msgid_plural "In %1% days, %2%" -msgstr[0] "%1% gün içinde, %2%" - -#. TRANSLATORS: In 2 or more days, up to one week. -#. Argument is number of days. -#: ../src/utils.cpp:233 -#| msgid "In {0} day" -#| msgid_plural "In {0} days" -msgid "In %1% day" -msgid_plural "In %1% days" -msgstr[0] "%1% gün içinde" +#: ../src/synchronization/syncdialog.cpp:503 +msgid "Downloading new/updated notes..." +msgstr "Yeni/güncellenmiş notlar indiriliyor..." -#: ../src/utils.cpp:244 -msgid "No Date" -msgstr "Tarih Yok" +#: ../src/synchronization/syncdialog.cpp:515 +msgid "Server Locked" +msgstr "Sunucu Kilitli" -#: ../src/watchers.cpp:210 -#| msgid "(Untitled {0})" -msgid "(Untitled %1%)" -msgstr "(Başlıksız %1%)" +#: ../src/synchronization/syncdialog.cpp:516 +msgid "Server is locked" +msgstr "Sunucu kilitli" -#: ../src/watchers.cpp:245 -#| msgid "" -#| "A note with the title {0} already exists. Please choose another " -#| "name for this note before continuing." +#: ../src/synchronization/syncdialog.cpp:517 msgid "" -"A note with the title %1% already exists. Please choose another name " -"for this note before continuing." +"One of your other computers is currently synchronizing. Please wait 2 " +"minutes and try again." msgstr "" -"%1% başlıklı bir not zaten var. Devam etmeden önce bu not için başka " -"bir ad seçin." +"Diğer bilgisayarlarınızdan birisi şu anda eşzamanlandırılıyor. Lütfen 2 " +"dakika bekleyin ve tekrar deneyin." -#: ../src/watchers.cpp:259 -msgid "Note title taken" -msgstr "Not başlığı alındı" +#: ../src/synchronization/syncdialog.cpp:521 +msgid "Preparing to download updates from server..." +msgstr "Sunucudan güncellemeleri indirmek için hazırlanılıyor..." -#: ../src/watchers.cpp:593 -msgid "_Copy Link Address" -msgstr "Bağlantı Adresini _Kopyala" +#: ../src/synchronization/syncdialog.cpp:524 +msgid "Preparing to upload updates to server..." +msgstr "Sunucuya güncellemeleri yüklemek için hazırlanılıyor..." -#: ../src/watchers.cpp:599 -msgid "_Open Link" -msgstr "_Bağlantıyı Aç" +#: ../src/synchronization/syncdialog.cpp:527 +msgid "Uploading notes to server..." +msgstr "Notlar sunucuya yükleniyor..." -#: ../src/notebooks/createnotebookdialog.cpp:38 -#: ../src/notebooks/notebookapplicationaddin.cpp:109 -msgid "Create a new notebook" -msgstr "Yeni bir not defteri oluştur" +#: ../src/synchronization/syncdialog.cpp:530 +msgid "Synchronization Failed" +msgstr "Eşzamanlandırma Başarısız Oldu" -#: ../src/notebooks/createnotebookdialog.cpp:39 -msgid "Type the name of the notebook you'd like to create." -msgstr "Oluşturmak istediğiniz not defterinin ismini yazın." +#: ../src/synchronization/syncdialog.cpp:531 +msgid "Failed to synchronize" +msgstr "Eşzamanlandırma başarısız oldu" -#: ../src/notebooks/createnotebookdialog.cpp:47 -msgid "N_otebook name:" -msgstr "_Not defteri ismi:" +#: ../src/synchronization/syncdialog.cpp:532 +msgid "Could not synchronize notes. Check the details below and try again." +msgstr "" +"Notlar eşzamanlandırılamadı. Aşağıdaki ayrıntıları kontrol edin ve tekrar " +"deneyin." -#: ../src/notebooks/createnotebookdialog.cpp:60 -msgid "Name already taken" -msgstr "İsim zaten alınmış" +#: ../src/synchronization/syncdialog.cpp:538 +msgid "Synchronization Complete" +msgstr "Eşzamanlandırma Tamamlandı" -#. Translation note: This is the Create button in the Create -#. New Note Dialog. -#: ../src/notebooks/createnotebookdialog.cpp:73 -msgid "C_reate" -msgstr "_Oluştur" +#: ../src/synchronization/syncdialog.cpp:539 +msgid "Synchronization is complete" +msgstr "Eşzamanlandırma tatmlandı" -#. The templateNoteTite should show the name of the -#. notebook. For example, if the name of the notebooks -#. "Meetings", the templateNoteTitle should be "Meetings -#. Notebook Template". Translators should place the -#. name of the notebook accordingly using "%1%". -#: ../src/notebooks/notebook.cpp:87 -#| msgid "{0} Notebook Template" -msgid "%1% Notebook Template" -msgstr "%1% Not Defteri Şablonu" +#: ../src/synchronization/syncdialog.cpp:540 +#, fuzzy +#| msgid "{0} note updated." +#| msgid_plural "{0} notes updated." +msgid "%1% note updated." +msgid_plural "%1% notes updated." +msgstr[0] "{0} not güncellendi." -#: ../src/notebooks/notebook.cpp:207 -msgid "All Notes" -msgstr "Tüm Notlar" +#: ../src/synchronization/syncdialog.cpp:541 +msgid "Your notes are now up to date." +msgstr "Notlarınızı artık güncel." -#: ../src/notebooks/notebook.cpp:219 -msgid "Unfiled Notes" -msgstr "Dosyalanmamış Notlar" +#: ../src/synchronization/syncdialog.cpp:546 +msgid "Synchronization Canceled" +msgstr "Eşzamanlandırma İptal Edildi" -#: ../src/notebooks/notebookapplicationaddin.cpp:103 -msgid "Note_books" -msgstr "_Not Defterleri" +#: ../src/synchronization/syncdialog.cpp:547 +msgid "Synchronization was canceled" +msgstr "Eşzamanlandırma iptal edildi" -#: ../src/notebooks/notebookapplicationaddin.cpp:104 -#: ../src/notebooks/notebookapplicationaddin.cpp:129 -msgid "Create a new note in a notebook" -msgstr "Bir not defteri içerisinde yeni bir not oluştur" +#: ../src/synchronization/syncdialog.cpp:548 +msgid "You canceled the synchronization. You may close the window now." +msgstr "Eşzamanlandırmayı iptal ettiniz. Şimdi pencereyi kapatabilirsiniz." -#: ../src/notebooks/notebookapplicationaddin.cpp:108 -#: ../src/notebooks/notebookapplicationaddin.cpp:263 -msgid "New Note_book..." -msgstr "Yeni _Not Defteri..." +#: ../src/synchronization/syncdialog.cpp:552 +msgid "Synchronization Not Configured" +msgstr "Eşzamanlandırma Yapılandırılmamış" -#: ../src/notebooks/notebookapplicationaddin.cpp:113 -msgid "_New Note" -msgstr "_Yeni Not" +#: ../src/synchronization/syncdialog.cpp:553 +msgid "Synchronization is not configured" +msgstr "Eşzamanlandırma yapılandırılmamış" -#: ../src/notebooks/notebookapplicationaddin.cpp:114 -msgid "Create a new note in this notebook" -msgstr "Bu not defterinde yeni bir not oluştur" +#: ../src/synchronization/syncdialog.cpp:554 +msgid "Please configure synchronization in the preferences dialog." +msgstr "Lütfen eşzamanlandırmanızı tercihler penceresinden yapılandırın." -#: ../src/notebooks/notebookapplicationaddin.cpp:118 -msgid "_Open Template Note" -msgstr "Şablom Notunu _Aç" +#: ../src/synchronization/syncdialog.cpp:558 +msgid "Synchronization Service Error" +msgstr "Eşzamanlandırma Servis Hatası" -#: ../src/notebooks/notebookapplicationaddin.cpp:119 -msgid "Open this notebook's template note" -msgstr "Bu not defterinin şablom notunu aç" - -#: ../src/notebooks/notebookapplicationaddin.cpp:123 -msgid "Delete Note_book" -msgstr "Not Defterini _Sil" - -#: ../src/notebooks/notebookapplicationaddin.cpp:124 -msgid "Delete the selected notebook" -msgstr "Seçilen not defterini sil" +#: ../src/synchronization/syncdialog.cpp:559 +msgid "Service error" +msgstr "Servis hatası" -#: ../src/notebooks/notebookmanager.cpp:337 -msgid "Really delete this notebook?" -msgstr "Bu not defterini silmek istediğinizden emin misiniz?" +#: ../src/synchronization/syncdialog.cpp:560 +msgid "Error connecting to the synchronization service. Please try again." +msgstr "Eşzamanlandırma servisine bağlanırken hata. Lütfen tekrar deneyin." -#: ../src/notebooks/notebookmanager.cpp:338 -msgid "" -"The notes that belong to this notebook will not be deleted, but they will no " -"longer be associated with this notebook. This action cannot be undone." -msgstr "" -"Bu not defterine ait olan notlar silinmeyecek, ancak artık bu not defteri " -"ile ilişkilendirilmeyecekler. Bu eylem geri alınamaz." +#: ../src/synchronization/syncdialog.cpp:574 +msgid "Deleted locally" +msgstr "Yerelde silindi" -#: ../src/notebooks/notebooknewnotemenuitem.cpp:39 -#| msgid "New \"{0}\" Note" -msgid "New \"%1%\" Note" -msgstr "Yeni \"%1%\" Not" +#: ../src/synchronization/syncdialog.cpp:577 +msgid "Deleted from server" +msgstr "Sunucudan silindi" -#: ../src/notebooks/notebookmenuitem.cpp:35 -msgid "No notebook" -msgstr "Not defteri yok" +#: ../src/synchronization/syncdialog.cpp:580 +msgid "Updated" +msgstr "Güncellendi" -#: ../src/notebooks/notebooknoteaddin.cpp:76 -msgid "Place this note into a notebook" -msgstr "Bu notu not defteri içerisine yerleştir" +#: ../src/synchronization/syncdialog.cpp:583 +msgid "Added" +msgstr "Eklendi" -#: ../src/notebooks/notebooknoteaddin.cpp:158 -msgid "Notebook" -msgstr "Not defteri" +#: ../src/synchronization/syncdialog.cpp:586 +msgid "Uploaded changes to server" +msgstr "Değişiklikler sunucuya yüklendi" -#: ../src/notebooks/notebooknoteaddin.cpp:184 -msgid "_New notebook..." -msgstr "Yeni _not defteri..." +#: ../src/synchronization/syncdialog.cpp:589 +msgid "Uploaded new note to server" +msgstr "Sunucuya yeni not yüklendi" -#: ../src/addins/backlinks/backlinksnoteaddin.cpp:43 -msgid "Backlinks" -msgstr "" +#: ../src/synchronization/syncmanager.cpp:66 +msgid "Synchronize Notes" +msgstr "Notları Eşzamanlandır" -#: ../src/addins/backlinks/backlinksnoteaddin.cpp:47 -msgid "See which notes link to the one you're currently viewing." +#: ../src/synchronization/syncmanager.cpp:85 +#: ../src/synchronization/syncmanager.cpp:102 +#: ../src/synchronization/syncmanager.cpp:575 +#, c-format +msgid "Report a bug. Cast failed: %s" msgstr "" -#: ../src/addins/backlinks/backlinksnoteaddin.cpp:51 -#: ../src/addins/inserttimestamp/inserttimestampnoteaddin.cpp:53 -msgid "Hubert Figuiere and Tomboy Project" -msgstr "Hubert Figuiere ve Tomboy Projesi" +#: ../src/synchronization/syncmanager.cpp:148 +#, c-format +msgid "Error cleaning up addin after synchronization: %s" +msgstr "" -#: ../src/addins/backlinks/backlinksnoteaddin.cpp:89 -msgid "What links here?" -msgstr "Buraya ne bağlı?" +#: ../src/synchronization/syncmanager.cpp:173 +#, c-format +msgid "Exception while creating SyncServer: %s" +msgstr "" -#: ../src/addins/backlinks/backlinksnoteaddin.cpp:145 -msgid "(none)" -msgstr "(hiçbiri)" +#. top-level try +#: ../src/synchronization/syncmanager.cpp:377 +#, fuzzy, c-format +#| msgid "" +#| "Saving configuration to the GNOME keyring failed with the following " +#| "message:" +msgid "Synchronization failed with the following exception: %s" +msgstr "" +"Yapılandırmanın GNOME anahtarlığına kaydedilmesi aşağıdaki ileti ile " +"başarısız oldu:" -#: ../src/addins/bugzilla/bugzillanoteaddin.cpp:60 -msgid "Bugzilla Links" -msgstr "Bugzilla Bağlantıları" +#: ../src/synchronization/syncutils.cpp:148 +#: ../src/synchronization/syncutils.cpp:180 +msgid "Could not enable FUSE" +msgstr "FUSE etkinleştirilemedi" -#: ../src/addins/bugzilla/bugzillanoteaddin.cpp:64 +#: ../src/synchronization/syncutils.cpp:149 +#: ../src/synchronization/syncutils.cpp:181 msgid "" -"Allows you to drag a Bugzilla URL from your browser directly into a Gnote " -"note. The bug number is inserted as a link with a little bug icon next to " -"it." +"The FUSE module could not be loaded. Please check that it is installed " +"properly and try again." msgstr "" +"FUSE modülü yüklenemedi. Lütfen doğru bir şekilde kurulduğundan emin olun ve " +"tekrar deneyin." -#: ../src/addins/bugzilla/bugzillanoteaddin.cpp:68 -#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:72 -#: ../src/addins/printnotes/printnotesnoteaddin.cpp:56 -#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:67 -msgid "Hubert Figuiere and the Tomboy Project" -msgstr "Hubert Figuiere ve Tomboy Projesi" +#: ../src/synchronization/syncutils.cpp:157 +msgid "Enable FUSE?" +msgstr "FUSE etkinleştirilsin mi?" -#: ../src/addins/bugzilla/bugzillapreferences.cpp:62 +#. TODO: This message isn't entirely accurate. +#. We should fix it. +#: ../src/synchronization/syncutils.cpp:160 msgid "" -"You can use any bugzilla just by dragging links into notes. If you want a " -"special icon for certain hosts, add them here." +"The synchronization you've chosen requires the FUSE module to be loaded.\n" +"\n" +"To avoid getting this prompt in the future, you should load FUSE at " +"startup. Add \"modprobe fuse\" to /etc/init.d/boot.local or \"fuse\" to /" +"etc/modules." msgstr "" -"Sadece bağları notlara taşıyarak herhangibir bugzilla kullanabilirsiniz. " -"Eğer belirli makinalar için özel simgeler istiyorsanız, onları buraya " -"ekleyin." +"Seçmiş olduğunuz eşzamanlandırma FUSE modülünün yüklenmesini gerektiriyor.\n" +"\n" +"Gelecekte bu soruyla karşılaşmamak için, başlangıçta FUSE'ü yüklemelisiniz. /" +"etc/init.d/boot.local içerisine \"modprbe fuse\" ekleyin ya da /etc/modules " +"içerisine \"fuse\" ekleyin." -#: ../src/addins/bugzilla/bugzillapreferences.cpp:79 -msgid "Host Name" -msgstr "Makina İsmi" +#: ../src/tray.cpp:54 +msgid "Take notes" +msgstr "Not alın" -#: ../src/addins/bugzilla/bugzillapreferences.cpp:92 -msgid "Icon" -msgstr "Simge" +#: ../src/tray.cpp:167 +msgid " (new)" +msgstr " (yeni)" -#: ../src/addins/bugzilla/bugzillapreferences.cpp:226 -msgid "Select an icon..." -msgstr "Bir simge seçin..." +#: ../src/tray.cpp:458 +msgid "_About Gnote" +msgstr "_Gnote Hakkında" -#. Extra Widget -#: ../src/addins/bugzilla/bugzillapreferences.cpp:241 -msgid "_Host name:" -msgstr "_Makina ismi:" +#: ../src/utils.cpp:144 +msgid "" +"The \"Gnote Manual\" could not be found. Please verify that your " +"installation has been completed successfully." +msgstr "" +"\"Gnote Kılavuzu\" bulunamadı. Lütfen kurulumunuzun başarıyla " +"tamamlandığından emin olun." -#: ../src/addins/bugzilla/bugzillapreferences.cpp:273 -#| msgid "_Host name:" -msgid "Host name invalid" -msgstr "Makine adı geçersiz" +#: ../src/utils.cpp:152 +msgid "Help not found" +msgstr "Yardım bulunamadı" -#: ../src/addins/bugzilla/bugzillapreferences.cpp:274 -#| msgid "You must specify the Bugzilla host name to use with this icon." -msgid "You must specify a valid Bugzilla host name to use with this icon." -msgstr "" -"Bu simge ile kullanmak için, geçerli bir Bugzilla makine adı belirtmelisiniz." +#: ../src/utils.cpp:185 +msgid "Cannot open location" +msgstr "Konum açılamıyor" -#: ../src/addins/bugzilla/bugzillapreferences.cpp:293 -msgid "Error saving icon" -msgstr "Simge kaydedilirken hata" +#. TRANSLATORS: argument is time. +#: ../src/utils.cpp:215 +msgid "Today, %1%" +msgstr "Bugün, %1%" -#: ../src/addins/bugzilla/bugzillapreferences.cpp:294 -msgid "Could not save the icon file." -msgstr "Simge dosyası kaydedilemedi." +#: ../src/utils.cpp:216 +msgid "Today" +msgstr "Bugün" -#: ../src/addins/bugzilla/bugzillapreferences.cpp:366 -msgid "Really remove this icon?" -msgstr "Bu simgeyi silmek istediğinizden emin misiniz?" +#. TRANSLATORS: argument is time. +#: ../src/utils.cpp:222 +msgid "Yesterday, %1%" +msgstr "Dün, %1%" -#: ../src/addins/bugzilla/bugzillapreferences.cpp:367 -msgid "If you remove an icon it is permanently lost." -msgstr "Eğer bir simgeyi silerseniz kalıcı olarak kaybolacaktır." +#: ../src/utils.cpp:223 +msgid "Yesterday" +msgstr "Dün" -#: ../src/addins/exporttohtml/exporttohtmldialog.cpp:39 -msgid "Destination for HTML Export" -msgstr "HTML Dışa Aktarımı İçin Konum" +#. TRANSLATORS: argument is time. +#: ../src/utils.cpp:229 +msgid "Tomorrow, %1%" +msgstr "Yarın, %1%" -#: ../src/addins/exporttohtml/exporttohtmldialog.cpp:41 -msgid "Export linked notes" -msgstr "Bağlı notları dışa aktar" +#: ../src/utils.cpp:230 +msgid "Tomorrow" +msgstr "Yarın" -#: ../src/addins/exporttohtml/exporttohtmldialog.cpp:42 -msgid "Include all other linked notes" -msgstr "Bağlı notları içer" +#. TRANSLATORS: date in current year. +#: ../src/utils.cpp:234 +msgid "%b %d" +msgstr "" -#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:64 -#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:99 -msgid "Export to HTML" -msgstr "HTML olarak Dışa Aktar" +#. TRANSLATORS: first argument is date, second is time. +#: ../src/utils.cpp:237 ../src/utils.cpp:249 +#| msgid "In %1% day, %2%" +#| msgid_plural "In %1% days, %2%" +msgid "%1%, %2%" +msgstr "%1%, %2%" -#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:68 -#, fuzzy -#| msgid "Export linked notes" -msgid "Exports individual notes to HTML." -msgstr "Bağlı notları dışa aktar" +#: ../src/utils.cpp:242 +msgid "No Date" +msgstr "Tarih Yok" -#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:145 -#, fuzzy -#| msgid "Your note was exported to \"{0}\"." -msgid "Your note was exported to \"%1%\"." -msgstr "Notunuz \"{0}\" konumuna aktarıldı." +#. TRANSLATORS: date in other than current year. +#: ../src/utils.cpp:246 +msgid "%b %d %Y" +msgstr "" -#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:154 -msgid "Note exported successfully" -msgstr "Not başarıyla dışa aktarıldı" +#: ../src/watchers.cpp:200 +msgid "(Untitled %1%)" +msgstr "(Başlıksız %1%)" + +#: ../src/watchers.cpp:231 +msgid "" +"A note with the title %1% already exists. Please choose another name " +"for this note before continuing." +msgstr "" +"%1% başlıklı bir not zaten var. Devam etmeden önce bu not için başka " +"bir ad seçin." + +#: ../src/watchers.cpp:246 +msgid "Note title taken" +msgstr "Not başlığı alındı" -#: ../src/addins/exporttohtml/exporttohtmlnoteaddin.cpp:179 -#, c-format -#| msgid "Could not save the file \"{0}\"" -msgid "Could not save the file \"%s\"" -msgstr "\"%s\" dosyası kaydedilemedi" +#: ../src/watchers.cpp:309 +msgid "Check spelling" +msgstr "Yazım denetimi" + +#: ../src/watchers.cpp:310 +#| msgid "Use tools on this note" +msgid "Check spelling in this note" +msgstr "Bu notta yazım denetimi yap" -#: ../src/addins/fixedwidth/fixedwidthmenuitem.cpp:35 -msgid "Fixed Wid_th" -msgstr "_Sabit Genişlik" +#: ../src/watchers.cpp:674 +msgid "_Copy Link Address" +msgstr "Bağlantı Adresini _Kopyala" -#. this is the name of the plugin. -#: ../src/addins/fixedwidth/fixedwidthnoteaddin.cpp:49 -#| msgid "Fixed Wid_th" -msgid "Fixed Width" -msgstr "Sabit Genişlik" +#: ../src/watchers.cpp:680 +msgid "_Open Link" +msgstr "_Bağlantıyı Aç" -#: ../src/addins/fixedwidth/fixedwidthnoteaddin.cpp:53 -msgid "Adds fixed-width font style." -msgstr "" +#~| msgid "" +#~| "Determines X coordinate of \"Search All Notes\" window; stored on Tomboy " +#~| "exit." +#~ msgid "Determines X coordinate of Search window; stored on Gnote exit." +#~ msgstr "" +#~ "Arama penceresinin X koordinatını belirtir; Gnote kapandığında saklanır." -#. Add the menu item when the window is created -#: ../src/addins/inserttimestamp/inserttimestampnoteaddin.cpp:45 -#: ../src/addins/inserttimestamp/inserttimestampnoteaddin.cpp:78 -msgid "Insert Timestamp" -msgstr "Zaman Etiketi Ekle" +#~| msgid "" +#~| "Determines Y coordinate of \"Search All Notes\" window; stored on Tomboy " +#~| "exit." +#~ msgid "Determines Y coordinate of Search window; stored on Gnote exit." +#~ msgstr "" +#~ "Arama penceresinin Y koordinatını belirtir; Gnote kapandığında saklanır." -#: ../src/addins/inserttimestamp/inserttimestampnoteaddin.cpp:49 -msgid "Inserts current date and time at the cursor position." -msgstr "" +#~ msgid "Enable startup notes" +#~ msgstr "Başlangıç notlarını etkinleştir" -#. Label -#: ../src/addins/inserttimestamp/inserttimestamppreferences.cpp:67 -msgid "Choose one of the predefined formats or use your own." -msgstr "" -"Önceden tanımlanmış biçimlerin bir tanesini seçin ya da sizinkini kullanın." +#~| msgid "" +#~| "If enabled, all notes that were open when Tomboy quit will automatically " +#~| "be reopened at startup." +#~ msgid "" +#~ "If enabled, all notes that were open when Gnote quit will automatically " +#~ "be reopened at startup." +#~ msgstr "" +#~ "Eğer etkinse, Gnote'dan çıkışta açık olan tüm notlar başlangıçta " +#~ "kendiliğinden tekrar açılacak." -#: ../src/addins/inserttimestamp/inserttimestamppreferences.cpp:75 -msgid "Use _Selected Format" -msgstr "_Seçili Biçimi Kullan" +#~| msgid "Saved horizontal position of \"Search All Notes\" window" +#~ msgid "Saved horizontal position of Search window" +#~ msgstr "Arama penceresinin kaydedilmiş yatay konumu" -#: ../src/addins/inserttimestamp/inserttimestamppreferences.cpp:104 -msgid "_Use Custom Format" -msgstr "Özel _Biçim Kullan" +#~| msgid "Saved vertical position of \"Search All Notes\" window" +#~ msgid "Saved vertical position of Search window" +#~ msgstr "Arama penceresinin kaydedilmiş dikey konumu" -#: ../src/addins/noteoftheday/noteoftheday.cpp:32 -msgid "Today: Template" -msgstr "Bugün: Şablom" +#~ msgid "_File" +#~ msgstr "_Dosya" -#: ../src/addins/noteoftheday/noteoftheday.cpp:34 -msgid "Today: " -msgstr "Bugün: " +#~ msgid "Open the selected note" +#~ msgstr "Seçilen notu aç" -#: ../src/addins/noteoftheday/noteoftheday.cpp:158 -msgid "Tasks" -msgstr "Görevler" +#~ msgid "Delete the selected note" +#~ msgstr "Seçilen notu sil" -#: ../src/addins/noteoftheday/noteoftheday.cpp:159 -msgid "Appointments" -msgstr "Randevular" +#~ msgid "Close this window" +#~ msgstr "Bu pencereyi kapat" -#. Format: "Today: Friday, July 01 2005" -#: ../src/addins/noteoftheday/noteoftheday.cpp:165 -msgid "%A, %B %d %Y" -msgstr "" +#~ msgid "_Edit" +#~ msgstr "_Düzenle" -#: ../src/addins/noteoftheday/noteofthedayapplicationaddin.cpp:45 -msgid "Note of the Day" -msgstr "Günün Notu" +#~ msgid "S_ynchronize Notes" +#~ msgstr "Notları _Eşzamanlandır" -#: ../src/addins/noteoftheday/noteofthedayapplicationaddin.cpp:49 -msgid "" -"Automatically creates a \"Today\" note for easily jotting down daily thoughts" -msgstr "" +#~ msgid "Start synchronizing notes" +#~ msgstr "Notları eşzamanlandırmayı başlat" -#: ../src/addins/noteoftheday/noteofthedayapplicationaddin.cpp:54 -msgid "Debarshi Ray and the Tomboy Project" -msgstr "" +#~ msgid "Cannot create new note" +#~ msgstr "Yeni not oluşturulamıyor" -#: ../src/addins/noteoftheday/noteofthedaypreferences.cpp:35 -msgid "_Open Today: Template" -msgstr "Bugün: Şablom _Aç" +#~ msgid "Editing" +#~ msgstr "Düzenleme" -#: ../src/addins/noteoftheday/noteofthedaypreferences.cpp:36 -#, fuzzy -#| msgid "" -#| "Change the Today: Template note to customize the text that new " -#| "Today notes have." -msgid "" -"Change the Today: Template note to customize " -"the text that new Today notes have." -msgstr "" -"Yeni Bugün notlarının içereceği metni özelleştirmek için Bugün: Şablon notunu değiştirin." +#~ msgid "Add-ins" +#~ msgstr "Eklentiler" -#: ../src/addins/printnotes/printnotesnoteaddin.cpp:48 -msgid "Printing Support" -msgstr "" +#~ msgid "Open \"Search _All Notes\"" +#~ msgstr "\"Tüm Notları Ara\" _Aç" -#: ../src/addins/printnotes/printnotesnoteaddin.cpp:52 -msgid "Allows you to print a note." -msgstr "" +#~ msgid "Find in This Note" +#~ msgstr "Bu Not İçinde Bul" -#: ../src/addins/printnotes/printnotesnoteaddin.cpp:79 -msgid "Print" -msgstr "Yazdır" +#~ msgid "_Find in This Note" +#~ msgstr "_Bu Not İçinde Bul" -#: ../src/addins/printnotes/printnotesnoteaddin.cpp:134 -msgid "Error printing note" -msgstr "Not yazdırılırken hata oluştu" +#~ msgid "Clos_e All Notes" +#~ msgstr "Tü_m Notları Kapat" + +#~ msgid "Search your notes (Ctrl-Shift-F)" +#~ msgstr "Notlarınızı arayın (Ctrl-Shift-F)" -#. %1% is the page number, %2% is the total number of pages -#: ../src/addins/printnotes/printnotesnoteaddin.cpp:298 #, fuzzy -#| msgid "Page {0} of {1}" -msgid "Page %1% of %2%" -msgstr "{1} sayfadan {0}" +#~| msgid "Link selected text to a new note" +#~ msgid "Link selected text to a new note (Ctrl-L)" +#~ msgstr "Seçilen metni yeni bir nota bağla" -#: ../src/addins/replacetitle/replacetitlenoteaddin.cpp:43 -#: ../src/addins/replacetitle/replacetitlenoteaddin.cpp:77 -msgid "Replace title" -msgstr "" +#~ msgid "_Text" +#~ msgstr "_Metin" -#: ../src/addins/replacetitle/replacetitlenoteaddin.cpp:48 -#, fuzzy -#| msgid "Delete the selected note" -msgid "Replace title with selection." -msgstr "Seçilen notu sil" +#~ msgid "T_ools" +#~ msgstr "_Araçlar" -#: ../src/addins/replacetitle/replacetitlenoteaddin.cpp:54 -msgid "Pierre-Yves Luyten" -msgstr "Pierre-Yves Luyten" +#~ msgid "_Find..." +#~ msgstr "_Bul..." -#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:59 -#, fuzzy -#| msgid "Sticky Note Importer First Run" -msgid "Sticky Notes Importer" -msgstr "En Başta Yapışkan Not İçe Aktarıcısını Çalıştır" +#~ msgid "_Next" +#~ msgstr "_Sonraki" -#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:63 -#, fuzzy -#| msgid "Import from Sticky Notes" -msgid "Import your notes from the Sticky Notes applet." -msgstr "Yapışkan Not'lardan İçe Aktar" +#~ msgid "_Previous" +#~ msgstr "Ö_nceki" -#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:109 -msgid "Import from Sticky Notes" -msgstr "Yapışkan Not'lardan İçe Aktar" +#~ msgid "_Find:" +#~ msgstr "_Bul:" -#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:209 -msgid "No Sticky Notes found" -msgstr "Yapışkan Not bulunamadı" +#~ msgid "Increase Font Size" +#~ msgstr "Yazıtipi Boyutunu Büyüt" -#. %1% is a the file name -#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:211 -#, fuzzy -#| msgid "No suitable Sticky Notes file was found at \"{0}\"." -msgid "No suitable Sticky Notes file was found at \"%1%\"." -msgstr "\"{0}\" konumunda uygun olmayayan Yapışkan Not dosyaları bulundu." +#~ msgid "Decrease Font Size" +#~ msgstr "Yazıtipi Boyutunu Küçült" -#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:219 -msgid "Sticky Notes import completed" -msgstr "Yapışkan Not içe aktarımı tamamlandı" +#~ msgid "Font Size" +#~ msgstr "Yazıtipi Boyutu" -#. here %1% is the number of notes imported, %2% the total number of notes. -#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:221 -#| msgid "{0} of {1} Sticky Note was successfully imported." -#| msgid_plural "" -#| "{0} of {1} Sticky Notes were successfully imported." -msgid "%1% of %2% Sticky Notes were successfully imported." -msgstr "%1% / %2% Yapışkan Not başarıyla içe aktarıldı." +#~ msgid "_Search:" +#~ msgstr "_Ara:" -#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:240 -msgid "Untitled" -msgstr "Başlıksız" +#~ msgid "Last Changed" +#~ msgstr "Son Değiştirilme" -#: ../src/addins/stickynoteimport/stickynoteimportnoteaddin.cpp:287 -msgid "Sticky Note: " -msgstr "Yapışkan Not: " +#~| msgid "Matches: {0} note" +#~| msgid_plural "Matches: {0} notes" +#~ msgid "Matches: %1% note" +#~ msgid_plural "Matches: %1% notes" +#~ msgstr[0] "Eşleşmeler: %1% not" -#: ../src/addins/tomboyimport/tomboyimportaddin.cpp:48 -#| msgid "Tomboy Notes" -msgid "Tomboy Importer" -msgstr "Tomboy İçe Aktarıcı" +#~| msgid "{0} day ago, {1}" +#~| msgid_plural "{0} days ago, {1}" +#~ msgid "%1% day ago, %2%" +#~ msgid_plural "%1% days ago, %2%" +#~ msgstr[0] "%1% gün önce, %2%" -#: ../src/addins/tomboyimport/tomboyimportaddin.cpp:52 -#| msgid "Export your notes." -msgid "Import your notes from Tomboy." -msgstr "Tomboy'daki notlarınızı içe aktarın." +#~| msgid "{0} day ago" +#~| msgid_plural "{0} days ago" +#~ msgid "%1% day ago" +#~ msgid_plural "%1% days ago" +#~ msgstr[0] "%1% gün önce" -#: ../src/addins/tomboyimport/tomboyimportaddin.cpp:56 -msgid "Hubert Figuiere" -msgstr "Hubert Figuiere" +#~| msgid "In {0} day" +#~| msgid_plural "In {0} days" +#~ msgid "In %1% day" +#~ msgid_plural "In %1% days" +#~ msgstr[0] "%1% gün içinde" -#: ../src/addins/underline/underlinemenuitem.cpp:35 -msgid "_Underline" -msgstr "_Altı çizili" +#~ msgid "Type the name of the notebook you'd like to create." +#~ msgstr "Oluşturmak istediğiniz not defterinin ismini yazın." -#. this is the name of the plugin. -#: ../src/addins/underline/underlinenoteaddin.cpp:49 -#, fuzzy -#| msgid "_Underline" -msgid "Underline" -msgstr "_Altı çizili" +#~ msgid "Note_books" +#~ msgstr "_Not Defterleri" -#: ../src/addins/underline/underlinenoteaddin.cpp:53 -msgid "Adds ability to underline text." -msgstr "" +#~ msgid "Create a new note in this notebook" +#~ msgstr "Bu not defterinde yeni bir not oluştur" -#: ../src/addins/underline/underlinenoteaddin.cpp:57 -msgid "Hubert Figuière and the Tomboy Project" -msgstr "Hubert Figuière ve Tomboy Projesi" +#~ msgid "Open this notebook's template note" +#~ msgstr "Bu not defterinin şablom notunu aç" + +#~ msgid "Delete Note_book" +#~ msgstr "Not Defterini _Sil" + +#~ msgid "Delete the selected notebook" +#~ msgstr "Seçilen not defterini sil" #~ msgid "Accessories" #~ msgstr "Donatılar" @@ -1995,9 +3146,6 @@ #~ msgid "Tomboy Applet Factory" #~ msgstr "Tomboy Uygulamacık Üreticisi" -#~ msgid "Automatic Background Synchronization Timeout" -#~ msgstr "Otomatik Arkaplan Eşzamanlamasında Zaman Aşımı" - #~ msgid "Enable Tray Icon" #~ msgstr "Bildirim Simgesini Etkinleştir" @@ -2029,17 +3177,6 @@ #~ "Böylece eklenti Tomboy'un bir sonraki başlatılmasında kendiliğinden " #~ "çalışacak." -#~ msgid "" -#~ "Integer value indicating how frequently to perform a background sync of " -#~ "your notes (when sync is configured). Any value less than 1 indicates " -#~ "that autosync is disabled. The lowest acceptable positive value is 5. " -#~ "Value is in minutes." -#~ msgstr "" -#~ "Notlarınızın (eşzamanlama yapılandırılmışsa) ne sıklıkla arkaplanda " -#~ "eşzamanlanacağını gösteren tam sayı değeri. 1'den küçük herhangi bir " -#~ "değer, otomatik eşzamanlamanın devre dışı bırakıldığını gösterir. Kabul " -#~ "edilebilir en küçük pozitif sayı 5'dir. Bu değer, dakika cinsindendir." - #~ msgid "Last Directory used in HTML Export" #~ msgstr "HTML Dışa Aktarmada Kullanılan Son Dizin" @@ -2101,22 +3238,6 @@ #~ msgid "Folder does not exist." #~ msgstr "Klasör mevcut değil." -#~ msgid "_Folder Path:" -#~ msgstr "_Klasör Yolu:" - -#~ msgid "Select Synchronization Folder..." -#~ msgstr "Eşzamanlandırma Klasörü Seç..." - -#~ msgid "Folder path field is empty." -#~ msgstr "Klasör yol alanı boş." - -#~ msgid "" -#~ "Specified folder path does not exist, and Tomboy was unable to create it." -#~ msgstr "Belirtilen klasör yolu mevcut değil, ve Tomboy onu oluşturamadı." - -#~ msgid "Local Folder" -#~ msgstr "Yerel Klasör" - #~ msgid "Cannot contact '{0}'" #~ msgstr "Bağlantı kurulamadı '{0}'" @@ -2141,9 +3262,6 @@ #~ msgid "Se_rver:" #~ msgstr "_Sunucu:" -#~ msgid "User_name:" -#~ msgstr "_Kullanıcı adı:" - #~ msgid "_Folder Path (optional):" #~ msgstr "_Klasör Yolu (tercihi):" @@ -2170,38 +3288,9 @@ #~ msgid "Tasque" #~ msgstr "Tasque" -#~ msgid "All" -#~ msgstr "Hepsi" - #~ msgid "--- Tasque is not running ---" #~ msgstr "--- Tasque çalışmıyor ---" -#~ msgid "_URL:" -#~ msgstr "_URL:" - -#~ msgid "_Password:" -#~ msgstr "_Parola:" - -#~ msgid "URL, username, or password field is empty." -#~ msgstr "URL, kullanıcı ismi ya da parola alanı boş." - -#~ msgid "WebDAV" -#~ msgstr "WebDAV" - -#~ msgid "" -#~ "There was an error connecting to the server. This may be caused by using " -#~ "an incorrect user name and/or password." -#~ msgstr "" -#~ "Sunucuya bağlanırken hata oluştu. Bu yanlış kullanıcı ismi ve/veya parola " -#~ "kullanılmasından kaynaklanabilir." - -#~ msgid "" -#~ "Saving configuration to the GNOME keyring failed with the following " -#~ "message:" -#~ msgstr "" -#~ "Yapılandırmanın GNOME anahtarlığına kaydedilmesi aşağıdaki ileti ile " -#~ "başarısız oldu:" - #~ msgid "Connect to Server" #~ msgstr "Sunucuya Bağlan" @@ -2280,9 +3369,6 @@ #~ msgid "Could not export, folder does not exist." #~ msgstr "Dışa aktarılamadı, böyle bir klasör yok." -#~ msgid "Could not export: {0}" -#~ msgstr "Dışa aktarılamadı: {0}" - #~ msgid "Your notes were exported to \"{0}\"." #~ msgstr "Notlarınız \"{0}\" konumuna aktarıldı." @@ -2306,21 +3392,12 @@ #~ msgid "Recent Notes" #~ msgstr "Son Notlar" -#~ msgid "_Window" -#~ msgstr "_Pencere" - #~ msgid "Preferences..." #~ msgstr "Tercihler..." #~ msgid "New Note {0}" #~ msgstr "Yeni Not {0}" -#, fuzzy -#~| msgid "Really delete this {0} note?" -#~| msgid_plural "Really delete these {0} notes?" -#~ msgid "Really delete \"{0}\"?" -#~ msgstr "Bu {0} not gerçekten silinsin mi?" - #~ msgid "Really delete this {0} note?" #~ msgid_plural "Really delete these {0} notes?" #~ msgstr[0] "Bu {0} not gerçekten silinsin mi?" @@ -2344,8 +3421,8 @@ #~ "link:url>\n" #~ "Configuration is at {2}\n" -#~ "You can install add-ins at " -#~ "{3}\n" +#~ "You can install add-ins at {3}\n" #~ "Log files can be found at {4}" #~ "\n" #~ "\n" @@ -2376,27 +3453,9 @@ #~ msgid "Search your notes" #~ msgstr "Notlarınızı arayın" -#, fuzzy -#~| msgid "Connect to Server" -#~ msgid "Convert to regular note" -#~ msgstr "Sunucuya Bağlan" - -#, fuzzy -#~| msgid "Select None" -#~ msgid "Save Se_lection" -#~ msgstr "Hiçbirini Seçme" - -#, fuzzy -#~| msgid "Note Title" -#~ msgid "Save _Title" -#~ msgstr "Not Başlığı" - #~ msgid "_Bold" #~ msgstr "_Kalın" -#~ msgid "Synchronization" -#~ msgstr "Eşzamanlandırma" - #~ msgid "Automaticall_y Sync in Background Every" #~ msgstr "Arkapland_a Otomatik Olarak Eşzamanlama Sıklığı:" @@ -2409,273 +3468,9 @@ #~ msgid "{0} Preferences" #~ msgstr "{0} Tercihleri" -#~ msgid "Other Synchronization Options" -#~ msgstr "Diğer Eşzamanlandırma Seçenekleri" - -#~ msgid "" -#~ "When a conflict is detected between a local note and a note on the " -#~ "configured synchronization server:" -#~ msgstr "" -#~ "Yerel bir not ile yapılandırılmış eşzamanlandırma sunucusu üzerindeki not " -#~ "arasında çakışma tespit edildiğinde:" - -#~ msgid "Always ask me what to do." -#~ msgstr "Ne yapılacağını her zaman bana sor." - -#~ msgid "Rename my local note." -#~ msgstr "Yerel notumu yeniden adlandır." - -#~ msgid "Replace my local note with the server's update." -#~ msgstr "Sunucudaki güncel olaranı ile beni notumu yer değiştir." - -#~ msgid "Are you sure?" -#~ msgstr "Emin misiniz?" - -#~ msgid "" -#~ "Clearing your synchronization settings is not recommended. You may be " -#~ "forced to synchronize all of your notes again when you save new settings." -#~ msgstr "" -#~ "Eşzamanlandırma ayarlarınızı temizlemek tavsiye edilmiyor. Yeni ayarları " -#~ "kaydettiğinizde tüm notlarınızı tekrar eşzamanlandırmaya " -#~ "zorlanabilrisiniz." - -#~ msgid "Resetting Synchronization Settings" -#~ msgstr "Eşzamanlandırma Ayarları Sıfırlanıyor" - -#~ msgid "" -#~ "You have disabled the configured synchronization service. Your " -#~ "synchronization settings will now be cleared. You may be forced to " -#~ "synchronize all of your notes again when you save new settings." -#~ msgstr "" -#~ "Yapılandırılmış eşzamanlandırma servisini etkinsizleştirdiniz. Şimdi " -#~ "eşzamanlandırma ayarlarını temizlenecek. Yeni ayarları kaydettiğinizde " -#~ "terkar tüm notlarınızı eşzamanlandırmaya zorlanabilirsiniz." - -#~ msgid "Connection successful" -#~ msgstr "Bağlantı başarılı" - -#~ msgid "" -#~ "Tomboy is ready to synchronize your notes. Would you like to synchronize " -#~ "them now?" -#~ msgstr "" -#~ "Tomboy notlarınızı eşzamanlandırmak için hazır. Notlarınızı şimdi " -#~ "eşzamanlandırmak istiyor musunuz?" - -#~ msgid "" -#~ "Please check your information and try again. The log file {0} may " -#~ "contain more information about the error." -#~ msgstr "" -#~ "Lütfen bilgilerinizi kontrol edip tekrar deneyin. Günlük dosyası {0}, " -#~ "hata hakkında daha fazla bilgi içeriyor olabilir." - -#~ msgid "Error connecting" -#~ msgstr "Bağlanırken hata oluştu" - #~ msgid "Add-in Dependencies:" #~ msgstr "Eklenti Bağımlılıkları:" -#~ msgid "" -#~ "This synchronization addin is not supported on your computer. Please make " -#~ "sure you have FUSE and {0} correctly installed and configured" -#~ msgstr "" -#~ "Eşzamanlandırma eklentisi bilgisayarınızda desteklenmiyor. Lütfen FUSE'ün " -#~ "bulunduğundan ve {0} kurulumunun doğru yapılıp yapılandırıldığından emin " -#~ "olun" - -#~ msgid "Could not read testfile." -#~ msgstr "Test dosyası okunamadı." - -#~ msgid "Write test failed." -#~ msgstr "Yazma testi başarısız oldu." - -#~ msgid "Timeout connecting to server." -#~ msgstr "Sunucuya bağlanırken zaman aşımı." - -#~ msgid "Error connecting to server." -#~ msgstr "Sunucuya bağlanırken hata." - -#~ msgid "FUSE could not be enabled." -#~ msgstr "FUSE etkinleştirilemedi." - -#~ msgid "An error ocurred while connecting to the specified server:" -#~ msgstr "Belirtilen sunucuya bağlanılırken bir hata oluştu:" - -#~ msgid "Details" -#~ msgstr "Ayrıntılar" - -#~ msgid "Status" -#~ msgstr "Durum" - -#~ msgid "Acquiring sync lock..." -#~ msgstr "Eşzamanlama kilidi alınıyor..." - -#~ msgid "Committing changes..." -#~ msgstr "Değişiklikler gönderiliyor..." - -#~ msgid "Synchronizing Notes" -#~ msgstr "Notlar Eşzamanlandırılıyor" - -#~ msgid "Synchronizing your notes..." -#~ msgstr "Notlarınız eşzamanlandırılıyor..." - -#~ msgid "This may take a while, kick back and enjoy!" -#~ msgstr "Bu biraz zaman alabilir, arkaya yaslanın ve keyfini çıkartın!" - -#~ msgid "Connecting to the server..." -#~ msgstr "Sunucuya bağlanılıyor..." - -#~ msgid "Deleting notes off of the server..." -#~ msgstr "Notlar sunucudan siliniyor..." - -#~ msgid "Downloading new/updated notes..." -#~ msgstr "Yeni/güncellenmiş notlar indiriliyor..." - -#~ msgid "Server Locked" -#~ msgstr "Sunucu Kilitli" - -#~ msgid "Server is locked" -#~ msgstr "Sunucu kilitli" - -#~ msgid "" -#~ "One of your other computers is currently synchronizing. Please wait 2 " -#~ "minutes and try again." -#~ msgstr "" -#~ "Diğer bilgisayarlarınızdan birisi şu anda eşzamanlandırılıyor. Lütfen 2 " -#~ "dakika bekleyin ve tekrar deneyin." - -#~ msgid "Preparing to download updates from server..." -#~ msgstr "Sunucudan güncellemeleri indirmek için hazırlanılıyor..." - -#~ msgid "Preparing to upload updates to server..." -#~ msgstr "Sunucuya güncellemeleri yüklemek için hazırlanılıyor..." - -#~ msgid "Uploading notes to server..." -#~ msgstr "Notlar sunucuya yükleniyor..." - -#~ msgid "Synchronization Failed" -#~ msgstr "Eşzamanlandırma Başarısız Oldu" - -#~ msgid "Failed to synchronize" -#~ msgstr "Eşzamanlandırma başarısız oldu" - -#~ msgid "Could not synchronize notes. Check the details below and try again." -#~ msgstr "" -#~ "Notlar eşzamanlandırılamadı. Aşağıdaki ayrıntıları kontrol edin ve tekrar " -#~ "deneyin." - -#~ msgid "Synchronization Complete" -#~ msgstr "Eşzamanlandırma Tamamlandı" - -#~ msgid "Synchronization is complete" -#~ msgstr "Eşzamanlandırma tatmlandı" - -#~ msgid "{0} note updated." -#~ msgid_plural "{0} notes updated." -#~ msgstr[0] "{0} not güncellendi." - -#~ msgid "Your notes are now up to date." -#~ msgstr "Notlarınızı artık güncel." - -#~ msgid "Synchronization Canceled" -#~ msgstr "Eşzamanlandırma İptal Edildi" - -#~ msgid "Synchronization was canceled" -#~ msgstr "Eşzamanlandırma iptal edildi" - -#~ msgid "You canceled the synchronization. You may close the window now." -#~ msgstr "Eşzamanlandırmayı iptal ettiniz. Şimdi pencereyi kapatabilirsiniz." - -#~ msgid "Synchronization Not Configured" -#~ msgstr "Eşzamanlandırma Yapılandırılmamış" - -#~ msgid "Synchronization is not configured" -#~ msgstr "Eşzamanlandırma yapılandırılmamış" - -#~ msgid "Please configure synchronization in the preferences dialog." -#~ msgstr "Lütfen eşzamanlandırmanızı tercihler penceresinden yapılandırın." - -#~ msgid "Synchronization Service Error" -#~ msgstr "Eşzamanlandırma Servis Hatası" - -#~ msgid "Service error" -#~ msgstr "Servis hatası" - -#~ msgid "Error connecting to the synchronization service. Please try again." -#~ msgstr "Eşzamanlandırma servisine bağlanırken hata. Lütfen tekrar deneyin." - -#~ msgid "Deleted locally" -#~ msgstr "Yerelde silindi" - -#~ msgid "Deleted from server" -#~ msgstr "Sunucudan silindi" - -#~ msgid "Updated" -#~ msgstr "Güncellendi" - -#~ msgid "Added" -#~ msgstr "Eklendi" - -#~ msgid "Uploaded changes to server" -#~ msgstr "Değişiklikler sunucuya yüklendi" - -#~ msgid "Uploaded new note to server" -#~ msgstr "Sunucuya yeni not yüklendi" - -#~ msgid "Note Conflict" -#~ msgstr "Not Çakışması" - -#~ msgid " (old)" -#~ msgstr " (eski)" - -#~ msgid "Rename local note:" -#~ msgstr "Yerel notu yeniden adlandır:" - -#~ msgid "Update links in referencing notes" -#~ msgstr "Referans notlardaki bağları güncelle" - -#~ msgid "Overwrite local note" -#~ msgstr "Yerel notun üzerine yaz" - -#~ msgid "Always perform this action" -#~ msgstr "Her zaman bu eylemi uygula" - -#~ msgid "Note conflict detected" -#~ msgstr "Not çakışması tespit edildi" - -#~ msgid "" -#~ "The server version of \"{0}\" conflicts with your local note. What do " -#~ "you want to do with your local note?" -#~ msgstr "" -#~ "Sunucu sürümü \"{0}\" yerel notunuzla çakışıyor. Yerel notla ne yapmak " -#~ "istiyor sunuz?" - -#~ msgid "Could not enable FUSE" -#~ msgstr "FUSE etkinleştirilemedi" - -#~ msgid "" -#~ "The FUSE module could not be loaded. Please check that it is installed " -#~ "properly and try again." -#~ msgstr "" -#~ "FUSE modülü yüklenemedi. Lütfen doğru bir şekilde kurulduğundan emin olun " -#~ "ve tekrar deneyin." - -#~ msgid "Enable FUSE?" -#~ msgstr "FUSE etkinleştirilsin mi?" - -#~ msgid "" -#~ "The synchronization you've chosen requires the FUSE module to be loaded.\n" -#~ "\n" -#~ "To avoid getting this prompt in the future, you should load FUSE at " -#~ "startup. Add \"modprobe fuse\" to /etc/init.d/boot.local or \"fuse\" to /" -#~ "etc/modules." -#~ msgstr "" -#~ "Seçmiş olduğunuz eşzamanlandırma FUSE modülünün yüklenmesini " -#~ "gerektiriyor.\n" -#~ "\n" -#~ "Gelecekte bu soruyla karşılaşmamak için, başlangıçta FUSE'ü " -#~ "yüklemelisiniz. /etc/init.d/boot.local içerisine \"modprbe fuse\" ekleyin " -#~ "ya da /etc/modules içerisine \"fuse\" ekleyin." - #~ msgid "Primary Development:" #~ msgstr "Birincil Geliştirme:" @@ -2877,9 +3672,6 @@ #~ msgid "Whether to print a header in each page" #~ msgstr "Her sayfada bir başlığın yazdırılması" -#~ msgid "Print Footer" -#~ msgstr "Soneki Yazdır" - #~ msgid "Whether to print a footer in each page" #~ msgstr "Her sayfanın sonunda son ekin yazdırılması" diff -Nru gnote-3.14.2/src/addins/backlinks/backlinks.desktop.in gnote-3.16.0/src/addins/backlinks/backlinks.desktop.in --- gnote-3.14.2/src/addins/backlinks/backlinks.desktop.in 2015-01-17 15:38:24.000000000 +0000 +++ gnote-3.16.0/src/addins/backlinks/backlinks.desktop.in 2015-03-29 19:57:00.000000000 +0000 @@ -7,5 +7,5 @@ Version=0.3 DefaultEnabled=true Module=backlinks -LibgnoteRelease=3.14 -LibgnoteVersionInfo=0:1:0 +LibgnoteRelease=3.16 +LibgnoteVersionInfo=0:0:0 diff -Nru gnote-3.14.2/src/addins/bugzilla/bugzilla.desktop.in gnote-3.16.0/src/addins/bugzilla/bugzilla.desktop.in --- gnote-3.14.2/src/addins/bugzilla/bugzilla.desktop.in 2015-01-17 15:38:24.000000000 +0000 +++ gnote-3.16.0/src/addins/bugzilla/bugzilla.desktop.in 2015-03-29 19:57:00.000000000 +0000 @@ -7,5 +7,5 @@ Version=0.2 DefaultEnabled=false Module=bugzilla -LibgnoteRelease=3.14 -LibgnoteVersionInfo=0:1:0 +LibgnoteRelease=3.16 +LibgnoteVersionInfo=0:0:0 diff -Nru gnote-3.14.2/src/addins/exporttogtg/exporttogtg.desktop.in gnote-3.16.0/src/addins/exporttogtg/exporttogtg.desktop.in --- gnote-3.14.2/src/addins/exporttogtg/exporttogtg.desktop.in 2015-01-17 15:38:24.000000000 +0000 +++ gnote-3.16.0/src/addins/exporttogtg/exporttogtg.desktop.in 2015-03-29 19:57:00.000000000 +0000 @@ -7,5 +7,5 @@ Version=0.1 DefaultEnabled=false Module=exporttogtg -LibgnoteRelease=3.14 -LibgnoteVersionInfo=0:1:0 +LibgnoteRelease=3.16 +LibgnoteVersionInfo=0:0:0 diff -Nru gnote-3.14.2/src/addins/exporttohtml/exporttohtml.desktop.in gnote-3.16.0/src/addins/exporttohtml/exporttohtml.desktop.in --- gnote-3.14.2/src/addins/exporttohtml/exporttohtml.desktop.in 2015-01-17 15:38:24.000000000 +0000 +++ gnote-3.16.0/src/addins/exporttohtml/exporttohtml.desktop.in 2015-03-29 19:57:01.000000000 +0000 @@ -7,5 +7,5 @@ Version=0.3 DefaultEnabled=false Module=exporttohtml -LibgnoteRelease=3.14 -LibgnoteVersionInfo=0:1:0 +LibgnoteRelease=3.16 +LibgnoteVersionInfo=0:0:0 diff -Nru gnote-3.14.2/src/addins/filesystemsyncservice/filesystemsyncservice.desktop.in gnote-3.16.0/src/addins/filesystemsyncservice/filesystemsyncservice.desktop.in --- gnote-3.14.2/src/addins/filesystemsyncservice/filesystemsyncservice.desktop.in 2015-01-17 15:38:24.000000000 +0000 +++ gnote-3.16.0/src/addins/filesystemsyncservice/filesystemsyncservice.desktop.in 2015-03-29 19:57:01.000000000 +0000 @@ -7,5 +7,5 @@ Version=0.2 DefaultEnabled=true Module=filesystemsyncservice -LibgnoteRelease=3.14 -LibgnoteVersionInfo=0:1:0 +LibgnoteRelease=3.16 +LibgnoteVersionInfo=0:0:0 diff -Nru gnote-3.14.2/src/addins/fixedwidth/fixedwidth.desktop.in gnote-3.16.0/src/addins/fixedwidth/fixedwidth.desktop.in --- gnote-3.14.2/src/addins/fixedwidth/fixedwidth.desktop.in 2015-01-17 15:38:24.000000000 +0000 +++ gnote-3.16.0/src/addins/fixedwidth/fixedwidth.desktop.in 2015-03-29 19:57:01.000000000 +0000 @@ -7,5 +7,5 @@ Version=0.3 DefaultEnabled=true Module=fixedwidth -LibgnoteRelease=3.14 -LibgnoteVersionInfo=0:1:0 +LibgnoteRelease=3.16 +LibgnoteVersionInfo=0:0:0 diff -Nru gnote-3.14.2/src/addins/inserttimestamp/inserttimestamp.desktop.in gnote-3.16.0/src/addins/inserttimestamp/inserttimestamp.desktop.in --- gnote-3.14.2/src/addins/inserttimestamp/inserttimestamp.desktop.in 2015-01-17 15:38:24.000000000 +0000 +++ gnote-3.16.0/src/addins/inserttimestamp/inserttimestamp.desktop.in 2015-03-29 19:57:01.000000000 +0000 @@ -7,5 +7,5 @@ Version=0.2 DefaultEnabled=false Module=inserttimestamp -LibgnoteRelease=3.14 -LibgnoteVersionInfo=0:1:0 +LibgnoteRelease=3.16 +LibgnoteVersionInfo=0:0:0 diff -Nru gnote-3.14.2/src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in gnote-3.16.0/src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in --- gnote-3.14.2/src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in 2015-01-17 15:38:24.000000000 +0000 +++ gnote-3.16.0/src/addins/notedirectorywatcher/notedirectorywatcher.desktop.in 2015-03-29 19:57:01.000000000 +0000 @@ -7,5 +7,5 @@ Version=0.3 DefaultEnabled=false Module=notedirectorywatcher -LibgnoteRelease=3.14 -LibgnoteVersionInfo=0:1:0 +LibgnoteRelease=3.16 +LibgnoteVersionInfo=0:0:0 diff -Nru gnote-3.14.2/src/addins/noteoftheday/noteoftheday.desktop.in gnote-3.16.0/src/addins/noteoftheday/noteoftheday.desktop.in --- gnote-3.14.2/src/addins/noteoftheday/noteoftheday.desktop.in 2015-01-17 15:38:24.000000000 +0000 +++ gnote-3.16.0/src/addins/noteoftheday/noteoftheday.desktop.in 2015-03-29 19:57:01.000000000 +0000 @@ -7,5 +7,5 @@ Version=0.2 DefaultEnabled=false Module=noteoftheday -LibgnoteRelease=3.14 -LibgnoteVersionInfo=0:1:0 +LibgnoteRelease=3.16 +LibgnoteVersionInfo=0:0:0 diff -Nru gnote-3.14.2/src/addins/printnotes/printnotes.desktop.in gnote-3.16.0/src/addins/printnotes/printnotes.desktop.in --- gnote-3.14.2/src/addins/printnotes/printnotes.desktop.in 2015-01-17 15:38:24.000000000 +0000 +++ gnote-3.16.0/src/addins/printnotes/printnotes.desktop.in 2015-03-29 19:57:01.000000000 +0000 @@ -7,5 +7,5 @@ Version=0.6 DefaultEnabled=true Module=printnotes -LibgnoteRelease=3.14 -LibgnoteVersionInfo=0:1:0 +LibgnoteRelease=3.16 +LibgnoteVersionInfo=0:0:0 diff -Nru gnote-3.14.2/src/addins/readonly/readonly.desktop.in gnote-3.16.0/src/addins/readonly/readonly.desktop.in --- gnote-3.14.2/src/addins/readonly/readonly.desktop.in 2015-01-17 15:38:24.000000000 +0000 +++ gnote-3.16.0/src/addins/readonly/readonly.desktop.in 2015-03-29 19:57:01.000000000 +0000 @@ -7,5 +7,5 @@ Version=0.2 DefaultEnabled=false Module=readonly -LibgnoteRelease=3.14 -LibgnoteVersionInfo=0:1:0 +LibgnoteRelease=3.16 +LibgnoteVersionInfo=0:0:0 diff -Nru gnote-3.14.2/src/addins/replacetitle/replacetitle.desktop.in gnote-3.16.0/src/addins/replacetitle/replacetitle.desktop.in --- gnote-3.14.2/src/addins/replacetitle/replacetitle.desktop.in 2015-01-17 15:38:24.000000000 +0000 +++ gnote-3.16.0/src/addins/replacetitle/replacetitle.desktop.in 2015-03-29 19:57:01.000000000 +0000 @@ -7,5 +7,5 @@ Version=0.2 DefaultEnabled=true Module=replacetitle -LibgnoteRelease=3.14 -LibgnoteVersionInfo=0:1:0 +LibgnoteRelease=3.16 +LibgnoteVersionInfo=0:0:0 diff -Nru gnote-3.14.2/src/addins/specialnotes/specialnotes.desktop.in gnote-3.16.0/src/addins/specialnotes/specialnotes.desktop.in --- gnote-3.14.2/src/addins/specialnotes/specialnotes.desktop.in 2015-01-17 15:38:24.000000000 +0000 +++ gnote-3.16.0/src/addins/specialnotes/specialnotes.desktop.in 2015-03-29 19:57:01.000000000 +0000 @@ -7,5 +7,5 @@ Version=0.1 DefaultEnabled=false Module=specialnotes -LibgnoteRelease=3.14 -LibgnoteVersionInfo=0:1:0 +LibgnoteRelease=3.16 +LibgnoteVersionInfo=0:0:0 diff -Nru gnote-3.14.2/src/addins/statistics/statistics.desktop.in gnote-3.16.0/src/addins/statistics/statistics.desktop.in --- gnote-3.14.2/src/addins/statistics/statistics.desktop.in 2015-01-17 15:38:24.000000000 +0000 +++ gnote-3.16.0/src/addins/statistics/statistics.desktop.in 2015-03-29 19:57:01.000000000 +0000 @@ -7,5 +7,5 @@ Version=0.2 DefaultEnabled=false Module=statistics -LibgnoteRelease=3.14 -LibgnoteVersionInfo=0:1:0 +LibgnoteRelease=3.16 +LibgnoteVersionInfo=0:0:0 diff -Nru gnote-3.14.2/src/addins/stickynoteimport/stickynoteimport.desktop.in gnote-3.16.0/src/addins/stickynoteimport/stickynoteimport.desktop.in --- gnote-3.14.2/src/addins/stickynoteimport/stickynoteimport.desktop.in 2015-01-17 15:38:24.000000000 +0000 +++ gnote-3.16.0/src/addins/stickynoteimport/stickynoteimport.desktop.in 2015-03-29 19:57:01.000000000 +0000 @@ -7,7 +7,7 @@ Version=0.2 DefaultEnabled=true Module=stickynoteimport -LibgnoteRelease=3.14 -LibgnoteVersionInfo=0:1:0 +LibgnoteRelease=3.16 +LibgnoteVersionInfo=0:0:0 [AddinAttributes] AutoDisable=true diff -Nru gnote-3.14.2/src/addins/tableofcontents/tableofcontents.desktop.in gnote-3.16.0/src/addins/tableofcontents/tableofcontents.desktop.in --- gnote-3.14.2/src/addins/tableofcontents/tableofcontents.desktop.in 2015-01-17 15:38:24.000000000 +0000 +++ gnote-3.16.0/src/addins/tableofcontents/tableofcontents.desktop.in 2015-03-29 19:57:01.000000000 +0000 @@ -8,5 +8,5 @@ DefaultEnabled=false Module=tableofcontents _Copyright=© 2013 Luc Pionchon -LibgnoteRelease=3.14 -LibgnoteVersionInfo=0:1:0 +LibgnoteRelease=3.16 +LibgnoteVersionInfo=0:0:0 diff -Nru gnote-3.14.2/src/addins/todo/todo.desktop.in gnote-3.16.0/src/addins/todo/todo.desktop.in --- gnote-3.14.2/src/addins/todo/todo.desktop.in 2015-01-17 15:38:24.000000000 +0000 +++ gnote-3.16.0/src/addins/todo/todo.desktop.in 2015-03-29 19:57:01.000000000 +0000 @@ -7,5 +7,5 @@ Version=0.1 DefaultEnabled=false Module=todo -LibgnoteRelease=3.14 -LibgnoteVersionInfo=0:1:0 +LibgnoteRelease=3.16 +LibgnoteVersionInfo=0:0:0 diff -Nru gnote-3.14.2/src/addins/tomboyimport/tomboyimport.desktop.in gnote-3.16.0/src/addins/tomboyimport/tomboyimport.desktop.in --- gnote-3.14.2/src/addins/tomboyimport/tomboyimport.desktop.in 2015-01-17 15:38:24.000000000 +0000 +++ gnote-3.16.0/src/addins/tomboyimport/tomboyimport.desktop.in 2015-03-29 19:57:01.000000000 +0000 @@ -7,7 +7,7 @@ Version=0.2 DefaultEnabled=true Module=tomboyimport -LibgnoteRelease=3.14 -LibgnoteVersionInfo=0:1:0 +LibgnoteRelease=3.16 +LibgnoteVersionInfo=0:0:0 [AddinAttributes] AutoDisable=true diff -Nru gnote-3.14.2/src/addins/underline/underline.desktop.in gnote-3.16.0/src/addins/underline/underline.desktop.in --- gnote-3.14.2/src/addins/underline/underline.desktop.in 2015-01-17 15:38:25.000000000 +0000 +++ gnote-3.16.0/src/addins/underline/underline.desktop.in 2015-03-29 19:57:01.000000000 +0000 @@ -7,5 +7,5 @@ Version=0.2 DefaultEnabled=true Module=underline -LibgnoteRelease=3.14 -LibgnoteVersionInfo=0:1:0 +LibgnoteRelease=3.16 +LibgnoteVersionInfo=0:0:0 diff -Nru gnote-3.14.2/src/addins/webdavsyncservice/webdavsyncservice.desktop.in gnote-3.16.0/src/addins/webdavsyncservice/webdavsyncservice.desktop.in --- gnote-3.14.2/src/addins/webdavsyncservice/webdavsyncservice.desktop.in 2015-01-17 15:38:25.000000000 +0000 +++ gnote-3.16.0/src/addins/webdavsyncservice/webdavsyncservice.desktop.in 2015-03-29 19:57:01.000000000 +0000 @@ -7,5 +7,5 @@ Version=0.2 DefaultEnabled=true Module=webdavsyncservice -LibgnoteRelease=3.14 -LibgnoteVersionInfo=0:1:0 +LibgnoteRelease=3.16 +LibgnoteVersionInfo=0:0:0 diff -Nru gnote-3.14.2/src/gnote.cpp gnote-3.16.0/src/gnote.cpp --- gnote-3.14.2/src/gnote.cpp 2015-01-17 12:55:44.000000000 +0000 +++ gnote-3.16.0/src/gnote.cpp 2015-03-07 18:13:28.000000000 +0000 @@ -56,10 +56,6 @@ #include "notebooks/notebookmanager.hpp" #include "synchronization/syncmanager.hpp" -#ifdef HAVE_X11_SUPPORT -#include "xkeybinder.hpp" -#endif - namespace gnote { @@ -69,19 +65,15 @@ , m_is_background(false) , m_is_shell_search(false) , m_prefsdlg(NULL) -#ifdef HAVE_X11_SUPPORT - , m_keybinder(NULL) -#endif { } Gnote::~Gnote() { - delete m_prefsdlg; + if (m_prefsdlg) { + delete m_prefsdlg; + } delete m_manager; -#ifdef HAVE_X11_SUPPORT - delete m_keybinder; -#endif } @@ -126,10 +118,6 @@ cmdline.parse(argc, argv); if(!m_manager) { common_init(); - Glib::RefPtr settings = Preferences::obj() - .get_schema_settings(Preferences::SCHEMA_GNOTE); - settings->signal_changed() - .connect(sigc::mem_fun(*this, &Gnote::on_setting_changed)); register_object(); } else if(cmdline.needs_execute()) { @@ -153,9 +141,6 @@ new Preferences; m_manager = new NoteManager(note_path); new notebooks::NotebookManager(default_note_manager()); -#ifdef HAVE_X11_SUPPORT - m_keybinder = new XKeybinder(); -#endif new ActionManager; sync::SyncManager::init(default_note_manager()); @@ -204,13 +189,7 @@ make_app_actions(); make_app_menu(); - Glib::RefPtr settings = Preferences::obj() - .get_schema_settings(Preferences::SCHEMA_GNOTE); - if(settings->get_boolean(Preferences::USE_STATUS_ICON)) { - DBG_OUT("starting tray icon"); - start_tray_icon(); - } - else if(is_background()) { + if(is_background()) { // do not exit when all windows are closed hold(); if(m_is_shell_search) { @@ -240,36 +219,6 @@ return note_path; } - bool Gnote::show_tray_icon_timeout() - { - // Setting to false and back to true is required to make it work on some tray implementations - m_tray_icon->set_visible(false); - m_tray_icon->set_visible(true); - return false; - } - - void Gnote::start_tray_icon() - { - // Create Search All Notes window as we need it present for application to run - get_main_window(); - - if(!m_tray_icon) { - // Create the tray icon and run the main loop -#ifdef HAVE_X11_SUPPORT - m_tray_icon = Glib::RefPtr(new TrayIcon(keybinder(), default_note_manager())); -#else - m_tray_icon = Glib::RefPtr(new TrayIcon(default_note_manager())); -#endif - m_tray = m_tray_icon->tray(); - } - - // Tome make status icon visible on some implementations, it should be made visible - // after some timeout. - Glib::RefPtr timeout = Glib::TimeoutSource::create(100); - timeout->connect(sigc::mem_fun(*this, &Gnote::show_tray_icon_timeout)); - timeout->attach(); - } - void Gnote::register_remote_control(NoteManager & manager, RemoteControlProxy::slot_name_acquire_finish on_finish) { @@ -285,26 +234,6 @@ } - void Gnote::on_setting_changed(const Glib::ustring & key) - { - if(key != Preferences::USE_STATUS_ICON) { - return; - } - - bool use_status_icon = Preferences::obj() - .get_schema_settings(Preferences::SCHEMA_GNOTE)->get_boolean(key); - if(use_status_icon) { - start_tray_icon(); - } - else { - if(m_tray_icon) { - m_tray_icon->set_visible(false); - } - ActionManager::obj()["ShowSearchAllNotesAction"]->activate(); - } - } - - void Gnote::setup_global_actions() { IActionManager & am(IActionManager::obj()); @@ -347,11 +276,6 @@ void Gnote::on_show_help_action(const Glib::VariantBase&) { GdkScreen *cscreen = NULL; - if(m_tray_icon) { - Gdk::Rectangle area; - GtkOrientation orientation; - gtk_status_icon_get_geometry(m_tray_icon->gobj(), &cscreen, area.gobj(), &orientation); - } utils::show_help("gnote", "", cscreen, NULL); } diff -Nru gnote-3.14.2/src/gnote.hpp gnote-3.16.0/src/gnote.hpp --- gnote-3.14.2/src/gnote.hpp 2015-01-17 12:53:20.000000000 +0000 +++ gnote-3.16.0/src/gnote.hpp 2015-03-07 18:13:28.000000000 +0000 @@ -1,7 +1,7 @@ /* * gnote * - * Copyright (C) 2010-2014 Aurimas Cernius + * Copyright (C) 2010-2015 Aurimas Cernius * Copyright (C) 2009 Hubert Figuiere * * This program is free software: you can redistribute it and/or modify @@ -35,13 +35,8 @@ #include "actionmanager.hpp" #include "ignote.hpp" #include "remotecontrolproxy.hpp" -#include "tray.hpp" #include "synchronization/syncdialog.hpp" -#ifdef HAVE_X11_SUPPORT -#include "keybinder.hpp" -#endif - namespace gnote { class PreferencesDialog; @@ -122,15 +117,8 @@ { return *m_manager; } -#ifdef HAVE_X11_SUPPORT - IKeybinder & keybinder() - { - return *m_keybinder; - } -#endif void setup_global_actions(); - void start_tray_icon(); void on_quit_gnote_action(const Glib::VariantBase&); void on_preferences_response(int res); @@ -143,21 +131,13 @@ virtual void open_search_all() override; void open_note_sync_window(const Glib::VariantBase&); - bool tray_icon_showing() - { - return m_tray_icon && m_tray_icon->is_embedded() && m_tray_icon->get_visible(); - } bool is_background() const { return m_is_background || m_is_shell_search; } bool windowed() { - return !tray_icon_showing() && !is_background(); - } - void set_tray(const Tray::Ptr & tray) - { - m_tray = tray; + return !is_background(); } static void register_remote_control(NoteManager & manager, RemoteControlProxy::slot_name_acquire_finish on_finish); virtual void open_note(const Note::Ptr & note) override; @@ -167,7 +147,6 @@ private: Gnote(); std::string get_note_path(const std::string & override_path); - void on_setting_changed(const Glib::ustring & key); void common_init(); void end_main(bool bus_aquired, bool name_acquired); void on_sync_dialog_response(int response_id); @@ -178,21 +157,15 @@ void on_new_window_action(const Glib::VariantBase&); void on_new_note_app_action(const Glib::VariantBase&); MainWindow *get_active_window(); - bool show_tray_icon_timeout(); void register_object(); NoteManager *m_manager; Glib::RefPtr m_icon_theme; - Glib::RefPtr m_tray_icon; - Tray::Ptr m_tray; bool m_is_background; bool m_is_shell_search; PreferencesDialog *m_prefsdlg; GnoteCommandLine cmd_line; sync::SyncDialog::Ptr m_sync_dlg; -#ifdef HAVE_X11_SUPPORT - IKeybinder *m_keybinder; -#endif }; diff -Nru gnote-3.14.2/src/iactionmanager.hpp gnote-3.16.0/src/iactionmanager.hpp --- gnote-3.14.2/src/iactionmanager.hpp 2014-03-25 21:29:20.000000000 +0000 +++ gnote-3.16.0/src/iactionmanager.hpp 2015-03-07 18:13:28.000000000 +0000 @@ -1,7 +1,7 @@ /* * gnote * - * Copyright (C) 2013 Aurimas Cernius + * Copyright (C) 2013,2015 Aurimas Cernius * * This program is free software: you can redistribute it and/or modify * it under the terms of the GNU General Public License as published by @@ -30,6 +30,7 @@ namespace gnote { enum NoteActionOrder { + NOTEBOOK_ORDER = 50, BACKLINKS_ORDER = 100, EXPORT_TO_HTML_ORDER = 200, EXPORT_TO_GTG_ORDER = 250, diff -Nru gnote-3.14.2/src/keybinder.hpp gnote-3.16.0/src/keybinder.hpp --- gnote-3.14.2/src/keybinder.hpp 2015-01-17 12:53:20.000000000 +0000 +++ gnote-3.16.0/src/keybinder.hpp 1970-01-01 00:00:00.000000000 +0000 @@ -1,51 +0,0 @@ -/* - * gnote - * - * Copyright (C) 2009 Hubert Figuiere - * - * This program is free software: you can redistribute it and/or modify - * it under the terms of the GNU General Public License as published by - * the Free Software Foundation, either version 3 of the License, or - * (at your option) any later version. - * - * This program is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU General Public License for more details. - * - * You should have received a copy of the GNU General Public License - * along with this program. If not, see . - */ - - - - - -#ifndef __KEYBINDER_HPP_ -#define __KEYBINDER_HPP_ - -#include - -#include -#include - - -namespace gnote { - - -class IKeybinder -{ -public: - virtual ~IKeybinder(){} - virtual void bind(const std::string & keystring, const sigc::slot & handler) = 0; - virtual void unbind(const std::string & keystring) = 0; - virtual void unbind_all() = 0; - virtual bool get_accel_keys(const std::string & prefs_path, guint & keyval, - Gdk::ModifierType & mods) = 0; -}; - - -} - - -#endif diff -Nru gnote-3.14.2/src/Makefile.am gnote-3.16.0/src/Makefile.am --- gnote-3.14.2/src/Makefile.am 2015-01-17 12:53:20.000000000 +0000 +++ gnote-3.16.0/src/Makefile.am 2015-03-07 18:13:28.000000000 +0000 @@ -84,12 +84,6 @@ dbus/searchprovider.hpp dbus/searchprovider.cpp \ $(NULL) -if HAVE_X11_SUPPORT -KEYBINDER_SOURCES=keybinder.hpp \ - prefskeybinder.hpp prefskeybinder.cpp \ - xkeybinder.hpp xkeybinder.cpp -endif - libgnote_la_LDFLAGS = -release @LIBGNOTE_RELEASE@ -version-info @LIBGNOTE_VERSION_INFO@ libgnote_la_LIBADD = $(LIBGNOTE_LIBS) libgnote_la_SOURCES = \ @@ -180,14 +174,12 @@ recentchanges.hpp recentchanges.cpp \ searchnoteswidget.hpp searchnoteswidget.cpp \ tagmanager.hpp tagmanager.cpp \ - tray.hpp tray.cpp \ notebooks/notebookstreeview.hpp notebooks/notebookstreeview.cpp \ synchronization/gnotesyncclient.hpp synchronization/gnotesyncclient.cpp \ synchronization/silentui.hpp synchronization/silentui.cpp \ synchronization/syncdialog.hpp synchronization/syncdialog.cpp \ synchronization/syncmanager.hpp synchronization/syncmanager.cpp \ $(DBUS_SOURCES) \ - $(KEYBINDER_SOURCES) \ main.cpp \ $(NULL) diff -Nru gnote-3.14.2/src/Makefile.in gnote-3.16.0/src/Makefile.in --- gnote-3.14.2/src/Makefile.in 2015-01-17 15:38:02.000000000 +0000 +++ gnote-3.16.0/src/Makefile.in 2015-03-29 19:56:40.000000000 +0000 @@ -173,41 +173,17 @@ am_filestest_OBJECTS = filestest.$(OBJEXT) filestest_OBJECTS = $(am_filestest_OBJECTS) filestest_DEPENDENCIES = libgnote.la -am__gnote_SOURCES_DIST = sharp/addinstreemodel.hpp \ - sharp/addinstreemodel.cpp actionmanager.hpp actionmanager.cpp \ - gnote.cpp gnote.hpp preferencesdialog.hpp \ - preferencesdialog.cpp recentchanges.hpp recentchanges.cpp \ - searchnoteswidget.hpp searchnoteswidget.cpp tagmanager.hpp \ - tagmanager.cpp tray.hpp tray.cpp \ - notebooks/notebookstreeview.hpp \ - notebooks/notebookstreeview.cpp \ - synchronization/gnotesyncclient.hpp \ - synchronization/gnotesyncclient.cpp \ - synchronization/silentui.hpp synchronization/silentui.cpp \ - synchronization/syncdialog.hpp synchronization/syncdialog.cpp \ - synchronization/syncmanager.hpp \ - synchronization/syncmanager.cpp remotecontrolproxy.hpp \ - remotecontrolproxy.cpp dbus/remotecontrol.hpp \ - dbus/remotecontrol.cpp dbus/remotecontrolclient.hpp \ - dbus/remotecontrolclient.cpp dbus/iremotecontrol.hpp \ - dbus/remotecontrol-client-glue.hpp \ - dbus/remotecontrol-client-glue.cpp dbus/remotecontrol-glue.hpp \ - dbus/remotecontrol-glue.cpp dbus/searchprovider.hpp \ - dbus/searchprovider.cpp keybinder.hpp prefskeybinder.hpp \ - prefskeybinder.cpp xkeybinder.hpp xkeybinder.cpp main.cpp am__objects_1 = remotecontrolproxy.$(OBJEXT) remotecontrol.$(OBJEXT) \ remotecontrolclient.$(OBJEXT) \ remotecontrol-client-glue.$(OBJEXT) \ remotecontrol-glue.$(OBJEXT) searchprovider.$(OBJEXT) -@HAVE_X11_SUPPORT_TRUE@am__objects_2 = prefskeybinder.$(OBJEXT) \ -@HAVE_X11_SUPPORT_TRUE@ xkeybinder.$(OBJEXT) am_gnote_OBJECTS = addinstreemodel.$(OBJEXT) actionmanager.$(OBJEXT) \ gnote.$(OBJEXT) preferencesdialog.$(OBJEXT) \ recentchanges.$(OBJEXT) searchnoteswidget.$(OBJEXT) \ - tagmanager.$(OBJEXT) tray.$(OBJEXT) \ - notebookstreeview.$(OBJEXT) gnotesyncclient.$(OBJEXT) \ - silentui.$(OBJEXT) syncdialog.$(OBJEXT) syncmanager.$(OBJEXT) \ - $(am__objects_1) $(am__objects_2) main.$(OBJEXT) + tagmanager.$(OBJEXT) notebookstreeview.$(OBJEXT) \ + gnotesyncclient.$(OBJEXT) silentui.$(OBJEXT) \ + syncdialog.$(OBJEXT) syncmanager.$(OBJEXT) $(am__objects_1) \ + main.$(OBJEXT) gnote_OBJECTS = $(am_gnote_OBJECTS) am__DEPENDENCIES_2 = libgnote.la $(am__DEPENDENCIES_1) gnote_DEPENDENCIES = $(am__DEPENDENCIES_2) @@ -295,11 +271,10 @@ $(notetest_SOURCES) $(stringtest_SOURCES) $(trietest_SOURCES) \ $(uritest_SOURCES) $(xmlreadertest_SOURCES) DIST_SOURCES = $(libgnote_la_SOURCES) $(dttest_SOURCES) \ - $(fileinfotest_SOURCES) $(filestest_SOURCES) \ - $(am__gnote_SOURCES_DIST) $(gnotesyncclienttest_SOURCES) \ - $(notemanagertest_SOURCES) $(notetest_SOURCES) \ - $(stringtest_SOURCES) $(trietest_SOURCES) $(uritest_SOURCES) \ - $(xmlreadertest_SOURCES) + $(fileinfotest_SOURCES) $(filestest_SOURCES) $(gnote_SOURCES) \ + $(gnotesyncclienttest_SOURCES) $(notemanagertest_SOURCES) \ + $(notetest_SOURCES) $(stringtest_SOURCES) $(trietest_SOURCES) \ + $(uritest_SOURCES) $(xmlreadertest_SOURCES) RECURSIVE_TARGETS = all-recursive check-recursive cscopelist-recursive \ ctags-recursive dvi-recursive html-recursive info-recursive \ install-data-recursive install-dvi-recursive \ @@ -797,10 +772,6 @@ dbus/searchprovider.hpp dbus/searchprovider.cpp \ $(NULL) -@HAVE_X11_SUPPORT_TRUE@KEYBINDER_SOURCES = keybinder.hpp \ -@HAVE_X11_SUPPORT_TRUE@ prefskeybinder.hpp prefskeybinder.cpp \ -@HAVE_X11_SUPPORT_TRUE@ xkeybinder.hpp xkeybinder.cpp - libgnote_la_LDFLAGS = -release @LIBGNOTE_RELEASE@ -version-info @LIBGNOTE_VERSION_INFO@ libgnote_la_LIBADD = $(LIBGNOTE_LIBS) libgnote_la_SOURCES = \ @@ -890,14 +861,12 @@ recentchanges.hpp recentchanges.cpp \ searchnoteswidget.hpp searchnoteswidget.cpp \ tagmanager.hpp tagmanager.cpp \ - tray.hpp tray.cpp \ notebooks/notebookstreeview.hpp notebooks/notebookstreeview.cpp \ synchronization/gnotesyncclient.hpp synchronization/gnotesyncclient.cpp \ synchronization/silentui.hpp synchronization/silentui.cpp \ synchronization/syncdialog.hpp synchronization/syncdialog.cpp \ synchronization/syncmanager.hpp synchronization/syncmanager.cpp \ $(DBUS_SOURCES) \ - $(KEYBINDER_SOURCES) \ main.cpp \ $(NULL) @@ -1142,7 +1111,6 @@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/notewindow.Plo@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/preferences.Plo@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/preferencesdialog.Po@am__quote@ -@AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/prefskeybinder.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/process.Plo@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/propertyeditor.Plo@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/recentchanges.Po@am__quote@ @@ -1173,14 +1141,12 @@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/testsyncclient.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/testtagmanager.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/timespan.Plo@am__quote@ -@AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/tray.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/trietest.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/undo.Plo@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/uri.Plo@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/uritest.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/utils.Plo@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/watchers.Plo@am__quote@ -@AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/xkeybinder.Po@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/xml.Plo@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/xmlconvert.Plo@am__quote@ @AMDEP_TRUE@@am__include@ @am__quote@./$(DEPDIR)/xmlreader.Plo@am__quote@ diff -Nru gnote-3.14.2/src/notebooks/notebookmenuitem.cpp gnote-3.16.0/src/notebooks/notebookmenuitem.cpp --- gnote-3.14.2/src/notebooks/notebookmenuitem.cpp 2013-03-24 14:39:02.000000000 +0000 +++ gnote-3.16.0/src/notebooks/notebookmenuitem.cpp 2015-03-07 18:13:28.000000000 +0000 @@ -1,7 +1,7 @@ /* * gnote * - * Copyright (C) 2010,2013 Aurimas Cernius + * Copyright (C) 2010,2013,2015 Aurimas Cernius * Copyright (C) 2009 Hubert Figuiere * * This program is free software: you can redistribute it and/or modify @@ -30,9 +30,8 @@ namespace gnote { namespace notebooks { - NotebookMenuItem::NotebookMenuItem(Gtk::RadioButtonGroup & group, - const Note::Ptr & note, const Notebook::Ptr & notebook) - : Gtk::RadioMenuItem(group, notebook ? notebook->get_name() : _("No notebook")) + NotebookMenuItem::NotebookMenuItem(const Note::Ptr & note, const Notebook::Ptr & notebook) + : Gtk::CheckMenuItem(notebook ? notebook->get_name() : _("No notebook")) , m_note(note) , m_notebook(notebook) { diff -Nru gnote-3.14.2/src/notebooks/notebookmenuitem.hpp gnote-3.16.0/src/notebooks/notebookmenuitem.hpp --- gnote-3.14.2/src/notebooks/notebookmenuitem.hpp 2012-01-31 20:48:23.000000000 +0000 +++ gnote-3.16.0/src/notebooks/notebookmenuitem.hpp 2015-03-07 18:13:28.000000000 +0000 @@ -1,6 +1,7 @@ /* * gnote * + * Copyright (C) 2015 Aurimas Cernius * Copyright (C) 2009 Hubert Figuiere * * This program is free software: you can redistribute it and/or modify @@ -23,7 +24,7 @@ #ifndef __NOTEBOOK_MENUITEM_HPP__ #define __NOTEBOOK_MENUITEM_HPP__ -#include +#include #include "note.hpp" #include "notebooks/notebook.hpp" @@ -33,10 +34,10 @@ namespace notebooks { class NotebookMenuItem - : public Gtk::RadioMenuItem + : public Gtk::CheckMenuItem { public: - NotebookMenuItem(Gtk::RadioButtonGroup & group, const Note::Ptr &, const Notebook::Ptr &); + NotebookMenuItem(const Note::Ptr &, const Notebook::Ptr &); const Note::Ptr & get_note() const { diff -Nru gnote-3.14.2/src/notebooks/notebooknoteaddin.cpp gnote-3.16.0/src/notebooks/notebooknoteaddin.cpp --- gnote-3.14.2/src/notebooks/notebooknoteaddin.cpp 2014-04-15 20:17:30.000000000 +0000 +++ gnote-3.16.0/src/notebooks/notebooknoteaddin.cpp 2015-03-07 18:13:28.000000000 +0000 @@ -1,7 +1,7 @@ /* * gnote * - * Copyright (C) 2010-2014 Aurimas Cernius + * Copyright (C) 2010-2015 Aurimas Cernius * Copyright (C) 2009 Hubert Figuiere * * This program is free software: you can redistribute it and/or modify @@ -27,11 +27,67 @@ #include "notebooks/notebooknoteaddin.hpp" #include "notebooks/notebookmanager.hpp" #include "debug.hpp" +#include "iactionmanager.hpp" #include "iconmanager.hpp" #include "tag.hpp" #include "itagmanager.hpp" #include "notewindow.hpp" -#include "utils.hpp" + + +namespace { + +class NotebookNoteAction + : public Gtk::Action +{ +public: + static Glib::RefPtr create(const sigc::slot & slot) + { + return Glib::RefPtr(new NotebookNoteAction(slot)); + } + virtual Gtk::Widget *create_menu_item_vfunc() override + { + m_submenu_built = false; + Gtk::MenuItem *menu_item = new Gtk::ImageMenuItem; + m_menu = manage(new Gtk::Menu); + m_menu->signal_hide().connect( + sigc::mem_fun(*this, &NotebookNoteAction::on_menu_hidden)); + menu_item->set_submenu(*m_menu); + return menu_item; + } +protected: + virtual void on_activate() override + { + Gtk::Action::on_activate(); + if(m_submenu_built) { + return; + } + update_menu(); + } +private: + explicit NotebookNoteAction(const sigc::slot & slot) + : m_submenu_built(false) + , m_update_menu_slot(slot) + { + set_name("NotebookAction"); + set_label(_("Notebook")); + set_tooltip(_("Place this note into a notebook")); + } + void on_menu_hidden() + { + m_submenu_built = false; + } + void update_menu() + { + m_update_menu_slot(m_menu); + m_submenu_built = true; + } + + Gtk::Menu *m_menu; + bool m_submenu_built; + sigc::slot m_update_menu_slot; +}; + +} namespace gnote { namespace notebooks { @@ -48,8 +104,6 @@ NotebookNoteAddin::NotebookNoteAddin() - : m_toolButton(NULL) - , m_menu(NULL) { } @@ -64,112 +118,21 @@ { } - void NotebookNoteAddin::initialize_tool_button() - { - gint icon_size = 16; - gtk_icon_size_lookup(GTK_ICON_SIZE_SMALL_TOOLBAR, &icon_size, NULL); - - Gtk::Grid *grid = manage(new Gtk::Grid); - grid->attach(*manage(new Gtk::Image( - IconManager::obj().get_icon(IconManager::NOTEBOOK, icon_size))), - 0, 0, 1, 1); - m_label_widget = manage(new Gtk::Label); - m_label_widget->set_vexpand(true); - m_label_widget->set_valign(Gtk::ALIGN_CENTER); - grid->attach(*m_label_widget, 1, 0, 1, 1); - m_toolButton = Gtk::manage(new gnote::utils::ToolMenuButton(*grid, m_menu)); - m_toolButton->set_tooltip_text(_("Place this note into a notebook")); - - m_show_menu_cid = m_menu->signal_show() - .connect(sigc::mem_fun(*this, &NotebookNoteAddin::on_menu_shown)); - m_toolButton->show_all(); - add_tool_item(m_toolButton, 0); - update_notebook_button_label(); - - m_note_added_cid = NotebookManager::obj().signal_note_added_to_notebook() - .connect(sigc::mem_fun(*this, &NotebookNoteAddin::on_note_added_to_notebook)); - m_note_removed_cid = NotebookManager::obj().signal_note_removed_from_notebook() - .connect(sigc::mem_fun(*this, &NotebookNoteAddin::on_note_removed_from_notebook)); - - get_note()->signal_tag_added - .connect(sigc::mem_fun(*this, &NotebookNoteAddin::on_note_tag_added)); - - // TODO: Make sure this is handled in NotebookNoteAddin, too - get_note()->signal_tag_removed - .connect(sigc::mem_fun(*this, &NotebookNoteAddin::on_note_tag_removed)); - } - - - void NotebookNoteAddin::on_note_tag_added(const NoteBase & note, const Tag::Ptr & tag) - { - Note::Ptr taggedNote = static_pointer_cast(const_cast(note).shared_from_this()); - if(taggedNote == get_note() && tag == get_template_tag()) { - update_button_sensitivity(true); - } - } - - - void NotebookNoteAddin::on_note_tag_removed(const NoteBase::Ptr & taggedNote, const std::string & tag) - { - if(taggedNote == get_note() && tag == get_template_tag()->normalized_name()) { - update_button_sensitivity(false); - } - } - void NotebookNoteAddin::shutdown () { - if(m_toolButton) { - m_show_menu_cid.disconnect(); - m_note_added_cid.disconnect(); - m_note_removed_cid.disconnect(); - } } - void NotebookNoteAddin::on_note_opened () - { - if(!m_menu) { - m_menu = manage(new Gtk::Menu()); - m_menu->show_all(); - } - if(!m_toolButton) { - initialize_tool_button(); - update_button_sensitivity(get_note()->contains_tag(get_template_tag())); - } - } - - void NotebookNoteAddin::update_button_sensitivity(bool isTemplate) - { - if(m_toolButton) { - m_toolButton->set_sensitive(!isTemplate); - } - } - - - void NotebookNoteAddin::on_menu_shown() + void NotebookNoteAddin::on_note_opened() { - update_menu(); - } - - void NotebookNoteAddin::on_note_added_to_notebook(const Note & note, - const Notebook::Ptr & notebook) - { - if(¬e == get_note().get()) { - update_notebook_button_label(notebook); + if(!get_note()->contains_tag(get_template_tag())) { + add_note_action(NotebookNoteAction::create(sigc::mem_fun(*this, &NotebookNoteAddin::update_menu)), + gnote::NOTEBOOK_ORDER); } } - void NotebookNoteAddin::on_note_removed_from_notebook(const Note & note, - const Notebook::Ptr &) - { - if(¬e == get_note().get()) { - update_notebook_button_label(); - } - } - - void NotebookNoteAddin::on_new_notebook_menu_item() { Note::List noteList; @@ -179,72 +142,40 @@ } - void NotebookNoteAddin::update_notebook_button_label() - { - Notebook::Ptr currentNotebook = NotebookManager::obj().get_notebook_from_note(get_note()); - update_notebook_button_label(currentNotebook); - } - - - void NotebookNoteAddin::update_notebook_button_label(const Notebook::Ptr & notebook) + void NotebookNoteAddin::update_menu(Gtk::Menu *menu) { - std::string labelText = (notebook ? notebook->get_name() : _("Notebook")); - - m_label_widget->set_text(labelText); - m_toolButton->show_all(); - } + // Clear the old items + FOREACH(Gtk::Widget *menu_item, menu->get_children()) { + menu->remove(*menu_item); + } - void NotebookNoteAddin::update_menu() - { - // - // Clear out the old list - // - for(std::list::const_iterator iter = m_menu_items.begin(); - iter != m_menu_items.end(); ++iter) { - m_menu->remove (**iter); - } - m_menu_items.clear(); - - // - // Build a new menu - // - - // Add the "New Notebook..." - Gtk::ImageMenuItem *newNotebookMenuItem = - manage(new Gtk::ImageMenuItem (_("_New notebook..."), true)); - newNotebookMenuItem->set_image(*manage(new Gtk::Image( + // Add new notebook item + Gtk::ImageMenuItem *new_notebook_item = manage(new Gtk::ImageMenuItem(_("_New notebook..."), true)); + new_notebook_item->set_image(*manage(new Gtk::Image( IconManager::obj().get_icon(IconManager::NOTEBOOK_NEW, 16)))); - newNotebookMenuItem->signal_activate() - .connect(sigc::mem_fun(*this,&NotebookNoteAddin::on_new_notebook_menu_item)); - newNotebookMenuItem->show (); - m_menu->append (*newNotebookMenuItem); - m_menu_items.push_back(newNotebookMenuItem); - + new_notebook_item->signal_activate().connect(sigc::mem_fun(*this, &NotebookNoteAddin::on_new_notebook_menu_item)); + new_notebook_item->show(); + menu->append(*new_notebook_item); + // Add the "(no notebook)" item at the top of the list - NotebookMenuItem *noNotebookMenuItem = manage(new NotebookMenuItem (m_radio_group, - get_note(), Notebook::Ptr())); - noNotebookMenuItem->show_all (); - m_menu->append (*noNotebookMenuItem); - m_menu_items.push_back(noNotebookMenuItem); + NotebookMenuItem *no_notebook_item = manage(new NotebookMenuItem(get_note(), Notebook::Ptr())); + no_notebook_item->show_all(); + menu->append(*no_notebook_item); - NotebookMenuItem *active_menu_item = noNotebookMenuItem; + NotebookMenuItem *active_menu_item = no_notebook_item; Notebook::Ptr current_notebook = NotebookManager::obj().get_notebook_from_note(get_note()); // Add in all the real notebooks - std::list notebookMenuItems; - get_notebook_menu_items (notebookMenuItems); - if (!notebookMenuItems.empty()) { - Gtk::SeparatorMenuItem *separator = manage(new Gtk::SeparatorMenuItem ()); - separator->show_all (); - m_menu->append (*separator); - m_menu_items.push_back(separator); - - for(std::list::const_iterator iter = notebookMenuItems.begin(); - iter != notebookMenuItems.end(); ++iter) { - NotebookMenuItem* item = *iter; - item->show_all (); - m_menu->append (*item); - m_menu_items.push_back(item); + std::list notebook_menu_items; + get_notebook_menu_items(notebook_menu_items); + if(!notebook_menu_items.empty()) { + Gtk::SeparatorMenuItem *separator = manage(new Gtk::SeparatorMenuItem()); + separator->show_all(); + menu->append(*separator); + + FOREACH(NotebookMenuItem *item, notebook_menu_items) { + item->show_all(); + menu->append(*item); if(current_notebook == item->get_notebook()) active_menu_item = item; } @@ -265,9 +196,8 @@ for(iter = model->children().begin(); iter != model->children().end(); ++iter) { Notebook::Ptr notebook; iter->get_value(0, notebook); - NotebookMenuItem *item = manage(new NotebookMenuItem (m_radio_group, - get_note(), notebook)); - items.push_back (item); + NotebookMenuItem *item = manage(new NotebookMenuItem(get_note(), notebook)); + items.push_back(item); } } diff -Nru gnote-3.14.2/src/notebooks/notebooknoteaddin.hpp gnote-3.16.0/src/notebooks/notebooknoteaddin.hpp --- gnote-3.14.2/src/notebooks/notebooknoteaddin.hpp 2014-03-25 21:29:20.000000000 +0000 +++ gnote-3.16.0/src/notebooks/notebooknoteaddin.hpp 2015-03-07 18:13:28.000000000 +0000 @@ -1,7 +1,7 @@ /* * gnote * - * Copyright (C) 2011-2014 Aurimas Cernius + * Copyright (C) 2011-2015 Aurimas Cernius * Copyright (C) 2009 Hubert Figuiere * * This program is free software: you can redistribute it and/or modify @@ -29,10 +29,7 @@ #include "base/macros.hpp" #include "noteaddin.hpp" -#include "notebooks/notebook.hpp" #include "notebooks/notebookmenuitem.hpp" -#include "note.hpp" -#include "utils.hpp" namespace gnote { namespace notebooks { @@ -51,26 +48,9 @@ NotebookNoteAddin(); private: - void initialize_tool_button(); - void on_note_tag_added(const NoteBase &, const Tag::Ptr &); - void on_note_tag_removed(const NoteBase::Ptr &, const std::string &); - void update_button_sensitivity(bool); - void on_menu_shown(); - void on_note_added_to_notebook(const Note &, const Notebook::Ptr &); - void on_note_removed_from_notebook(const Note &, const Notebook::Ptr &); void on_new_notebook_menu_item(); - void update_notebook_button_label(); - void update_notebook_button_label(const Notebook::Ptr &); - void update_menu(); void get_notebook_menu_items(std::list &); - gnote::utils::ToolMenuButton *m_toolButton; - Gtk::Label *m_label_widget; - Gtk::Menu *m_menu; - std::list m_menu_items; - Gtk::RadioButtonGroup m_radio_group; - sigc::connection m_show_menu_cid; - sigc::connection m_note_added_cid; - sigc::connection m_note_removed_cid; + void update_menu(Gtk::Menu *); static Tag::Ptr s_templateTag; }; diff -Nru gnote-3.14.2/src/preferencesdialog.cpp gnote-3.16.0/src/preferencesdialog.cpp --- gnote-3.14.2/src/preferencesdialog.cpp 2015-01-17 12:53:20.000000000 +0000 +++ gnote-3.16.0/src/preferencesdialog.cpp 2015-03-07 18:13:28.000000000 +0000 @@ -1,7 +1,7 @@ /* * gnote * - * Copyright (C) 2010-2014 Aurimas Cernius + * Copyright (C) 2010-2015 Aurimas Cernius * Copyright (C) 2009 Debarshi Ray * Copyright (C) 2009 Hubert Figuiere * @@ -120,10 +120,6 @@ notebook->append_page (*manage(make_editing_pane()), _("General")); notebook->append_page(*manage(make_links_pane()), _("Links")); -#ifdef HAVE_X11_SUPPORT - notebook->append_page (*manage(make_hotkeys_pane()), - _("Hotkeys")); -#endif // } notebook->append_page(*manage(make_sync_pane()), _("Synchronization")); @@ -243,14 +239,6 @@ int options_list_row = 0; - // Status icon - check = manage(make_check_button(_("Use status _icon"))); - set_widget_tooltip(*check, _("Show icon in tray, which is the central place of control.")); - options_list->attach(*check, 0, options_list_row++, 1, 1); - peditor = new sharp::PropertyEditorBool(settings, Preferences::USE_STATUS_ICON, *check); - peditor->setup(); - - // Open in new window check = manage(make_check_button(_("Always _open notes in new window"))); options_list->attach(*check, 0, options_list_row++, 1, 1); @@ -417,116 +405,6 @@ return vbox; } - // List of Hotkey options - Gtk::Widget *PreferencesDialog::make_hotkeys_pane() - { - Gtk::Label* label; - Gtk::CheckButton* check; - Gtk::Alignment* align; - Gtk::Entry* entry; - sharp::PropertyEditorBool *keybind_peditor; - sharp::PropertyEditor *peditor; - Glib::RefPtr settings = Preferences::obj().get_schema_settings(Preferences::SCHEMA_GNOTE); - Glib::RefPtr keybindings_settings = Preferences::obj() - .get_schema_settings(Preferences::SCHEMA_KEYBINDINGS); - - Gtk::Grid* hotkeys_list = new Gtk::Grid; - hotkeys_list->set_border_width(12); - hotkeys_list->show (); - int hotkeys_list_row = 0; - - - // Hotkeys... - - check = manage(make_check_button (_("Listen for _hotkeys"))); - set_widget_tooltip(*check, _("Hotkeys allow you to quickly access " - "your notes from anywhere with a keypress. " - "Example Hotkeys: <Control><Shift>F11, " - "<Alt>N")); - hotkeys_list->attach(*check, 0, hotkeys_list_row++, 1, 1); - - keybind_peditor = new sharp::PropertyEditorBool(settings, Preferences::ENABLE_KEYBINDINGS, *check); - keybind_peditor->setup(); - - align = manage(new Gtk::Alignment (0.5f, 0.5f, 0.0f, 1.0f)); - align->show (); - hotkeys_list->attach(*align, 0, hotkeys_list_row++, 1, 1); - - Gtk::Table *table = manage(new Gtk::Table (4, 2, false)); - table->set_col_spacings(6); - table->set_row_spacings(6); - table->show (); - align->add(*table); - - - // Show notes menu keybinding... - - label = manage(make_label (_("Show notes _menu"))); - table->attach (*label, 0, 1, 0, 1); - - entry = manage(new Gtk::Entry ()); - label->set_mnemonic_widget(*entry); - entry->show (); - table->attach (*entry, 1, 2, 0, 1); - - peditor = new sharp::PropertyEditor(keybindings_settings, - Preferences::KEYBINDING_SHOW_NOTE_MENU, - *entry); - peditor->setup(); - keybind_peditor->add_guard (entry); - - - // Open Start Here keybinding... - - label = manage(make_label (_("Open \"_Start Here\""))); - table->attach (*label, 0, 1, 1, 2); - - entry = manage(new Gtk::Entry ()); - label->set_mnemonic_widget(*entry); - entry->show (); - table->attach (*entry, 1, 2, 1, 2); - - peditor = new sharp::PropertyEditor(keybindings_settings, - Preferences::KEYBINDING_OPEN_START_HERE, - *entry); - peditor->setup(); - keybind_peditor->add_guard (entry); - - // Create new note keybinding... - - label = manage(make_label (_("Create _new note"))); - table->attach (*label, 0, 1, 2, 3); - - entry = manage(new Gtk::Entry ()); - label->set_mnemonic_widget(*entry); - entry->show (); - table->attach (*entry, 1, 2, 2, 3); - - peditor = new sharp::PropertyEditor(keybindings_settings, - Preferences::KEYBINDING_CREATE_NEW_NOTE, - *entry); - peditor->setup(); - keybind_peditor->add_guard (entry); - - // Open Search window keybinding... - - label = manage(make_label (_("Open Search _Window"))); - table->attach (*label, 0, 1, 3, 4); - - entry = manage(new Gtk::Entry ()); - label->set_mnemonic_widget(*entry); - entry->show (); - table->attach(*entry, 1, 2, 3, 4); - - peditor = new sharp::PropertyEditor(keybindings_settings, - Preferences::KEYBINDING_OPEN_RECENT_CHANGES, - *entry); - peditor->setup(); - keybind_peditor->add_guard (entry); - - return hotkeys_list; - } - void PreferencesDialog::combo_box_text_data_func(const Gtk::TreeIter & iter) { diff -Nru gnote-3.14.2/src/preferencesdialog.hpp gnote-3.16.0/src/preferencesdialog.hpp --- gnote-3.14.2/src/preferencesdialog.hpp 2015-01-17 12:53:20.000000000 +0000 +++ gnote-3.16.0/src/preferencesdialog.hpp 2015-03-07 18:13:28.000000000 +0000 @@ -1,7 +1,7 @@ /* * gnote * - * Copyright (C) 2011-2013 Aurimas Cernius + * Copyright (C) 2011-2013,2015 Aurimas Cernius * Copyright (C) 2009 Hubert Figuiere * * This program is free software: you can redistribute it and/or modify @@ -50,7 +50,6 @@ Gtk::Widget *make_editing_pane(); Gtk::Widget *make_links_pane(); - Gtk::Widget *make_hotkeys_pane(); Gtk::Widget *make_sync_pane(); Gtk::Widget *make_addins_pane(); diff -Nru gnote-3.14.2/src/prefskeybinder.cpp gnote-3.16.0/src/prefskeybinder.cpp --- gnote-3.14.2/src/prefskeybinder.cpp 2015-01-17 12:53:20.000000000 +0000 +++ gnote-3.16.0/src/prefskeybinder.cpp 1970-01-01 00:00:00.000000000 +0000 @@ -1,245 +0,0 @@ -/* - * gnote - * - * Copyright (C) 2011-2014 Aurimas Cernius - * Copyright (C) 2009 Hubert Figuiere - * - * This program is free software: you can redistribute it and/or modify - * it under the terms of the GNU General Public License as published by - * the Free Software Foundation, either version 3 of the License, or - * (at your option) any later version. - * - * This program is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU General Public License for more details. - * - * You should have received a copy of the GNU General Public License - * along with this program. If not, see . - */ - - - -#include "debug.hpp" -#include "ignote.hpp" -#include "keybinder.hpp" -#include "note.hpp" -#include "notemanager.hpp" -#include "notewindow.hpp" -#include "preferences.hpp" -#include "prefskeybinder.hpp" -#include "tray.hpp" - - -#define KEYBINDING_SHOW_NOTE_MENU_DEFAULT "<Alt>F12" -#define KEYBINDING_OPEN_START_HERE_DEFAULT "<Alt>F11" -#define KEYBINDING_CREATE_NEW_NOTE_DEFAULT "disabled" -#define KEYBINDING_OPEN_SEARCH_DEFAULT "disabled" -#define KEYBINDING_OPEN_RECENT_CHANGES_DEFAULT "disabled" - - -namespace gnote { - - - class PrefsKeybinder::Binding - { - public: - Binding(const std::string & pref_path, const std::string & default_binding, - const sigc::slot & handler, IKeybinder & native_keybinder); - void set_binding(); - void unset_binding(); - private: - void on_binding_changed(const Glib::ustring & key); - - std::string m_pref_path; - std::string m_key_sequence; - sigc::slot m_handler; - IKeybinder & m_native_keybinder; - guint m_notify_cnx; - }; - - PrefsKeybinder::Binding::Binding(const std::string & pref_path, - const std::string & default_binding, - const sigc::slot & handler, - IKeybinder & native_keybinder) - : m_pref_path(pref_path) - , m_key_sequence(default_binding) - , m_handler(handler) - , m_native_keybinder(native_keybinder) - , m_notify_cnx(0) - { - Glib::RefPtr keybindings_settings = Preferences::obj() - .get_schema_settings(Preferences::SCHEMA_KEYBINDINGS); - m_key_sequence = keybindings_settings->get_string(pref_path); - set_binding(); - keybindings_settings->signal_changed() - .connect(sigc::mem_fun(*this, &PrefsKeybinder::Binding::on_binding_changed)); - } - - void PrefsKeybinder::Binding::on_binding_changed(const Glib::ustring & key) - { - if (key == m_pref_path) { - std::string value = Preferences::obj().get_schema_settings(Preferences::SCHEMA_KEYBINDINGS)->get_string(key); - DBG_OUT("Binding for '%s' changed to '%s'!", m_pref_path.c_str(), value.c_str()); - - unset_binding (); - - m_key_sequence = value; - set_binding (); - } - } - - - void PrefsKeybinder::Binding::set_binding() - { - if(m_key_sequence.empty() || (m_key_sequence == "disabled")) { - return; - } - DBG_OUT("Binding key '%s' for '%s'", - m_key_sequence.c_str(), m_pref_path.c_str()); - - m_native_keybinder.bind (m_key_sequence, m_handler); - } - - void PrefsKeybinder::Binding::unset_binding() - { - if(m_key_sequence.empty()) { - return; - } - DBG_OUT("Unbinding key '%s' for '%s'", - m_key_sequence.c_str(), m_pref_path.c_str()); - - m_native_keybinder.unbind (m_key_sequence); - } - - - PrefsKeybinder::PrefsKeybinder(IKeybinder & keybinder) - : m_native_keybinder(keybinder) - { - } - - - PrefsKeybinder::~PrefsKeybinder() - { - - } - - - void PrefsKeybinder::bind(const std::string & pref_path, const std::string & default_binding, - const sigc::slot & handler) - { - m_bindings.push_back(new Binding(pref_path, default_binding, - handler, m_native_keybinder)); - } - - void PrefsKeybinder::unbind_all() - { - for(std::list::const_iterator iter = m_bindings.begin(); - iter != m_bindings.end(); ++iter) { - delete *iter; - } - m_bindings.clear (); - m_native_keybinder.unbind_all (); - } - - - GnotePrefsKeybinder::GnotePrefsKeybinder(IKeybinder & keybinder, - NoteManager & manager, IGnoteTray & trayicon) - : PrefsKeybinder(keybinder) - , m_manager(manager) - , m_trayicon(trayicon) - { - Glib::RefPtr settings = Preferences::obj() - .get_schema_settings(Preferences::SCHEMA_GNOTE); - enable_disable(settings->get_boolean(Preferences::ENABLE_KEYBINDINGS)); - settings->signal_changed() - .connect(sigc::mem_fun(*this, &GnotePrefsKeybinder::enable_keybindings_changed)); - } - - - void GnotePrefsKeybinder::enable_keybindings_changed(const Glib::ustring & key) - { - if(key == Preferences::ENABLE_KEYBINDINGS) { - Glib::RefPtr settings = Preferences::obj() - .get_schema_settings(Preferences::SCHEMA_GNOTE); - - bool enabled = settings->get_boolean(key); - enable_disable(enabled); - } - } - - - void GnotePrefsKeybinder::enable_disable(bool enable) - { - DBG_OUT("EnableDisable Called: enabling... %s", enable ? "true" : "false"); - if(enable) { - bind(Preferences::KEYBINDING_SHOW_NOTE_MENU, KEYBINDING_SHOW_NOTE_MENU_DEFAULT, - sigc::mem_fun(*this, &GnotePrefsKeybinder::key_show_menu)); - - bind(Preferences::KEYBINDING_OPEN_START_HERE, KEYBINDING_OPEN_START_HERE_DEFAULT, - sigc::mem_fun(*this, &GnotePrefsKeybinder::key_openstart_here)); - - bind(Preferences::KEYBINDING_CREATE_NEW_NOTE, KEYBINDING_CREATE_NEW_NOTE_DEFAULT, - sigc::mem_fun(*this, &GnotePrefsKeybinder::key_create_new_note)); - - bind(Preferences::KEYBINDING_OPEN_SEARCH, KEYBINDING_OPEN_SEARCH_DEFAULT, - sigc::mem_fun(*this, &GnotePrefsKeybinder::key_open_search)); - - bind(Preferences::KEYBINDING_OPEN_RECENT_CHANGES, KEYBINDING_OPEN_RECENT_CHANGES_DEFAULT, - sigc::mem_fun(*this, &GnotePrefsKeybinder::key_open_recent_changes)); - } - else { - unbind_all(); - } - } - - - void GnotePrefsKeybinder::key_show_menu() - { - // Show the notes menu, highlighting the first item. - // This matches the behavior of GTK for - // accelerator-shown menus. - m_trayicon.show_menu (true); - } - - - void GnotePrefsKeybinder::key_openstart_here() - { - NoteBase::Ptr note = m_manager.find_by_uri(m_manager.start_note_uri()); - if (note) { - IGnote::obj().open_note(static_pointer_cast(note)); - } - } - - - void GnotePrefsKeybinder::key_create_new_note() - { - try { - Note::Ptr new_note = static_pointer_cast(m_manager.create()); - IGnote::obj().open_note(new_note); - } - catch (...) { - // Fail silently. - } - - } - - - void GnotePrefsKeybinder::key_open_search() - { - /* Find dialog is deprecated in favor of searcable ToC */ - /* - NoteFindDialog find_dialog = NoteFindDialog.GetInstance (manager); - find_dialog.Present (); - */ - key_open_recent_changes (); - } - - - void GnotePrefsKeybinder::key_open_recent_changes() - { - IGnote::obj().open_search_all(); - } - -} - diff -Nru gnote-3.14.2/src/prefskeybinder.hpp gnote-3.16.0/src/prefskeybinder.hpp --- gnote-3.14.2/src/prefskeybinder.hpp 2015-01-17 12:53:20.000000000 +0000 +++ gnote-3.16.0/src/prefskeybinder.hpp 1970-01-01 00:00:00.000000000 +0000 @@ -1,76 +0,0 @@ -/* - * gnote - * - * Copyright (C) 2011,2013 Aurimas Cernius - * Copyright (C) 2009 Hubert Figuiere - * - * This program is free software: you can redistribute it and/or modify - * it under the terms of the GNU General Public License as published by - * the Free Software Foundation, either version 3 of the License, or - * (at your option) any later version. - * - * This program is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU General Public License for more details. - * - * You should have received a copy of the GNU General Public License - * along with this program. If not, see . - */ - - - -#ifndef _PREFSKEYBINDER_HPP_ -#define _PREFSKEYBINDER_HPP_ - -#include -#include -#include - -#include "preferences.hpp" - -namespace gnote { - -class TrayIcon; -class NoteManager; -class IGnoteTray; -class IKeybinder; - - -class PrefsKeybinder : public sigc::trackable -{ -public: - PrefsKeybinder(IKeybinder &); - virtual ~PrefsKeybinder(); - void bind(const std::string & pref_path, const std::string & default_binding, - const sigc::slot & handler); - void unbind_all(); - -private: - class Binding; - - IKeybinder & m_native_keybinder; - std::list m_bindings; -}; - -class GnotePrefsKeybinder - : public PrefsKeybinder -{ -public: - GnotePrefsKeybinder(IKeybinder & keybinder, NoteManager & manager, IGnoteTray & trayicon); - void enable_keybindings_changed(const Glib::ustring & key); - void enable_disable(bool enable); -private: - void key_show_menu(); - void key_openstart_here(); - void key_create_new_note(); - void key_open_search(); - void key_open_recent_changes(); - NoteManager & m_manager; - IGnoteTray & m_trayicon; -}; - - -} - -#endif diff -Nru gnote-3.14.2/src/recentchanges.cpp gnote-3.16.0/src/recentchanges.cpp --- gnote-3.14.2/src/recentchanges.cpp 2014-12-21 21:44:59.000000000 +0000 +++ gnote-3.16.0/src/recentchanges.cpp 2015-03-07 18:13:28.000000000 +0000 @@ -1,7 +1,7 @@ /* * gnote * - * Copyright (C) 2010-2014 Aurimas Cernius + * Copyright (C) 2010-2015 Aurimas Cernius * Copyright (C) 2010 Debarshi Ray * Copyright (C) 2009 Hubert Figuiere * @@ -171,8 +171,8 @@ right_box->show(); m_header_bar.pack_start(*left_box); - m_header_bar.pack_end(m_embedded_toolbar); m_header_bar.pack_end(*right_box); + m_header_bar.pack_end(m_embedded_toolbar); m_header_bar.show(); } diff -Nru gnote-3.14.2/src/tray.cpp gnote-3.16.0/src/tray.cpp --- gnote-3.14.2/src/tray.cpp 2015-01-17 12:53:20.000000000 +0000 +++ gnote-3.16.0/src/tray.cpp 1970-01-01 00:00:00.000000000 +0000 @@ -1,593 +0,0 @@ -/* - * gnote - * - * Copyright (C) 2010-2014 Aurimas Cernius - * Copyright (C) 2009 Hubert Figuiere - * - * This program is free software: you can redistribute it and/or modify - * it under the terms of the GNU General Public License as published by - * the Free Software Foundation, either version 3 of the License, or - * (at your option) any later version. - * - * This program is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU General Public License for more details. - * - * You should have received a copy of the GNU General Public License - * along with this program. If not, see . - */ - -#ifdef HAVE_CONFIG_H -#include -#endif - -#include - -#include -#include -#include -#include -#include - - -#include "tray.hpp" -#include "debug.hpp" -#include "actionmanager.hpp" -#include "iconmanager.hpp" -#include "utils.hpp" -#include "ignote.hpp" -#include "note.hpp" -#include "notemanager.hpp" -#include "notewindow.hpp" -#include "prefskeybinder.hpp" -#include "tag.hpp" -#include "itagmanager.hpp" -#include "preferences.hpp" -#include "sharp/datetime.hpp" -#include "sharp/string.hpp" - -namespace gnote { - - std::string tray_util_get_tooltip_text() - { - std::string tip_text = _("Take notes"); - -#ifdef HAVE_X11_SUPPORT - if (Preferences::obj().get_schema_settings( - Preferences::SCHEMA_GNOTE)->get_boolean(Preferences::ENABLE_KEYBINDINGS)) { - std::string shortcut = KeybindingToAccel::get_shortcut(Preferences::KEYBINDING_SHOW_NOTE_MENU); - if (!shortcut.empty()) - tip_text += str(boost::format(" (%1%)") % shortcut); - } -#endif - - return tip_text; - } - - - - NoteMenuItem::NoteMenuItem(const Note::Ptr & note, bool show_pin) - : Gtk::ImageMenuItem(get_display_name(note)) - , m_note(note) - , m_pin_img(NULL) - , m_pinned(false) - , m_inhibit_activate(false) - { - set_image(*manage(new Gtk::Image(IconManager::obj().get_icon(IconManager::NOTE, 16)))); - if(show_pin) { - Gtk::Grid *box = manage(new Gtk::Grid); - Gtk::Widget *child = get_child(); - Gtk::Container::remove(*child); - child->set_hexpand(true); - box->attach(*child, 0, 0, 1, 1); - add(*box); - box->show(); - - m_pinned = note->is_pinned(); - m_pin_img = manage(new Gtk::Image(m_pinned ? get_pindown_icon() : get_pinup_icon())); - m_pin_img->show(); - box->attach(*m_pin_img, 1, 0, 1, 1); - } - } - - void NoteMenuItem::on_activate() - { - if(!m_inhibit_activate) { - if(m_note) { - MainWindow::present_in_new_window(m_note, - Preferences::obj().get_schema_settings(Preferences::SCHEMA_GNOTE)->get_boolean( - Preferences::ENABLE_CLOSE_NOTE_ON_ESCAPE)); - } - } - } - - bool NoteMenuItem::on_button_press_event(GdkEventButton *ev) - { - if (m_pin_img && (ev->x >= m_pin_img->get_allocation().get_x()) - && (ev->x < m_pin_img->get_allocation().get_x() - + m_pin_img->get_allocation().get_width())) { - m_pinned = !m_pinned; - m_note->set_pinned(m_pinned); - m_pin_img->set(m_pinned ? get_pindown_icon() : get_pinup_icon()); - m_inhibit_activate = true; - return true; - } - - return Gtk::ImageMenuItem::on_button_press_event(ev); - } - - - bool NoteMenuItem::on_button_release_event(GdkEventButton *ev) - { - if (m_inhibit_activate) { - m_inhibit_activate = false; - return true; - } - return Gtk::ImageMenuItem::on_button_release_event(ev); - } - - - bool NoteMenuItem::on_motion_notify_event(GdkEventMotion *ev) - { - if (!m_pinned && m_pin_img) { - if (ev->x >= m_pin_img->get_allocation().get_x() && - ev->x < m_pin_img->get_allocation().get_x() + m_pin_img->get_allocation().get_width()) { - Glib::RefPtr pin_active = IconManager::obj().get_icon(IconManager::PIN_ACTIVE, 16); - if (m_pin_img->get_pixbuf() != pin_active) { - m_pin_img->set(pin_active); - } - } - else { - Glib::RefPtr pinup = get_pinup_icon(); - if (m_pin_img->get_pixbuf() != pinup) { - m_pin_img->set(pinup); - } - } - } - - return Gtk::ImageMenuItem::on_motion_notify_event(ev); - } - - - bool NoteMenuItem::on_leave_notify_event(GdkEventCrossing *ev) - { - if (!m_pinned && m_pin_img) { - m_pin_img->set(get_pinup_icon()); - } - return Gtk::ImageMenuItem::on_leave_notify_event(ev); - } - - std::string NoteMenuItem::get_display_name(const Note::Ptr & note) - { - std::string display_name = note->get_title(); - int max_length = 100; - - if (note->is_new()) { - std::string new_string = _(" (new)"); - max_length -= new_string.size(); - display_name = ellipsify (display_name, max_length) + new_string; - } - else { - display_name = ellipsify (display_name, max_length); - } - - return display_name; - } - - std::string NoteMenuItem::ellipsify (const std::string & str, size_t max) - { - if(str.size() > max) { - std::string new_str = str; - new_str.resize(max); - return new_str + "..."; - } - return str; - } - - - - Glib::RefPtr NoteMenuItem::get_pinup_icon() - { - return IconManager::obj().get_icon(IconManager::PIN_UP, 16); - } - - Glib::RefPtr NoteMenuItem::get_pindown_icon() - { - return IconManager::obj().get_icon(IconManager::PIN_DOWN, 16); - } - -#ifdef HAVE_X11_SUPPORT - Tray::Tray(NoteManager & manager, IGnoteTray & trayicon, IKeybinder & keybinder) - : m_manager(manager) - , m_trayicon(trayicon) - , m_menu_added(false) - , m_keybinder(keybinder) - { - m_tray_menu = make_tray_notes_menu(); - } -#else - Tray::Tray(NoteManager & manager, IGnoteTray & trayicon) - : m_manager(manager) - , m_trayicon(trayicon) - , m_menu_added(false) - { - m_tray_menu = make_tray_notes_menu(); - } -#endif - - Gtk::Menu * Tray::make_tray_notes_menu() - { - Gtk::Menu *menu = manage(new Gtk::Menu); - - m_new_note_item = manage(new Gtk::ImageMenuItem); - m_new_note_item->set_image(*manage(new Gtk::Image(Gtk::Stock::NEW, Gtk::ICON_SIZE_MENU))); - m_new_note_item->set_label(_("Create _New Note")); - m_new_note_item->set_use_underline(true); - m_new_note_item->set_tooltip_text(_("Create a new note")); - m_new_note_item->show(); - m_new_note_item->signal_activate() - .connect(sigc::mem_fun(*this, &Tray::on_new_note_activate)); - menu->insert(*m_new_note_item, -1); - m_search_notes_item = manage(new Gtk::ImageMenuItem); - m_search_notes_item->set_image(*manage(new Gtk::Image(Gtk::Stock::FIND, Gtk::ICON_SIZE_MENU))); - m_search_notes_item->set_label(_("_Search All Notes")); - m_search_notes_item->set_use_underline(true); - m_search_notes_item->set_tooltip_text(_("Open the Search All Notes window")); - m_search_notes_item->show(); - m_search_notes_item->signal_activate() - .connect(sigc::mem_fun(*this, &Tray::on_search_notes_activate)); - menu->insert(*m_search_notes_item, -1); - -#ifdef HAVE_X11_SUPPORT - bool enable_keybindings = Preferences::obj().get_schema_settings( - Preferences::SCHEMA_GNOTE)->get_boolean(Preferences::ENABLE_KEYBINDINGS); - if (enable_keybindings) { - KeybindingToAccel::add_accelerator(m_keybinder, *m_new_note_item, Preferences::KEYBINDING_CREATE_NEW_NOTE); - KeybindingToAccel::add_accelerator(m_keybinder, *m_search_notes_item, Preferences::KEYBINDING_OPEN_RECENT_CHANGES); - } -#endif - - return menu; - } - - void Tray::update_tray_menu(Gtk::Widget * parent) - { - if (!m_menu_added) { - if (parent) -// Can't call the Gtkmm version as it is protected. -// m_tray_menu->attach_to_widget(*parent); - gtk_menu_attach_to_widget(m_tray_menu->gobj(), parent->gobj(), NULL); - m_menu_added = true; - } - - add_recently_changed_notes(); - - m_tray_menu->show_all(); - } - - void Tray::add_recently_changed_notes() - { - int min_size = Preferences::obj().get_schema_settings( - Preferences::SCHEMA_GNOTE)->get_int(Preferences::MENU_NOTE_COUNT); - int max_size = 18; - int list_size = 0; - NoteMenuItem *item; - - std::vector old_items = m_tray_menu->get_children(); - for(std::vector::iterator iter = old_items.begin(); - iter != old_items.end(); ++iter) { - m_tray_menu->remove(**iter); - } - - sharp::DateTime days_ago(sharp::DateTime::now()); - days_ago.add_days(-3); - - // Prevent template notes from appearing in the menu - Tag::Ptr template_tag = ITagManager::obj() - .get_or_create_system_tag(ITagManager::TEMPLATE_NOTE_SYSTEM_TAG); - - // List the most recently changed notes, any currently - // opened notes, and any pinned notes... - FOREACH(const NoteBase::Ptr & iter, m_manager.get_notes()) { - Note::Ptr note(static_pointer_cast(iter)); - - if (note->is_special()) { - DBG_OUT("skipping special note '%s'", note->get_title().c_str()); - continue; - } - - // Skip template notes - if (note->contains_tag (template_tag)) { - DBG_OUT("skipping template '%s'", note->get_title().c_str()); - continue; - } - - bool show = false; - - // Test for note.IsPinned first so that all of the pinned notes - // are guaranteed to be included regardless of the size of the - // list. - if (note->is_pinned()) { - show = true; - } - else if ((note->is_opened() && note->get_window()->host()) || - (note->change_date().is_valid() && (note->change_date() > days_ago)) || - (list_size < min_size)) { - if (list_size <= max_size) - show = true; - } - - if (show) { - item = Gtk::manage(new NoteMenuItem (note, true)); - m_tray_menu->insert(*item, -1); - list_size++; - } - } - - NoteBase::Ptr start = m_manager.find_by_uri(m_manager.start_note_uri()); - if (start) { - item = Gtk::manage(new NoteMenuItem(static_pointer_cast(start), false)); - m_tray_menu->insert(*item, -1); - list_size++; - -#ifdef HAVE_X11_SUPPORT - bool enable_keybindings = Preferences::obj().get_schema_settings( - Preferences::SCHEMA_GNOTE)->get_boolean(Preferences::ENABLE_KEYBINDINGS); - if (enable_keybindings) { - KeybindingToAccel::add_accelerator(m_keybinder, *item, Preferences::KEYBINDING_OPEN_START_HERE); - } -#endif - } - - bool menuOpensUpward = m_trayicon.menu_opens_upward(); - ActionManager & am(static_cast(IActionManager::obj())); - int insertion_point = 0; // If menu opens downward - if(menuOpensUpward) { - insertion_point = -1; - } - - Gtk::SeparatorMenuItem *separator = manage(new Gtk::SeparatorMenuItem()); - m_tray_menu->insert(*separator, insertion_point); - m_tray_menu->insert(*m_search_notes_item, insertion_point); - std::vector items = am.get_tray_menu_items(); - for(std::vector::iterator iter = items.begin(); iter != items.end(); ++iter) { - m_tray_menu->insert(**iter, insertion_point); - } - m_tray_menu->insert(*m_new_note_item, insertion_point); - } - - void Tray::on_new_note_activate() - { - MainWindow &win = IGnote::obj().new_main_window(); - win.new_note(); - win.present(); - win.close_on_escape(Preferences::obj().get_schema_settings( - Preferences::SCHEMA_GNOTE)->get_boolean(Preferences::ENABLE_CLOSE_NOTE_ON_ESCAPE)); - } - - void Tray::on_search_notes_activate() - { - IGnote::obj().new_main_window().present(); - } - - -#ifdef HAVE_X11_SUPPORT - TrayIcon::TrayIcon(IKeybinder & keybinder, NoteManager & manager) - : Gtk::StatusIcon() - , m_tray(new Tray(manager, *this, keybinder)) - , m_context_menu(NULL) - , m_keybinder(new GnotePrefsKeybinder(keybinder, manager, *this)) -#else - TrayIcon::TrayIcon(NoteManager & manager) - : Gtk::StatusIcon() - , m_tray(new Tray(manager, *this)) - , m_context_menu(NULL) -#endif - { - gtk_status_icon_set_tooltip_text(gobj(), - tray_util_get_tooltip_text().c_str()); - - IGnote::obj().signal_quit.connect(sigc::mem_fun(*this, &TrayIcon::on_exit)); - signal_activate().connect(sigc::mem_fun(*this, &TrayIcon::on_activate)); - signal_popup_menu().connect(sigc::mem_fun(*this, &TrayIcon::on_popup_menu)); - } - - void TrayIcon::show_menu(bool select_first_item) - { - if(m_context_menu) { - DBG_OUT("context menu found"); - } - m_tray->update_tray_menu(NULL); - if(select_first_item) { - m_tray->tray_menu()->select_first(false); - } - - popup_menu_at_position(*m_tray->tray_menu(), 0, - gtk_get_current_event_time()); - } - - TrayIcon::~TrayIcon() - { - delete m_context_menu; -#ifdef HAVE_X11_SUPPORT - delete m_keybinder; -#endif - } - - void TrayIcon::on_activate() - { - DBG_OUT("activated"); - show_menu(false); - } - - void TrayIcon::on_popup_menu(guint button, guint32 activate_time) - { - DBG_OUT("popup"); - if(button == 3) { - Gtk::Menu *menu = get_right_click_menu(); - popup_menu_at_position(*menu, button, activate_time); - } - } - - Gtk::Menu * TrayIcon::get_right_click_menu() - { - DBG_OUT("get right click menu"); - if(m_context_menu) { - DBG_OUT("menu already exists"); - return m_context_menu; - } - m_context_menu = new Gtk::Menu(); - DBG_OUT("creating menu"); - - Glib::RefPtr accel_group = Gtk::AccelGroup::create(); - m_context_menu->set_accel_group(accel_group); - - Gtk::ImageMenuItem * item; - - item = manage(new Gtk::ImageMenuItem(_("_Preferences"), true)); - item->set_image(*manage(new Gtk::Image(Gtk::Stock::PREFERENCES, Gtk::ICON_SIZE_MENU))); - item->signal_activate().connect(sigc::mem_fun(*this, &TrayIcon::show_preferences)); - m_context_menu->append(*item); - - item = manage(new Gtk::ImageMenuItem(_("_Help"), true)); - item->set_image(*manage(new Gtk::Image(Gtk::Stock::HELP, Gtk::ICON_SIZE_MENU))); - item->signal_activate().connect(sigc::mem_fun(*this, &TrayIcon::show_help_contents)); - m_context_menu->append(*item); - - item = manage(new Gtk::ImageMenuItem(_("_About Gnote"), true)); - item->set_image(*manage(new Gtk::Image(Gtk::Stock::ABOUT, Gtk::ICON_SIZE_MENU))); - item->signal_activate().connect(sigc::mem_fun(*this, &TrayIcon::show_about)); - m_context_menu->append(*item); - - m_context_menu->append(*manage(new Gtk::SeparatorMenuItem())); - - item = manage(new Gtk::ImageMenuItem(_("_Quit"), true)); - item->set_image(*manage(new Gtk::Image(Gtk::Stock::QUIT, Gtk::ICON_SIZE_MENU))); - item->signal_activate().connect(sigc::mem_fun(*this, &TrayIcon::quit)); - m_context_menu->append(*item); - - m_context_menu->show_all(); - - return m_context_menu; - } - - void TrayIcon::show_preferences() - { - ActionManager::obj()["ShowPreferencesAction"]->activate(); - } - - void TrayIcon::show_help_contents() - { - ActionManager::obj()["ShowHelpAction"]->activate(); - } - - void TrayIcon::show_about() - { - ActionManager::obj()["ShowAboutAction"]->activate(); - } - - void TrayIcon::quit() - { - ActionManager::obj()["QuitGNoteAction"]->activate(); - } - - void TrayIcon::on_exit() - { - set_visible(false); - } - - bool TrayIcon::menu_opens_upward() - { - bool open_upwards = false; - int val = 0; -// Glib::RefPtr screen; - GdkScreen *cscreen; - - Gdk::Rectangle area; - GtkOrientation orientation; -// get_geometry(screen, area, orientation); - gtk_status_icon_get_geometry(gobj(), &cscreen, area.gobj(), &orientation); - val = area.get_y(); - - Gtk::Requisition menu_req, unused; - m_tray->tray_menu()->get_preferred_size(unused, menu_req); - if (val + menu_req.height >= gdk_screen_get_height(cscreen)) - open_upwards = true; - - return open_upwards; - } - - bool TrayIcon::on_size_changed(int size) - { - if(size < 32) { - size = 24; - } - else if(size < 48) { - size = 32; - } - else size = 48; - Glib::RefPtr pixbuf = IconManager::obj().get_icon(IconManager::GNOTE, size); - set(pixbuf); - return Gtk::StatusIcon::on_size_changed(size); - } - -#ifdef HAVE_X11_SUPPORT - // - // This is a helper to take the XKeybinding string from GConf, and - // convert it to a widget accelerator label, so note menu items can - // display their global X keybinding. - // - // FIXME: It would be totally sweet to allow setting the accelerator - // visually through the menuitem, and have the new value be stored in - // GConf. - // - Glib::RefPtr KeybindingToAccel::s_accel_group; - - - Glib::RefPtr - KeybindingToAccel::get_accel_group() - { - if(!s_accel_group) { - s_accel_group = Gtk::AccelGroup::create(); - } - return s_accel_group; - } - - std::string KeybindingToAccel::get_shortcut (const std::string & key) - { - try { - std::string binding = Preferences::obj() - .get_schema_settings(Preferences::SCHEMA_KEYBINDINGS)->get_string(key); - if (binding.empty() || - binding == "disabled") { - return ""; - } - - binding = sharp::string_replace_all(binding, "<", ""); - binding = sharp::string_replace_all(binding, ">", "-"); - - return binding; - } - catch(...) - { - } - return ""; - } - - void KeybindingToAccel::add_accelerator(IKeybinder & keybinder, Gtk::MenuItem & item, const std::string & key) - { - guint keyval; - Gdk::ModifierType mods; - - if(keybinder.get_accel_keys(key, keyval, mods)) { - item.add_accelerator ("activate", - get_accel_group(), - keyval, - mods, - Gtk::ACCEL_VISIBLE); - } - } -#endif - -} diff -Nru gnote-3.14.2/src/tray.hpp gnote-3.16.0/src/tray.hpp --- gnote-3.14.2/src/tray.hpp 2015-01-17 12:53:20.000000000 +0000 +++ gnote-3.16.0/src/tray.hpp 1970-01-01 00:00:00.000000000 +0000 @@ -1,163 +0,0 @@ -/* - * gnote - * - * Copyright (C) 2010-2013 Aurimas Cernius - * Copyright (C) 2009 Hubert Figuiere - * - * This program is free software: you can redistribute it and/or modify - * it under the terms of the GNU General Public License as published by - * the Free Software Foundation, either version 3 of the License, or - * (at your option) any later version. - * - * This program is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU General Public License for more details. - * - * You should have received a copy of the GNU General Public License - * along with this program. If not, see . - */ - - - -#ifndef _TRAYICON_HPP_ -#define _TRAYICON_HPP_ - -#include -#include - -#include "base/macros.hpp" -#include "note.hpp" - -#ifdef HAVE_X11_SUPPORT -#include "keybinder.hpp" -#endif - -namespace gnote { - -class TrayIcon; -class PrefsKeybinder; -class NoteManager; - -class NoteMenuItem - : public Gtk::ImageMenuItem -{ -public: - NoteMenuItem(const Note::Ptr & note, bool show_pin); - -protected: - virtual void on_activate() override; - virtual bool on_button_press_event(GdkEventButton *) override; - virtual bool on_button_release_event(GdkEventButton *) override; - virtual bool on_motion_notify_event(GdkEventMotion *) override; - virtual bool on_leave_notify_event(GdkEventCrossing *) override; - -private: - Note::Ptr m_note; - Gtk::Image *m_pin_img; - bool m_pinned; - bool m_inhibit_activate; - - static std::string get_display_name(const Note::Ptr & n); - static std::string ellipsify (const std::string & str, size_t max); - static Glib::RefPtr get_pinup_icon(); - static Glib::RefPtr get_pindown_icon(); -}; - - -class IGnoteTray -{ -public: - virtual void show_menu(bool select_first_item) = 0; - virtual bool menu_opens_upward() = 0; -}; - -class Tray -{ -public: - typedef shared_ptr Ptr; -#ifdef HAVE_X11_SUPPORT - Tray(NoteManager &, IGnoteTray &, IKeybinder &); -#else - Tray(NoteManager &, IGnoteTray &); -#endif - - Gtk::Menu * make_tray_notes_menu(); - Gtk::Menu * tray_menu() - { return m_tray_menu; } - void update_tray_menu(Gtk::Widget * parent); - void add_recently_changed_notes(); -private: - void on_new_note_activate(); - void on_search_notes_activate(); - - NoteManager & m_manager; - IGnoteTray & m_trayicon; - Gtk::Menu *m_tray_menu; - Gtk::ImageMenuItem *m_new_note_item; - Gtk::ImageMenuItem *m_search_notes_item; - bool m_menu_added; -#ifdef HAVE_X11_SUPPORT - IKeybinder & m_keybinder; -#endif -}; - - -class TrayIcon - : public Gtk::StatusIcon - , public IGnoteTray -{ -public: -#ifdef HAVE_X11_SUPPORT - TrayIcon(IKeybinder & keybinder, NoteManager & manager); -#else - explicit TrayIcon(NoteManager & manager); -#endif - ~TrayIcon(); - - Tray::Ptr tray() const - { return m_tray; } - - void show_menu(bool select_first_item); - - Gtk::Menu * get_right_click_menu(); - - void on_activate(); - void on_popup_menu(guint button, guint32 activate_time); - void on_exit(); - bool menu_opens_upward(); - - void show_preferences(); - void show_help_contents(); - void show_about(); - void quit(); -protected: - virtual bool on_size_changed(int size) override; -private: - Tray::Ptr m_tray; - Gtk::Menu *m_context_menu; -#ifdef HAVE_X11_SUPPORT - PrefsKeybinder *m_keybinder; -#endif -}; - - -#ifdef HAVE_X11_SUPPORT -class KeybindingToAccel -{ -public: - static std::string get_shortcut (const std::string & key); - static void add_accelerator(IKeybinder & keybinder, Gtk::MenuItem & item, const std::string & key); - - static Glib::RefPtr get_accel_group(); -private: - static Glib::RefPtr s_accel_group; -}; -#endif - - - -std::string tray_util_get_tooltip_text(); - -} -#endif diff -Nru gnote-3.14.2/src/xkeybinder.cpp gnote-3.16.0/src/xkeybinder.cpp --- gnote-3.14.2/src/xkeybinder.cpp 2015-01-17 12:53:20.000000000 +0000 +++ gnote-3.16.0/src/xkeybinder.cpp 1970-01-01 00:00:00.000000000 +0000 @@ -1,107 +0,0 @@ -/* - * gnote - * - * Copyright (C) 2011 Aurimas Cernius - * Copyright (C) 2009 Hubert Figuiere - * - * This program is free software: you can redistribute it and/or modify - * it under the terms of the GNU General Public License as published by - * the Free Software Foundation, either version 3 of the License, or - * (at your option) any later version. - * - * This program is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU General Public License for more details. - * - * You should have received a copy of the GNU General Public License - * along with this program. If not, see . - */ - - - -#include "libtomboy/eggaccelerators.h" -#include "libtomboy/tomboykeybinder.h" - -#include "preferences.hpp" -#include "xkeybinder.hpp" - -namespace gnote { - - - XKeybinder::XKeybinder() - { - tomboy_keybinder_init (); - } - - - void XKeybinder::keybinding_pressed(char *keystring, gpointer user_data) - { - XKeybinder * self = static_cast(user_data); - BindingMap::iterator iter = self->m_bindings.find(keystring); - if(iter != self->m_bindings.end()) { - iter->second(); - } - } - - void XKeybinder::bind(const std::string & keystring, const sigc::slot & handler) - { - m_bindings[keystring] = handler; - tomboy_keybinder_bind(keystring.c_str(), &XKeybinder::keybinding_pressed, this); - } - - - void XKeybinder::unbind(const std::string & keystring) - { - BindingMap::iterator iter = m_bindings.find(keystring); - if(iter != m_bindings.end()) { - tomboy_keybinder_unbind(keystring.c_str(), &XKeybinder::keybinding_pressed); - m_bindings.erase(iter); - } - } - - - void XKeybinder::unbind_all() - { - for(BindingMap::const_iterator iter = m_bindings.begin(); - iter != m_bindings.end(); ++iter) { - tomboy_keybinder_unbind (iter->first.c_str(), &XKeybinder::keybinding_pressed); - } - m_bindings.clear(); - } - - - bool XKeybinder::get_accel_keys(const std::string & key, guint & keyval, - Gdk::ModifierType & mods) - { - keyval = 0; - mods = (Gdk::ModifierType)0; - - try { - std::string binding = Preferences::obj().get_schema_settings( - Preferences::SCHEMA_KEYBINDINGS)->get_string(key); - if (binding.empty() || binding == "disabled") { - return false; - } - - EggVirtualModifierType virtual_mods = (EggVirtualModifierType)0; - if (!egg_accelerator_parse_virtual (binding.c_str(), - &keyval, - &virtual_mods)) { - return false; - } - - GdkKeymap *keymap = gdk_keymap_get_default(); - GdkModifierType pmods = (GdkModifierType)0; - egg_keymap_resolve_virtual_modifiers (keymap, - virtual_mods, - &pmods); - mods = (Gdk::ModifierType)pmods; - } - catch (...) { - return false; - } - return true; - } - -} diff -Nru gnote-3.14.2/src/xkeybinder.hpp gnote-3.16.0/src/xkeybinder.hpp --- gnote-3.14.2/src/xkeybinder.hpp 2015-01-17 12:53:20.000000000 +0000 +++ gnote-3.16.0/src/xkeybinder.hpp 1970-01-01 00:00:00.000000000 +0000 @@ -1,57 +0,0 @@ -/* - * gnote - * - * Copyright (C) 2013 Aurimas Cernius - * Copyright (C) 2009 Hubert Figuiere - * - * This program is free software: you can redistribute it and/or modify - * it under the terms of the GNU General Public License as published by - * the Free Software Foundation, either version 3 of the License, or - * (at your option) any later version. - * - * This program is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU General Public License for more details. - * - * You should have received a copy of the GNU General Public License - * along with this program. If not, see . - */ - - - -#ifndef __XKEYBINDER_HPP_ -#define __XKEYBINDER_HPP_ - -#include - -#include - -#include "base/macros.hpp" -#include "keybinder.hpp" - -namespace gnote { - -class XKeybinder - : public IKeybinder -{ -public: - XKeybinder(); - virtual void bind(const std::string & keystring, const sigc::slot & handler) override; - virtual void unbind(const std::string & keystring) override; - virtual void unbind_all() override; - virtual bool get_accel_keys(const std::string & prefs_path, guint & keyval, - Gdk::ModifierType & mods) override; -private: - static void keybinding_pressed(char *keystring, gpointer user_data); - - typedef sigc::slot Handler; - typedef std::map BindingMap; - BindingMap m_bindings; - -}; - - -} - -#endif