diff -Nru kde-l10n-hi-4.12.97/debian/changelog kde-l10n-hi-4.13.0/debian/changelog --- kde-l10n-hi-4.12.97/debian/changelog 2014-04-03 15:21:27.000000000 +0000 +++ kde-l10n-hi-4.13.0/debian/changelog 2014-04-10 11:33:07.000000000 +0000 @@ -1,3 +1,9 @@ +kde-l10n-hi (4:4.13.0-0ubuntu1) trusty; urgency=medium + + * New upstream release of KDE Software Compilation + + -- Jonathan Riddell Thu, 10 Apr 2014 12:22:05 +0100 + kde-l10n-hi (4:4.12.97-0ubuntu1) trusty; urgency=medium * New upstream release diff -Nru kde-l10n-hi-4.12.97/messages/applications/dolphin.po kde-l10n-hi-4.13.0/messages/applications/dolphin.po --- kde-l10n-hi-4.12.97/messages/applications/dolphin.po 2014-03-25 04:40:13.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/applications/dolphin.po 2014-03-29 04:06:52.000000000 +0000 @@ -9,7 +9,7 @@ msgstr "" "Project-Id-Version: dolphin\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-25 01:33+0000\n" +"POT-Creation-Date: 2014-03-29 01:37+0000\n" "PO-Revision-Date: 2010-12-16 16:50+0530\n" "Last-Translator: G Karunakar \n" "Language-Team: Hindi \n" @@ -489,12 +489,12 @@ msgid "Main Toolbar" msgstr "मुख्य औज़ार पट्टी" -#: dolphinviewcontainer.cpp:421 +#: dolphinviewcontainer.cpp:403 msgctxt "@info:progress" msgid "Loading folder..." msgstr "फ़ोल्डर लोड किया जा रहा है..." -#: dolphinviewcontainer.cpp:429 +#: dolphinviewcontainer.cpp:411 #, fuzzy #| msgctxt "@label:listbox" #| msgid "Sorting:" @@ -502,27 +502,27 @@ msgid "Sorting..." msgstr "छांटा जा रहा है:" -#: dolphinviewcontainer.cpp:440 +#: dolphinviewcontainer.cpp:422 msgctxt "@info" msgid "Searching..." msgstr "" -#: dolphinviewcontainer.cpp:460 +#: dolphinviewcontainer.cpp:442 msgctxt "@info:status" msgid "No items found." msgstr "कोई मद नही मिले" -#: dolphinviewcontainer.cpp:575 +#: dolphinviewcontainer.cpp:557 msgctxt "@info:status" msgid "Dolphin does not support web pages, the web browser has been launched" msgstr "" -#: dolphinviewcontainer.cpp:589 +#: dolphinviewcontainer.cpp:571 msgctxt "@info:status" msgid "Protocol not supported by Dolphin, Konqueror has been launched" msgstr "" -#: dolphinviewcontainer.cpp:597 +#: dolphinviewcontainer.cpp:579 msgctxt "@info:status" msgid "Invalid protocol" msgstr "अवैध प्रोटोकॉल" @@ -1576,38 +1576,38 @@ msgid "Highest Rating" msgstr "" -#: search/dolphinsearchbox.cpp:103 +#: search/dolphinsearchbox.cpp:101 #, kde-format msgctxt "action:button" msgid "From Here (%1)" msgstr "यहाँ से (%1)" -#: search/dolphinsearchbox.cpp:325 +#: search/dolphinsearchbox.cpp:324 msgctxt "@info:tooltip" msgid "Quit searching" msgstr "खोजना बंद करें" -#: search/dolphinsearchbox.cpp:351 +#: search/dolphinsearchbox.cpp:350 msgctxt "action:button" msgid "Filename" msgstr "फ़ाइल नाम" -#: search/dolphinsearchbox.cpp:355 +#: search/dolphinsearchbox.cpp:354 msgctxt "action:button" msgid "Content" msgstr "विषयवस्तु" -#: search/dolphinsearchbox.cpp:366 +#: search/dolphinsearchbox.cpp:365 msgctxt "action:button" msgid "From Here" msgstr "यहाँ से" -#: search/dolphinsearchbox.cpp:370 +#: search/dolphinsearchbox.cpp:369 msgctxt "action:button" msgid "Everywhere" msgstr "हर जगह" -#: search/dolphinsearchbox.cpp:461 +#: search/dolphinsearchbox.cpp:459 #, kde-format msgctxt "" "@title UDS_DISPLAY_NAME for a KIO directory listing. %1 is the query the " @@ -1615,12 +1615,7 @@ msgid "Query Results from '%1'" msgstr "'%1' से क्वेरी के परिणाम" -#: search/dolphinsearchbox.cpp:476 -msgctxt "@label:textbox" -msgid "Find:" -msgstr "ढूंढें:" - -#: search/dolphinsearchbox.cpp:494 +#: search/dolphinsearchbox.cpp:512 #, fuzzy #| msgctxt "@label" #| msgid "Permissions" @@ -1628,7 +1623,7 @@ msgid "Fewer Options" msgstr "अनुमतियाँ" -#: search/dolphinsearchbox.cpp:494 +#: search/dolphinsearchbox.cpp:512 msgctxt "action:button" msgid "More Options" msgstr "" @@ -2936,6 +2931,10 @@ msgid "Updating version information..." msgstr "" +#~ msgctxt "@label:textbox" +#~ msgid "Find:" +#~ msgstr "ढूंढें:" + #, fuzzy #~| msgctxt "@action:inmenu" #~| msgid "Copy" diff -Nru kde-l10n-hi-4.12.97/messages/applications/katepart4.po kde-l10n-hi-4.13.0/messages/applications/katepart4.po --- kde-l10n-hi-4.12.97/messages/applications/katepart4.po 2014-03-06 03:45:35.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/applications/katepart4.po 2014-04-08 10:13:54.000000000 +0000 @@ -8,7 +8,7 @@ msgstr "" "Project-Id-Version: katepart\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-06 01:26+0000\n" +"POT-Creation-Date: 2014-04-08 08:02+0000\n" "PO-Revision-Date: 2007-09-13 11:39+0530\n" "Last-Translator: Ravishankar Shrivastava \n" "Language-Team: Hindi \n" @@ -8394,17 +8394,17 @@ msgstr "" #: vimode/kateviinsertmode.cpp:278 vimode/katevimodebase.cpp:957 -#: vimode/katevinormalmode.cpp:3873 +#: vimode/katevinormalmode.cpp:3876 #, kde-format msgid "Nothing in register %1" msgstr "" -#: vimode/katevinormalmode.cpp:1653 +#: vimode/katevinormalmode.cpp:1656 #, kde-format msgid "'%1' %2, Hex %3, Octal %4" msgstr "" -#: vimode/katevinormalmode.cpp:2547 +#: vimode/katevinormalmode.cpp:2550 #, fuzzy, kde-format #| msgid "Mark Type %1" msgid "Mark not set: %1" diff -Nru kde-l10n-hi-4.12.97/messages/CMakeLists.txt kde-l10n-hi-4.13.0/messages/CMakeLists.txt --- kde-l10n-hi-4.12.97/messages/CMakeLists.txt 2014-03-27 00:59:56.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/CMakeLists.txt 2014-04-10 09:29:25.000000000 +0000 @@ -1,5 +1,4 @@ add_subdirectory(applications) -add_subdirectory(frameworks) add_subdirectory(kdeaccessibility) add_subdirectory(kdeadmin) add_subdirectory(kdeartwork) diff -Nru kde-l10n-hi-4.12.97/messages/frameworks/CMakeLists.txt kde-l10n-hi-4.13.0/messages/frameworks/CMakeLists.txt --- kde-l10n-hi-4.12.97/messages/frameworks/CMakeLists.txt 2014-03-27 00:59:56.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/frameworks/CMakeLists.txt 1970-01-01 00:00:00.000000000 +0000 @@ -1,2 +0,0 @@ -file(GLOB _po_files *.po) -GETTEXT_PROCESS_PO_FILES(${CURRENT_LANG} ALL INSTALL_DESTINATION ${LOCALE_INSTALL_DIR} ${_po_files} ) diff -Nru kde-l10n-hi-4.12.97/messages/frameworks/kdecalendarsystems.po kde-l10n-hi-4.13.0/messages/frameworks/kdecalendarsystems.po --- kde-l10n-hi-4.12.97/messages/frameworks/kdecalendarsystems.po 2014-01-25 21:41:22.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/frameworks/kdecalendarsystems.po 1970-01-01 00:00:00.000000000 +0000 @@ -1,4682 +0,0 @@ -# translation of kdelibs4.po to Hindi -# Copyright (C) YEAR This_file_is_part_of_KDE -# This file is distributed under the same license as the PACKAGE package. -# -# Ravishankar Shrivastava , 2007. -# Ravishankar Shrivastava , 2008. -# G Karunakar , 2009. -msgid "" -msgstr "" -"Project-Id-Version: kdelibs4\n" -"Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-01-24 18:50+0000\n" -"PO-Revision-Date: 2009-06-22 02:17+0530\n" -"Last-Translator: G Karunakar \n" -"Language-Team: Hindi \n" -"Language: hi\n" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" -"Plural-Forms: nplurals=2; plural=(n!=1);\n" -"X-Generator: KBabel 1.11.4\n" - -#: kcalendarsystem.cpp:108 -msgctxt "@item Calendar system" -msgid "Gregorian" -msgstr "ग्रेगोरियन" - -#: kcalendarsystem.cpp:110 -#, fuzzy -msgctxt "@item Calendar system" -msgid "Coptic" -msgstr "कोप्टिक" - -#: kcalendarsystem.cpp:112 -#, fuzzy -msgctxt "@item Calendar system" -msgid "Ethiopian" -msgstr "इथियोपी" - -#: kcalendarsystem.cpp:114 -msgctxt "@item Calendar system" -msgid "Hebrew" -msgstr "हिब्रू" - -#: kcalendarsystem.cpp:116 -msgctxt "@item Calendar system" -msgid "Islamic / Hijri (Civil)" -msgstr "" - -#: kcalendarsystem.cpp:118 -msgctxt "@item Calendar system" -msgid "Indian National" -msgstr "" - -#: kcalendarsystem.cpp:120 -msgctxt "@item Calendar system" -msgid "Jalali" -msgstr "जलाली" - -#: kcalendarsystem.cpp:122 -msgctxt "@item Calendar system" -msgid "Japanese" -msgstr "" - -#: kcalendarsystem.cpp:124 -#, fuzzy -msgctxt "@item Calendar system" -msgid "Julian" -msgstr "जन." - -#: kcalendarsystem.cpp:126 -msgctxt "@item Calendar system" -msgid "Taiwanese" -msgstr "" - -#: kcalendarsystem.cpp:128 -#, fuzzy -#| msgid "R. Thaani" -msgctxt "@item Calendar system" -msgid "Thai" -msgstr "र. उस्सानी" - -#: kcalendarsystem.cpp:131 -msgctxt "@item Calendar system" -msgid "Invalid Calendar Type" -msgstr "अवैध कैलेण्डर किस्म" - -#: kcalendarsystem.cpp:1494 -msgctxt "Negative symbol as used for year numbers, e.g. -5 = 5 BC" -msgid "-" -msgstr "" - -#: kcalendarsystem.cpp:1531 -msgid "Today" -msgstr "आज" - -#: kcalendarsystem.cpp:1533 -msgid "Yesterday" -msgstr "कल" - -#: kcalendarsystemcoptic.cpp:45 -msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, LongFormat" -msgid "Anno Martyrum" -msgstr "" - -#: kcalendarsystemcoptic.cpp:46 -msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat" -msgid "AM" -msgstr "" - -#: kcalendarsystemcoptic.cpp:47 -#, c-format -msgctxt "" -"(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM" -msgid "%Ey %EC" -msgstr "" - -#: kcalendarsystemcoptic.cpp:153 -msgctxt "Coptic month 1 - KLocale::NarrowName" -msgid "T" -msgstr "" - -#: kcalendarsystemcoptic.cpp:155 -msgctxt "Coptic month 2 - KLocale::NarrowName" -msgid "P" -msgstr "" - -#: kcalendarsystemcoptic.cpp:157 -msgctxt "Coptic month 3 - KLocale::NarrowName" -msgid "H" -msgstr "" - -#: kcalendarsystemcoptic.cpp:159 -msgctxt "Coptic month 4 - KLocale::NarrowName" -msgid "K" -msgstr "" - -#: kcalendarsystemcoptic.cpp:161 -msgctxt "Coptic month 5 - KLocale::NarrowName" -msgid "T" -msgstr "" - -#: kcalendarsystemcoptic.cpp:163 -msgctxt "Coptic month 6 - KLocale::NarrowName" -msgid "M" -msgstr "" - -#: kcalendarsystemcoptic.cpp:165 -msgctxt "Coptic month 7 - KLocale::NarrowName" -msgid "P" -msgstr "" - -#: kcalendarsystemcoptic.cpp:167 -msgctxt "Coptic month 8 - KLocale::NarrowName" -msgid "P" -msgstr "" - -#: kcalendarsystemcoptic.cpp:169 -msgctxt "Coptic month 9 - KLocale::NarrowName" -msgid "P" -msgstr "" - -#: kcalendarsystemcoptic.cpp:171 -msgctxt "Coptic month 10 - KLocale::NarrowName" -msgid "P" -msgstr "" - -#: kcalendarsystemcoptic.cpp:173 -msgctxt "Coptic month 11 - KLocale::NarrowName" -msgid "E" -msgstr "" - -#: kcalendarsystemcoptic.cpp:175 -msgctxt "Coptic month 12 - KLocale::NarrowName" -msgid "M" -msgstr "" - -#: kcalendarsystemcoptic.cpp:177 -msgctxt "Coptic month 13 - KLocale::NarrowName" -msgid "K" -msgstr "" - -#: kcalendarsystemcoptic.cpp:186 -#, fuzzy -msgctxt "Coptic month 1 - KLocale::ShortName Possessive" -msgid "of Tho" -msgstr "खोर का" - -#: kcalendarsystemcoptic.cpp:188 -#, fuzzy -msgctxt "Coptic month 2 - KLocale::ShortName Possessive" -msgid "of Pao" -msgstr "तमुज का" - -#: kcalendarsystemcoptic.cpp:190 -#, fuzzy -msgctxt "Coptic month 3 - KLocale::ShortName Possessive" -msgid "of Hat" -msgstr "शवत का" - -#: kcalendarsystemcoptic.cpp:192 -#, fuzzy -msgctxt "Coptic month 4 - KLocale::ShortName Possessive" -msgid "of Kia" -msgstr "निसान का" - -#: kcalendarsystemcoptic.cpp:194 -#, fuzzy -msgctxt "Coptic month 5 - KLocale::ShortName Possessive" -msgid "of Tob" -msgstr "फरवरी का" - -#: kcalendarsystemcoptic.cpp:196 -#, fuzzy -msgctxt "Coptic month 6 - KLocale::ShortName Possessive" -msgid "of Mes" -msgstr "मेह का" - -#: kcalendarsystemcoptic.cpp:198 -#, fuzzy -msgctxt "Coptic month 7 - KLocale::ShortName Possessive" -msgid "of Par" -msgstr "मार्च का" - -#: kcalendarsystemcoptic.cpp:200 -#, fuzzy -msgctxt "Coptic month 8 - KLocale::ShortName Possessive" -msgid "of Pam" -msgstr "तमुज का" - -#: kcalendarsystemcoptic.cpp:202 -#, fuzzy -msgctxt "Coptic month 9 - KLocale::ShortName Possessive" -msgid "of Pas" -msgstr "बाह का" - -#: kcalendarsystemcoptic.cpp:204 -#, fuzzy -msgctxt "Coptic month 10 - KLocale::ShortName Possessive" -msgid "of Pan" -msgstr "जनवरी का" - -#: kcalendarsystemcoptic.cpp:206 -#, fuzzy -msgctxt "Coptic month 11 - KLocale::ShortName Possessive" -msgid "of Epe" -msgstr "फरवरी का" - -#: kcalendarsystemcoptic.cpp:208 -#, fuzzy -msgctxt "Coptic month 12 - KLocale::ShortName Possessive" -msgid "of Meo" -msgstr "मोर का" - -#: kcalendarsystemcoptic.cpp:210 -#, fuzzy -msgctxt "Coptic month 13 - KLocale::ShortName Possessive" -msgid "of Kou" -msgstr "खोर का" - -#: kcalendarsystemcoptic.cpp:219 -#, fuzzy -msgctxt "Coptic month 1 - KLocale::ShortName" -msgid "Tho" -msgstr "मंगल" - -#: kcalendarsystemcoptic.cpp:221 -#, fuzzy -msgctxt "Coptic month 2 - KLocale::ShortName" -msgid "Pao" -msgstr "ठहरें" - -#: kcalendarsystemcoptic.cpp:223 -#, fuzzy -msgctxt "Coptic month 3 - KLocale::ShortName" -msgid "Hat" -msgstr "शनि" - -#: kcalendarsystemcoptic.cpp:225 -#, fuzzy -msgctxt "Coptic month 4 - KLocale::ShortName" -msgid "Kia" -msgstr "गुरु" - -#: kcalendarsystemcoptic.cpp:227 -#, fuzzy -msgctxt "Coptic month 5 - KLocale::ShortName" -msgid "Tob" -msgstr "कार्य" - -#: kcalendarsystemcoptic.cpp:229 -#, fuzzy -msgctxt "Coptic month 6 - KLocale::ShortName" -msgid "Mes" -msgstr "हाँ" - -#: kcalendarsystemcoptic.cpp:231 -#, fuzzy -msgctxt "Coptic month 7 - KLocale::ShortName" -msgid "Par" -msgstr "मार्च" - -#: kcalendarsystemcoptic.cpp:233 -#, fuzzy -msgctxt "Coptic month 8 - KLocale::ShortName" -msgid "Pam" -msgstr "पूर्वाह्न" - -#: kcalendarsystemcoptic.cpp:235 -#, fuzzy -msgctxt "Coptic month 9 - KLocale::ShortName" -msgid "Pas" -msgstr "पृष्ठ" - -#: kcalendarsystemcoptic.cpp:237 -#, fuzzy -msgctxt "Coptic month 10 - KLocale::ShortName" -msgid "Pan" -msgstr "जन." - -#: kcalendarsystemcoptic.cpp:239 -#, fuzzy -msgctxt "Coptic month 11 - KLocale::ShortName" -msgid "Epe" -msgstr "एस्केप" - -#: kcalendarsystemcoptic.cpp:241 -#, fuzzy -msgctxt "Coptic month 12 - KLocale::ShortName" -msgid "Meo" -msgstr "सोम" - -#: kcalendarsystemcoptic.cpp:243 -#, fuzzy -msgctxt "Coptic month 12 - KLocale::ShortName" -msgid "Kou" -msgstr "खोर" - -#: kcalendarsystemcoptic.cpp:252 -#, fuzzy -msgctxt "Coptic month 1 - KLocale::LongName Possessive" -msgid "of Thoout" -msgstr "खोर का" - -#: kcalendarsystemcoptic.cpp:254 -#, fuzzy -msgctxt "Coptic month 2 - KLocale::LongName Possessive" -msgid "of Paope" -msgstr "तमुज का" - -#: kcalendarsystemcoptic.cpp:256 -#, fuzzy -msgctxt "Coptic month 3 - KLocale::LongName Possessive" -msgid "of Hathor" -msgstr "जिल्हज का" - -#: kcalendarsystemcoptic.cpp:258 -#, fuzzy -msgctxt "Coptic month 4 - KLocale::LongName Possessive" -msgid "of Kiahk" -msgstr "खोर का" - -#: kcalendarsystemcoptic.cpp:260 -#, fuzzy -msgctxt "Coptic month 5 - KLocale::LongName Possessive" -msgid "of Tobe" -msgstr "अक्टूबर का" - -#: kcalendarsystemcoptic.cpp:262 -#, fuzzy -msgctxt "Coptic month 6 - KLocale::LongName Possessive" -msgid "of Meshir" -msgstr "मेहर का" - -#: kcalendarsystemcoptic.cpp:264 -#, fuzzy -msgctxt "Coptic month 7 - KLocale::LongName Possessive" -msgid "of Paremhotep" -msgstr "पैरामीटर" - -#: kcalendarsystemcoptic.cpp:266 -#, fuzzy -msgctxt "Coptic month 8 - KLocale::LongName Possessive" -msgid "of Parmoute" -msgstr "तमुज का" - -#: kcalendarsystemcoptic.cpp:268 -#, fuzzy -msgctxt "Coptic month 9 - KLocale::LongName Possessive" -msgid "of Pashons" -msgstr "बाह का" - -#: kcalendarsystemcoptic.cpp:270 -#, fuzzy -msgctxt "Coptic month 10 - KLocale::LongName Possessive" -msgid "of Paone" -msgstr "जनवरी का" - -#: kcalendarsystemcoptic.cpp:272 -#, fuzzy -msgctxt "Coptic month 11 - KLocale::LongName Possessive" -msgid "of Epep" -msgstr "सित. का" - -#: kcalendarsystemcoptic.cpp:274 -#, fuzzy -msgctxt "Coptic month 12 - KLocale::LongName Possessive" -msgid "of Mesore" -msgstr "मोर का" - -#: kcalendarsystemcoptic.cpp:276 -#, fuzzy -msgctxt "Coptic month 12 - KLocale::LongName Possessive" -msgid "of Kouji nabot" -msgstr "फरवरी का" - -#: kcalendarsystemcoptic.cpp:285 -#, fuzzy -msgctxt "Coptic month 1 - KLocale::LongName" -msgid "Thoout" -msgstr "गुरू" - -#: kcalendarsystemcoptic.cpp:287 -#, fuzzy -msgctxt "Coptic month 2 - KLocale::LongName" -msgid "Paope" -msgstr "गुण" - -#: kcalendarsystemcoptic.cpp:289 -#, fuzzy -msgctxt "Coptic month 3 - KLocale::LongName" -msgid "Hathor" -msgstr "लेखक" - -#: kcalendarsystemcoptic.cpp:291 -#, fuzzy -msgctxt "Coptic month 4 - KLocale::LongName" -msgid "Kiahk" -msgstr "खोर का" - -#: kcalendarsystemcoptic.cpp:293 -#, fuzzy -msgctxt "Coptic month 5 - KLocale::LongName" -msgid "Tobe" -msgstr "कार्य" - -#: kcalendarsystemcoptic.cpp:295 -#, fuzzy -msgctxt "Coptic month 6 - KLocale::LongName" -msgid "Meshir" -msgstr "मेहर" - -#: kcalendarsystemcoptic.cpp:297 -#, fuzzy -msgctxt "Coptic month 7 - KLocale::LongName" -msgid "Paremhotep" -msgstr "पैरामीटर" - -#: kcalendarsystemcoptic.cpp:299 -#, fuzzy -msgctxt "Coptic month 8 - KLocale::LongName" -msgid "Parmoute" -msgstr "पैरामीटर" - -#: kcalendarsystemcoptic.cpp:301 -#, fuzzy -msgctxt "Coptic month 9 - KLocale::LongName" -msgid "Pashons" -msgstr "ठहरें" - -#: kcalendarsystemcoptic.cpp:303 -#, fuzzy -msgctxt "Coptic month 10 - KLocale::LongName" -msgid "Paone" -msgstr "कुछ नहीं" - -#: kcalendarsystemcoptic.cpp:305 -#, fuzzy -msgctxt "Coptic month 11 - KLocale::LongName" -msgid "Epep" -msgstr "एस्केप" - -#: kcalendarsystemcoptic.cpp:307 -#, fuzzy -msgctxt "Coptic month 12 - KLocale::LongName" -msgid "Mesore" -msgstr "बहाल करें (&R)" - -#: kcalendarsystemcoptic.cpp:309 -#, fuzzy -msgctxt "Coptic month 12 - KLocale::LongName" -msgid "Kouji nabot" -msgstr "फरवरी का" - -#: kcalendarsystemcoptic.cpp:324 -msgctxt "Coptic weekday 1 - KLocale::NarrowName" -msgid "P" -msgstr "" - -#: kcalendarsystemcoptic.cpp:326 -msgctxt "Coptic weekday 2 - KLocale::NarrowName" -msgid "P" -msgstr "" - -#: kcalendarsystemcoptic.cpp:328 -msgctxt "Coptic weekday 3 - KLocale::NarrowName" -msgid "P" -msgstr "" - -#: kcalendarsystemcoptic.cpp:330 -msgctxt "Coptic weekday 4 - KLocale::NarrowName" -msgid "P" -msgstr "" - -#: kcalendarsystemcoptic.cpp:332 -msgctxt "Coptic weekday 5 - KLocale::NarrowName" -msgid "P" -msgstr "" - -#: kcalendarsystemcoptic.cpp:334 -msgctxt "Coptic weekday 6 - KLocale::NarrowName" -msgid "P" -msgstr "" - -#: kcalendarsystemcoptic.cpp:336 -msgctxt "Coptic weekday 7 - KLocale::NarrowName" -msgid "T" -msgstr "" - -#: kcalendarsystemcoptic.cpp:345 -#, fuzzy -msgctxt "Coptic weekday 1 - KLocale::ShortName" -msgid "Pes" -msgstr "पृष्ठ" - -#: kcalendarsystemcoptic.cpp:347 -#, fuzzy -msgctxt "Coptic weekday 2 - KLocale::ShortName" -msgid "Psh" -msgstr "ठहरें" - -#: kcalendarsystemcoptic.cpp:349 -#, fuzzy -msgctxt "Coptic weekday 3 - KLocale::ShortName" -msgid "Pef" -msgstr "पृष्ठ" - -#: kcalendarsystemcoptic.cpp:351 -msgctxt "Coptic weekday 4 - KLocale::ShortName" -msgid "Pti" -msgstr "" - -#: kcalendarsystemcoptic.cpp:353 -#, fuzzy -msgctxt "Coptic weekday 5 - KLocale::ShortName" -msgid "Pso" -msgstr "ठहरें" - -#: kcalendarsystemcoptic.cpp:355 -#, fuzzy -msgctxt "Coptic weekday 6 - KLocale::ShortName" -msgid "Psa" -msgstr "ठहरें" - -#: kcalendarsystemcoptic.cpp:357 -msgctxt "Coptic weekday 7 - KLocale::ShortName" -msgid "Tky" -msgstr "" - -#: kcalendarsystemcoptic.cpp:365 -#, fuzzy -msgctxt "Coptic weekday 1 - KLocale::LongName" -msgid "Pesnau" -msgstr "ठहरें" - -#: kcalendarsystemcoptic.cpp:367 -#, fuzzy -msgctxt "Coptic weekday 2 - KLocale::LongName" -msgid "Pshoment" -msgstr "टिप्पणी" - -#: kcalendarsystemcoptic.cpp:369 -msgctxt "Coptic weekday 3 - KLocale::LongName" -msgid "Peftoou" -msgstr "" - -#: kcalendarsystemcoptic.cpp:371 -msgctxt "Coptic weekday 4 - KLocale::LongName" -msgid "Ptiou" -msgstr "" - -#: kcalendarsystemcoptic.cpp:373 -#, fuzzy -msgctxt "Coptic weekday 5 - KLocale::LongName" -msgid "Psoou" -msgstr "ठहरें" - -#: kcalendarsystemcoptic.cpp:375 -msgctxt "Coptic weekday 6 - KLocale::LongName" -msgid "Psabbaton" -msgstr "" - -#: kcalendarsystemcoptic.cpp:377 -msgctxt "Coptic weekday 7 - KLocale::LongName" -msgid "Tkyriakē" -msgstr "" - -#: kcalendarsystemethiopian.cpp:50 -msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, LongFormat" -msgid "Amata Mehrat" -msgstr "" - -#: kcalendarsystemethiopian.cpp:51 -msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, ShortFormat" -msgid "AM" -msgstr "" - -#: kcalendarsystemethiopian.cpp:52 -#, c-format -msgctxt "" -"(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM" -msgid "%Ey %EC" -msgstr "" - -#: kcalendarsystemethiopian.cpp:66 -msgctxt "Ethiopian month 1 - KLocale::NarrowName" -msgid "M" -msgstr "" - -#: kcalendarsystemethiopian.cpp:68 -msgctxt "Ethiopian month 2 - KLocale::NarrowName" -msgid "T" -msgstr "" - -#: kcalendarsystemethiopian.cpp:70 -msgctxt "Ethiopian month 3 - KLocale::NarrowName" -msgid "H" -msgstr "" - -#: kcalendarsystemethiopian.cpp:72 -msgctxt "Ethiopian month 4 - KLocale::NarrowName" -msgid "T" -msgstr "" - -#: kcalendarsystemethiopian.cpp:74 -msgctxt "Ethiopian month 5 - KLocale::NarrowName" -msgid "T" -msgstr "" - -#: kcalendarsystemethiopian.cpp:76 -msgctxt "Ethiopian month 6 - KLocale::NarrowName" -msgid "Y" -msgstr "" - -#: kcalendarsystemethiopian.cpp:78 -msgctxt "Ethiopian month 7 - KLocale::NarrowName" -msgid "M" -msgstr "" - -#: kcalendarsystemethiopian.cpp:80 -msgctxt "Ethiopian month 8 - KLocale::NarrowName" -msgid "M" -msgstr "" - -#: kcalendarsystemethiopian.cpp:82 -msgctxt "Ethiopian month 9 - KLocale::NarrowName" -msgid "G" -msgstr "" - -#: kcalendarsystemethiopian.cpp:84 -msgctxt "Ethiopian month 10 - KLocale::NarrowName" -msgid "S" -msgstr "" - -#: kcalendarsystemethiopian.cpp:86 -msgctxt "Ethiopian month 11 - KLocale::NarrowName" -msgid "H" -msgstr "" - -#: kcalendarsystemethiopian.cpp:88 -msgctxt "Ethiopian month 12 - KLocale::NarrowName" -msgid "N" -msgstr "" - -#: kcalendarsystemethiopian.cpp:90 -msgctxt "Ethiopian month 13 - KLocale::NarrowName" -msgid "P" -msgstr "" - -#: kcalendarsystemethiopian.cpp:99 -#, fuzzy -msgctxt "Ethiopian month 1 - KLocale::ShortName Possessive" -msgid "of Mes" -msgstr "मेह का" - -#: kcalendarsystemethiopian.cpp:101 -#, fuzzy -msgctxt "Ethiopian month 2 - KLocale::ShortName Possessive" -msgid "of Teq" -msgstr "तेवेत का" - -#: kcalendarsystemethiopian.cpp:103 -#, fuzzy -msgctxt "Ethiopian month 3 - KLocale::ShortName Possessive" -msgid "of Hed" -msgstr "फरवरी का" - -#: kcalendarsystemethiopian.cpp:105 -#, fuzzy -msgctxt "Ethiopian month 4 - KLocale::ShortName Possessive" -msgid "of Tah" -msgstr "बाह का" - -#: kcalendarsystemethiopian.cpp:107 -#, fuzzy -msgctxt "Ethiopian month 5 - KLocale::ShortName Possessive" -msgid "of Ter" -msgstr "तिर का" - -#: kcalendarsystemethiopian.cpp:109 -#, fuzzy -msgctxt "Ethiopian month 6 - KLocale::ShortName Possessive" -msgid "of Yak" -msgstr "जनवरी का" - -#: kcalendarsystemethiopian.cpp:111 -#, fuzzy -msgctxt "Ethiopian month 7 - KLocale::ShortName Possessive" -msgid "of Mag" -msgstr "मार्च का" - -#: kcalendarsystemethiopian.cpp:113 -#, fuzzy -msgctxt "Ethiopian month 8 - KLocale::ShortName Possessive" -msgid "of Miy" -msgstr "मई का" - -#: kcalendarsystemethiopian.cpp:115 -#, fuzzy -msgctxt "Ethiopian month 9 - KLocale::ShortName Possessive" -msgid "of Gen" -msgstr "जनवरी का" - -#: kcalendarsystemethiopian.cpp:117 -#, fuzzy -msgctxt "Ethiopian month 10 - KLocale::ShortName Possessive" -msgid "of Sen" -msgstr "सित. का" - -#: kcalendarsystemethiopian.cpp:119 -#, fuzzy -msgctxt "Ethiopian month 11 - KLocale::ShortName Possessive" -msgid "of Ham" -msgstr "तमुज का" - -#: kcalendarsystemethiopian.cpp:121 -#, fuzzy -msgctxt "Ethiopian month 12 - KLocale::ShortName Possessive" -msgid "of Neh" -msgstr "मेह का" - -#: kcalendarsystemethiopian.cpp:123 -#, fuzzy -msgctxt "Ethiopian month 13 - KLocale::ShortName Possessive" -msgid "of Pag" -msgstr "तमुज का" - -#: kcalendarsystemethiopian.cpp:132 -#, fuzzy -msgctxt "Ethiopian month 1 - KLocale::ShortName" -msgid "Mes" -msgstr "हाँ" - -#: kcalendarsystemethiopian.cpp:134 -#, fuzzy -msgctxt "Ethiopian month 2 - KLocale::ShortName" -msgid "Teq" -msgstr "मंगल" - -#: kcalendarsystemethiopian.cpp:136 -#, fuzzy -msgctxt "Ethiopian month 3 - KLocale::ShortName" -msgid "Hed" -msgstr "बुध" - -#: kcalendarsystemethiopian.cpp:138 -#, fuzzy -msgctxt "Ethiopian month 4 - KLocale::ShortName" -msgid "Tah" -msgstr "मंगल" - -#: kcalendarsystemethiopian.cpp:140 -#, fuzzy -msgctxt "Ethiopian month 5 - KLocale::ShortName" -msgid "Ter" -msgstr "मंगल" - -#: kcalendarsystemethiopian.cpp:142 -#, fuzzy -msgctxt "Ethiopian month 6 - KLocale::ShortName" -msgid "Yak" -msgstr "जनवरी का" - -#: kcalendarsystemethiopian.cpp:144 -#, fuzzy -msgctxt "Ethiopian month 7 - KLocale::ShortName" -msgid "Mag" -msgstr "मार्च" - -#: kcalendarsystemethiopian.cpp:146 -#, fuzzy -msgctxt "Ethiopian month 8 - KLocale::ShortName" -msgid "Miy" -msgstr "मई" - -#: kcalendarsystemethiopian.cpp:148 -#, fuzzy -msgctxt "Ethiopian month 9 - KLocale::ShortName" -msgid "Gen" -msgstr "हराः" - -#: kcalendarsystemethiopian.cpp:150 -#, fuzzy -msgctxt "Ethiopian month 10 - KLocale::ShortName" -msgid "Sen" -msgstr "भेजें (&S)" - -#: kcalendarsystemethiopian.cpp:152 -#, fuzzy -msgctxt "Ethiopian month 11 - KLocale::ShortName" -msgid "Ham" -msgstr "पूर्वाह्न" - -#: kcalendarsystemethiopian.cpp:154 -#, fuzzy -msgctxt "Ethiopian month 12 - KLocale::ShortName" -msgid "Neh" -msgstr "मेह" - -#: kcalendarsystemethiopian.cpp:156 -#, fuzzy -msgctxt "Ethiopian month 13 - KLocale::ShortName" -msgid "Pag" -msgstr "पृष्ठ" - -#: kcalendarsystemethiopian.cpp:165 -#, fuzzy -msgctxt "Ethiopian month 1 - KLocale::LongName Possessive" -msgid "of Meskerem" -msgstr "मेहर का" - -#: kcalendarsystemethiopian.cpp:167 -#, fuzzy -msgctxt "Ethiopian month 2 - KLocale::LongName Possessive" -msgid "of Tequemt" -msgstr "तेवेत का" - -#: kcalendarsystemethiopian.cpp:169 -#, fuzzy -msgctxt "Ethiopian month 3 - KLocale::LongName Possessive" -msgid "of Hedar" -msgstr "अदार का" - -#: kcalendarsystemethiopian.cpp:171 -#, fuzzy -msgctxt "Ethiopian month 4 - KLocale::LongName Possessive" -msgid "of Tahsas" -msgstr "बहमान का" - -#: kcalendarsystemethiopian.cpp:173 -#, fuzzy -msgctxt "Ethiopian month 5 - KLocale::LongName Possessive" -msgid "of Ter" -msgstr "तिर का" - -#: kcalendarsystemethiopian.cpp:175 -#, fuzzy -msgctxt "Ethiopian month 6 - KLocale::LongName Possessive" -msgid "of Yakatit" -msgstr "फर का" - -#: kcalendarsystemethiopian.cpp:177 -#, fuzzy -msgctxt "Ethiopian month 7 - KLocale::LongName Possessive" -msgid "of Magabit" -msgstr "रज्जब का" - -#: kcalendarsystemethiopian.cpp:179 -#, fuzzy -msgctxt "Ethiopian month 8 - KLocale::LongName Possessive" -msgid "of Miyazya" -msgstr "मई का" - -#: kcalendarsystemethiopian.cpp:181 -#, fuzzy -msgctxt "Ethiopian month 9 - KLocale::LongName Possessive" -msgid "of Genbot" -msgstr "फरवरी का" - -#: kcalendarsystemethiopian.cpp:183 -#, fuzzy -msgctxt "Ethiopian month 10 - KLocale::LongName Possessive" -msgid "of Sene" -msgstr "सित. का" - -#: kcalendarsystemethiopian.cpp:185 -#, fuzzy -msgctxt "Ethiopian month 11 - KLocale::LongName Possessive" -msgid "of Hamle" -msgstr "तमुज का" - -#: kcalendarsystemethiopian.cpp:187 -#, fuzzy -msgctxt "Ethiopian month 12 - KLocale::LongName Possessive" -msgid "of Nehase" -msgstr "शाह का" - -#: kcalendarsystemethiopian.cpp:189 -#, fuzzy -msgctxt "Ethiopian month 13 - KLocale::LongName Possessive" -msgid "of Pagumen" -msgstr "तमुज का" - -#: kcalendarsystemethiopian.cpp:198 -#, fuzzy -msgctxt "Ethiopian month 1 - KLocale::LongName" -msgid "Meskerem" -msgstr "मेहर का" - -#: kcalendarsystemethiopian.cpp:200 -#, fuzzy -msgctxt "Ethiopian month 2 - KLocale::LongName" -msgid "Tequemt" -msgstr "तेवत" - -#: kcalendarsystemethiopian.cpp:202 -#, fuzzy -msgctxt "Ethiopian month 3 - KLocale::LongName" -msgid "Hedar" -msgstr "अदर" - -#: kcalendarsystemethiopian.cpp:204 -#, fuzzy -msgctxt "Ethiopian month 4 - KLocale::LongName" -msgid "Tahsas" -msgstr "कार्य" - -#: kcalendarsystemethiopian.cpp:206 -#, fuzzy -msgctxt "Ethiopian month 5 - KLocale::LongName" -msgid "Ter" -msgstr "मंगल" - -#: kcalendarsystemethiopian.cpp:208 -#, fuzzy -msgctxt "Ethiopian month 6 - KLocale::LongName" -msgid "Yakatit" -msgstr "फर का" - -#: kcalendarsystemethiopian.cpp:210 -#, fuzzy -msgctxt "Ethiopian month 7 - KLocale::LongName" -msgid "Magabit" -msgstr "रज्जब का" - -#: kcalendarsystemethiopian.cpp:212 -#, fuzzy -msgctxt "Ethiopian month 8 - KLocale::LongName" -msgid "Miyazya" -msgstr "मई का" - -#: kcalendarsystemethiopian.cpp:214 -#, fuzzy -msgctxt "Ethiopian month 9 - KLocale::LongName" -msgid "Genbot" -msgstr "फरवरी का" - -#: kcalendarsystemethiopian.cpp:216 -#, fuzzy -msgctxt "Ethiopian month 10 - KLocale::LongName" -msgid "Sene" -msgstr "भेजें (&S)" - -#: kcalendarsystemethiopian.cpp:218 -#, fuzzy -msgctxt "Ethiopian month 11 - KLocale::LongName" -msgid "Hamle" -msgstr "नाम" - -#: kcalendarsystemethiopian.cpp:220 -#, fuzzy -msgctxt "Ethiopian month 12 - KLocale::LongName" -msgid "Nehase" -msgstr "नाम" - -#: kcalendarsystemethiopian.cpp:222 -#, fuzzy -msgctxt "Ethiopian month 13 - KLocale::LongName" -msgid "Pagumen" -msgstr "पृष्ठ" - -#: kcalendarsystemethiopian.cpp:236 -msgctxt "Ethiopian weekday 1 - KLocale::NarrowName " -msgid "S" -msgstr "" - -#: kcalendarsystemethiopian.cpp:238 -msgctxt "Ethiopian weekday 2 - KLocale::NarrowName " -msgid "M" -msgstr "" - -#: kcalendarsystemethiopian.cpp:240 -msgctxt "Ethiopian weekday 3 - KLocale::NarrowName " -msgid "R" -msgstr "" - -#: kcalendarsystemethiopian.cpp:242 -msgctxt "Ethiopian weekday 4 - KLocale::NarrowName " -msgid "H" -msgstr "" - -#: kcalendarsystemethiopian.cpp:244 -#, fuzzy -#| msgid "Av" -msgctxt "Ethiopian weekday 5 - KLocale::NarrowName " -msgid "A" -msgstr "एव" - -#: kcalendarsystemethiopian.cpp:246 -msgctxt "Ethiopian weekday 6 - KLocale::NarrowName " -msgid "Q" -msgstr "" - -#: kcalendarsystemethiopian.cpp:248 -msgctxt "Ethiopian weekday 7 - KLocale::NarrowName " -msgid "E" -msgstr "" - -#: kcalendarsystemethiopian.cpp:257 -#, fuzzy -msgctxt "Ethiopian weekday 1 - KLocale::ShortName" -msgid "Seg" -msgstr "सित." - -#: kcalendarsystemethiopian.cpp:259 -#, fuzzy -msgctxt "Ethiopian weekday 2 - KLocale::ShortName" -msgid "Mak" -msgstr "मार्च" - -#: kcalendarsystemethiopian.cpp:261 -#, fuzzy -msgctxt "Ethiopian weekday 3 - KLocale::ShortName" -msgid "Rob" -msgstr "कार्य" - -#: kcalendarsystemethiopian.cpp:263 -#, fuzzy -msgctxt "Ethiopian weekday 4 - KLocale::ShortName" -msgid "Ham" -msgstr "पूर्वाह्न" - -#: kcalendarsystemethiopian.cpp:265 -#, fuzzy -#| msgid "Arb" -msgctxt "Ethiopian weekday 5 - KLocale::ShortName" -msgid "Arb" -msgstr "बुध" - -#: kcalendarsystemethiopian.cpp:267 -#, fuzzy -msgctxt "Ethiopian weekday 6 - KLocale::ShortName" -msgid "Qed" -msgstr "बुध" - -#: kcalendarsystemethiopian.cpp:269 -#, fuzzy -msgctxt "Ethiopian weekday 7 - KLocale::ShortName" -msgid "Ehu" -msgstr "गुरू" - -#: kcalendarsystemethiopian.cpp:276 -#, fuzzy -msgctxt "Ethiopian weekday 1 - KLocale::LongName" -msgid "Segno" -msgstr "भेजें (&S)" - -#: kcalendarsystemethiopian.cpp:278 -#, fuzzy -msgctxt "Ethiopian weekday 2 - KLocale::LongName" -msgid "Maksegno" -msgstr "भेजें (&S)" - -#: kcalendarsystemethiopian.cpp:280 -#, fuzzy -msgctxt "Ethiopian weekday 3 - KLocale::LongName" -msgid "Rob" -msgstr "कार्य" - -#: kcalendarsystemethiopian.cpp:282 -#, fuzzy -msgctxt "Ethiopian weekday 4 - KLocale::LongName" -msgid "Hamus" -msgstr "ठहरें" - -#: kcalendarsystemethiopian.cpp:284 -#, fuzzy -#| msgid "Arb" -msgctxt "Ethiopian weekday 5 - KLocale::LongName" -msgid "Arb" -msgstr "बुध" - -#: kcalendarsystemethiopian.cpp:286 -#, fuzzy -msgctxt "Ethiopian weekday 6 - KLocale::LongName" -msgid "Qedame" -msgstr "नाम" - -#: kcalendarsystemethiopian.cpp:288 -#, fuzzy -msgctxt "Ethiopian weekday 7 - KLocale::LongName" -msgid "Ehud" -msgstr "गुरू" - -#: kcalendarsystemgregorian.cpp:53 -msgctxt "Calendar Era: Gregorian Common Era, years < 0, LongFormat" -msgid "Before Common Era" -msgstr "" - -#: kcalendarsystemgregorian.cpp:54 -msgctxt "Calendar Era: Gregorian Common Era, years < 0, ShortFormat" -msgid "BCE" -msgstr "" - -#: kcalendarsystemgregorian.cpp:56 -msgctxt "Calendar Era: Gregorian Christian Era, years < 0, LongFormat" -msgid "Before Christ" -msgstr "" - -#: kcalendarsystemgregorian.cpp:57 -msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat" -msgid "BC" -msgstr "" - -#: kcalendarsystemgregorian.cpp:59 -#, c-format -msgctxt "" -"(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC" -msgid "%Ey %EC" -msgstr "" - -#: kcalendarsystemgregorian.cpp:63 -msgctxt "Calendar Era: Gregorian Common Era, years > 0, LongFormat" -msgid "Common Era" -msgstr "" - -#: kcalendarsystemgregorian.cpp:64 -msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat" -msgid "CE" -msgstr "" - -#: kcalendarsystemgregorian.cpp:66 kcalendarsystemjapanese.cpp:57 -msgctxt "Calendar Era: Gregorian Christian Era, years > 0, LongFormat" -msgid "Anno Domini" -msgstr "" - -#: kcalendarsystemgregorian.cpp:67 kcalendarsystemjapanese.cpp:58 -msgctxt "Calendar Era: Gregorian Christian Era, years > 0, ShortFormat" -msgid "AD" -msgstr "" - -#: kcalendarsystemgregorian.cpp:69 kcalendarsystemjapanese.cpp:59 -#, c-format -msgctxt "" -"(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD" -msgid "%Ey %EC" -msgstr "" - -#: kcalendarsystemgregorian.cpp:138 -msgctxt "Gregorian month 1 - KLocale::NarrowName" -msgid "J" -msgstr "" - -#: kcalendarsystemgregorian.cpp:140 -msgctxt "Gregorian month 2 - KLocale::NarrowName" -msgid "F" -msgstr "" - -#: kcalendarsystemgregorian.cpp:142 -msgctxt "Gregorian month 3 - KLocale::NarrowName" -msgid "M" -msgstr "" - -#: kcalendarsystemgregorian.cpp:144 -#, fuzzy -#| msgid "Av" -msgctxt "Gregorian month 4 - KLocale::NarrowName" -msgid "A" -msgstr "एव" - -#: kcalendarsystemgregorian.cpp:146 -msgctxt "Gregorian month 5 - KLocale::NarrowName" -msgid "M" -msgstr "" - -#: kcalendarsystemgregorian.cpp:148 -msgctxt "Gregorian month 6 - KLocale::NarrowName" -msgid "J" -msgstr "" - -#: kcalendarsystemgregorian.cpp:150 -msgctxt "Gregorian month 7 - KLocale::NarrowName" -msgid "J" -msgstr "" - -#: kcalendarsystemgregorian.cpp:152 -#, fuzzy -#| msgid "Av" -msgctxt "Gregorian month 8 - KLocale::NarrowName" -msgid "A" -msgstr "एव" - -#: kcalendarsystemgregorian.cpp:154 -msgctxt "Gregorian month 9 - KLocale::NarrowName" -msgid "S" -msgstr "" - -#: kcalendarsystemgregorian.cpp:156 -msgctxt "Gregorian month 10 - KLocale::NarrowName" -msgid "O" -msgstr "" - -#: kcalendarsystemgregorian.cpp:158 -msgctxt "Gregorian month 11 - KLocale::NarrowName" -msgid "N" -msgstr "" - -#: kcalendarsystemgregorian.cpp:160 -msgctxt "Gregorian month 12 - KLocale::NarrowName" -msgid "D" -msgstr "" - -#: kcalendarsystemgregorian.cpp:169 -#, fuzzy -#| msgctxt "of January" -#| msgid "of Jan" -msgctxt "Gregorian month 1 - KLocale::ShortName Possessive" -msgid "of Jan" -msgstr "जनवरी का" - -#: kcalendarsystemgregorian.cpp:171 -#, fuzzy -#| msgctxt "of February" -#| msgid "of Feb" -msgctxt "Gregorian month 2 - KLocale::ShortName Possessive" -msgid "of Feb" -msgstr "फरवरी का" - -#: kcalendarsystemgregorian.cpp:173 -#, fuzzy -#| msgctxt "of March" -#| msgid "of Mar" -msgctxt "Gregorian month 3 - KLocale::ShortName Possessive" -msgid "of Mar" -msgstr "मार्च का" - -#: kcalendarsystemgregorian.cpp:175 -#, fuzzy -#| msgctxt "of April" -#| msgid "of Apr" -msgctxt "Gregorian month 4 - KLocale::ShortName Possessive" -msgid "of Apr" -msgstr "अप्रैल का" - -#: kcalendarsystemgregorian.cpp:177 -#, fuzzy -#| msgctxt "of May short" -#| msgid "of May" -msgctxt "Gregorian month 5 - KLocale::ShortName Possessive" -msgid "of May" -msgstr "मई का" - -#: kcalendarsystemgregorian.cpp:179 -#, fuzzy -#| msgctxt "of June" -#| msgid "of Jun" -msgctxt "Gregorian month 6 - KLocale::ShortName Possessive" -msgid "of Jun" -msgstr "जून का" - -#: kcalendarsystemgregorian.cpp:181 -#, fuzzy -#| msgctxt "of July" -#| msgid "of Jul" -msgctxt "Gregorian month 7 - KLocale::ShortName Possessive" -msgid "of Jul" -msgstr "जुलाई का" - -#: kcalendarsystemgregorian.cpp:183 -#, fuzzy -#| msgctxt "of August" -#| msgid "of Aug" -msgctxt "Gregorian month 8 - KLocale::ShortName Possessive" -msgid "of Aug" -msgstr "अग. का" - -#: kcalendarsystemgregorian.cpp:185 -#, fuzzy -#| msgctxt "of September" -#| msgid "of Sep" -msgctxt "Gregorian month 9 - KLocale::ShortName Possessive" -msgid "of Sep" -msgstr "सित. का" - -#: kcalendarsystemgregorian.cpp:187 -#, fuzzy -#| msgctxt "of October" -#| msgid "of Oct" -msgctxt "Gregorian month 10 - KLocale::ShortName Possessive" -msgid "of Oct" -msgstr "अक्तू. का" - -#: kcalendarsystemgregorian.cpp:189 -#, fuzzy -#| msgctxt "of November" -#| msgid "of Nov" -msgctxt "Gregorian month 11 - KLocale::ShortName Possessive" -msgid "of Nov" -msgstr "नवं. का" - -#: kcalendarsystemgregorian.cpp:191 -#, fuzzy -#| msgctxt "of December" -#| msgid "of Dec" -msgctxt "Gregorian month 12 - KLocale::ShortName Possessive" -msgid "of Dec" -msgstr "दिस. का" - -#: kcalendarsystemgregorian.cpp:200 -#, fuzzy -#| msgctxt "January" -#| msgid "Jan" -msgctxt "Gregorian month 1 - KLocale::ShortName" -msgid "Jan" -msgstr "जन." - -#: kcalendarsystemgregorian.cpp:202 -#, fuzzy -#| msgctxt "February" -#| msgid "Feb" -msgctxt "Gregorian month 2 - KLocale::ShortName" -msgid "Feb" -msgstr "फर." - -#: kcalendarsystemgregorian.cpp:204 -#, fuzzy -#| msgctxt "March" -#| msgid "Mar" -msgctxt "Gregorian month 3 - KLocale::ShortName" -msgid "Mar" -msgstr "मार्च" - -#: kcalendarsystemgregorian.cpp:206 -#, fuzzy -#| msgctxt "April" -#| msgid "Apr" -msgctxt "Gregorian month 4 - KLocale::ShortName" -msgid "Apr" -msgstr "अप्रै." - -#: kcalendarsystemgregorian.cpp:208 -#, fuzzy -#| msgctxt "May short" -#| msgid "May" -msgctxt "Gregorian month 5 - KLocale::ShortName" -msgid "May" -msgstr "मई" - -#: kcalendarsystemgregorian.cpp:210 -#, fuzzy -#| msgctxt "June" -#| msgid "Jun" -msgctxt "Gregorian month 6 - KLocale::ShortName" -msgid "Jun" -msgstr "जून" - -#: kcalendarsystemgregorian.cpp:212 -#, fuzzy -#| msgctxt "July" -#| msgid "Jul" -msgctxt "Gregorian month 7 - KLocale::ShortName" -msgid "Jul" -msgstr "जु." - -#: kcalendarsystemgregorian.cpp:214 -#, fuzzy -#| msgctxt "August" -#| msgid "Aug" -msgctxt "Gregorian month 8 - KLocale::ShortName" -msgid "Aug" -msgstr "अग." - -#: kcalendarsystemgregorian.cpp:216 -#, fuzzy -#| msgctxt "September" -#| msgid "Sep" -msgctxt "Gregorian month 9 - KLocale::ShortName" -msgid "Sep" -msgstr "सित." - -#: kcalendarsystemgregorian.cpp:218 -#, fuzzy -#| msgctxt "October" -#| msgid "Oct" -msgctxt "Gregorian month 10 - KLocale::ShortName" -msgid "Oct" -msgstr "अक्तू." - -#: kcalendarsystemgregorian.cpp:220 -#, fuzzy -#| msgctxt "November" -#| msgid "Nov" -msgctxt "Gregorian month 11 - KLocale::ShortName" -msgid "Nov" -msgstr "नवं." - -#: kcalendarsystemgregorian.cpp:222 -#, fuzzy -#| msgctxt "December" -#| msgid "Dec" -msgctxt "Gregorian month 12 - KLocale::ShortName" -msgid "Dec" -msgstr "दिसं." - -#: kcalendarsystemgregorian.cpp:231 -#, fuzzy -#| msgid "of January" -msgctxt "Gregorian month 1 - KLocale::LongName Possessive" -msgid "of January" -msgstr "जनवरी का" - -#: kcalendarsystemgregorian.cpp:233 -#, fuzzy -#| msgid "of February" -msgctxt "Gregorian month 2 - KLocale::LongName Possessive" -msgid "of February" -msgstr "फरवरी का" - -#: kcalendarsystemgregorian.cpp:235 -#, fuzzy -#| msgid "of March" -msgctxt "Gregorian month 3 - KLocale::LongName Possessive" -msgid "of March" -msgstr "मार्च का" - -#: kcalendarsystemgregorian.cpp:237 -#, fuzzy -#| msgid "of April" -msgctxt "Gregorian month 4 - KLocale::LongName Possessive" -msgid "of April" -msgstr "अप्रैल का" - -#: kcalendarsystemgregorian.cpp:239 -#, fuzzy -#| msgctxt "of May short" -#| msgid "of May" -msgctxt "Gregorian month 5 - KLocale::LongName Possessive" -msgid "of May" -msgstr "मई का" - -#: kcalendarsystemgregorian.cpp:241 -#, fuzzy -#| msgid "of June" -msgctxt "Gregorian month 6 - KLocale::LongName Possessive" -msgid "of June" -msgstr "जून का" - -#: kcalendarsystemgregorian.cpp:243 -#, fuzzy -#| msgid "of July" -msgctxt "Gregorian month 7 - KLocale::LongName Possessive" -msgid "of July" -msgstr "जुलाई का" - -#: kcalendarsystemgregorian.cpp:245 -#, fuzzy -#| msgid "of August" -msgctxt "Gregorian month 8 - KLocale::LongName Possessive" -msgid "of August" -msgstr "अगस्त का" - -#: kcalendarsystemgregorian.cpp:247 -#, fuzzy -#| msgid "of September" -msgctxt "Gregorian month 9 - KLocale::LongName Possessive" -msgid "of September" -msgstr "सितम्बर का" - -#: kcalendarsystemgregorian.cpp:249 -#, fuzzy -#| msgid "of October" -msgctxt "Gregorian month 10 - KLocale::LongName Possessive" -msgid "of October" -msgstr "अक्टूबर का" - -#: kcalendarsystemgregorian.cpp:251 -#, fuzzy -#| msgid "of November" -msgctxt "Gregorian month 11 - KLocale::LongName Possessive" -msgid "of November" -msgstr "नवंबर का" - -#: kcalendarsystemgregorian.cpp:253 -#, fuzzy -#| msgid "of December" -msgctxt "Gregorian month 12 - KLocale::LongName Possessive" -msgid "of December" -msgstr "दिसम्बर का" - -#: kcalendarsystemgregorian.cpp:262 -#, fuzzy -#| msgid "January" -msgctxt "Gregorian month 1 - KLocale::LongName" -msgid "January" -msgstr "जनवरी" - -#: kcalendarsystemgregorian.cpp:264 -#, fuzzy -#| msgid "February" -msgctxt "Gregorian month 2 - KLocale::LongName" -msgid "February" -msgstr "फरवरी" - -#: kcalendarsystemgregorian.cpp:266 -#, fuzzy -#| msgctxt "March long" -#| msgid "March" -msgctxt "Gregorian month 3 - KLocale::LongName" -msgid "March" -msgstr "मार्च" - -#: kcalendarsystemgregorian.cpp:268 -#, fuzzy -#| msgid "April" -msgctxt "Gregorian month 4 - KLocale::LongName" -msgid "April" -msgstr "अप्रैल" - -#: kcalendarsystemgregorian.cpp:270 -#, fuzzy -#| msgctxt "May short" -#| msgid "May" -msgctxt "Gregorian month 5 - KLocale::LongName" -msgid "May" -msgstr "मई" - -#: kcalendarsystemgregorian.cpp:272 -#, fuzzy -#| msgid "June" -msgctxt "Gregorian month 6 - KLocale::LongName" -msgid "June" -msgstr "जून" - -#: kcalendarsystemgregorian.cpp:274 -#, fuzzy -#| msgid "July" -msgctxt "Gregorian month 7 - KLocale::LongName" -msgid "July" -msgstr "जुलाई" - -#: kcalendarsystemgregorian.cpp:276 -#, fuzzy -#| msgctxt "August long" -#| msgid "August" -msgctxt "Gregorian month 8 - KLocale::LongName" -msgid "August" -msgstr "अगस्त" - -#: kcalendarsystemgregorian.cpp:278 -#, fuzzy -#| msgid "September" -msgctxt "Gregorian month 9 - KLocale::LongName" -msgid "September" -msgstr "सितम्बर" - -#: kcalendarsystemgregorian.cpp:280 -#, fuzzy -#| msgid "October" -msgctxt "Gregorian month 10 - KLocale::LongName" -msgid "October" -msgstr "अक्टूबर" - -#: kcalendarsystemgregorian.cpp:282 -#, fuzzy -#| msgid "November" -msgctxt "Gregorian month 11 - KLocale::LongName" -msgid "November" -msgstr "नवम्बर" - -#: kcalendarsystemgregorian.cpp:284 -#, fuzzy -#| msgid "December" -msgctxt "Gregorian month 12 - KLocale::LongName" -msgid "December" -msgstr "दिसम्बर" - -#: kcalendarsystemgregorian.cpp:297 kcalendarsystemhebrew.cpp:807 -msgctxt "Gregorian weekday 1 - KLocale::NarrowName " -msgid "M" -msgstr "" - -#: kcalendarsystemgregorian.cpp:299 kcalendarsystemhebrew.cpp:809 -msgctxt "Gregorian weekday 2 - KLocale::NarrowName " -msgid "T" -msgstr "" - -#: kcalendarsystemgregorian.cpp:301 kcalendarsystemhebrew.cpp:811 -msgctxt "Gregorian weekday 3 - KLocale::NarrowName " -msgid "W" -msgstr "" - -#: kcalendarsystemgregorian.cpp:303 kcalendarsystemhebrew.cpp:813 -msgctxt "Gregorian weekday 4 - KLocale::NarrowName " -msgid "T" -msgstr "" - -#: kcalendarsystemgregorian.cpp:305 kcalendarsystemhebrew.cpp:815 -msgctxt "Gregorian weekday 5 - KLocale::NarrowName " -msgid "F" -msgstr "" - -#: kcalendarsystemgregorian.cpp:307 kcalendarsystemhebrew.cpp:817 -msgctxt "Gregorian weekday 6 - KLocale::NarrowName " -msgid "S" -msgstr "" - -#: kcalendarsystemgregorian.cpp:309 kcalendarsystemhebrew.cpp:819 -msgctxt "Gregorian weekday 7 - KLocale::NarrowName " -msgid "S" -msgstr "" - -#: kcalendarsystemgregorian.cpp:318 kcalendarsystemhebrew.cpp:828 -#, fuzzy -#| msgctxt "Monday" -#| msgid "Mon" -msgctxt "Gregorian weekday 1 - KLocale::ShortName" -msgid "Mon" -msgstr "सोम" - -#: kcalendarsystemgregorian.cpp:320 kcalendarsystemhebrew.cpp:830 -#, fuzzy -#| msgctxt "Tuesday" -#| msgid "Tue" -msgctxt "Gregorian weekday 2 - KLocale::ShortName" -msgid "Tue" -msgstr "मंगल" - -#: kcalendarsystemgregorian.cpp:322 kcalendarsystemhebrew.cpp:832 -#, fuzzy -#| msgctxt "Wednesday" -#| msgid "Wed" -msgctxt "Gregorian weekday 3 - KLocale::ShortName" -msgid "Wed" -msgstr "बुध" - -#: kcalendarsystemgregorian.cpp:324 kcalendarsystemhebrew.cpp:834 -#, fuzzy -#| msgctxt "Thursday" -#| msgid "Thu" -msgctxt "Gregorian weekday 4 - KLocale::ShortName" -msgid "Thu" -msgstr "गुरू" - -#: kcalendarsystemgregorian.cpp:326 kcalendarsystemhebrew.cpp:836 -#, fuzzy -#| msgctxt "Friday" -#| msgid "Fri" -msgctxt "Gregorian weekday 5 - KLocale::ShortName" -msgid "Fri" -msgstr "शुक्र" - -#: kcalendarsystemgregorian.cpp:328 kcalendarsystemhebrew.cpp:838 -#, fuzzy -#| msgctxt "Saturday" -#| msgid "Sat" -msgctxt "Gregorian weekday 6 - KLocale::ShortName" -msgid "Sat" -msgstr "शनि" - -#: kcalendarsystemgregorian.cpp:330 kcalendarsystemhebrew.cpp:840 -#, fuzzy -#| msgctxt "Sunday" -#| msgid "Sun" -msgctxt "Gregorian weekday 7 - KLocale::ShortName" -msgid "Sun" -msgstr "रवि" - -#: kcalendarsystemgregorian.cpp:337 kcalendarsystemhebrew.cpp:847 -#, fuzzy -#| msgid "Monday" -msgctxt "Gregorian weekday 1 - KLocale::LongName" -msgid "Monday" -msgstr "सोमवार" - -#: kcalendarsystemgregorian.cpp:339 kcalendarsystemhebrew.cpp:849 -#, fuzzy -#| msgid "Tuesday" -msgctxt "Gregorian weekday 2 - KLocale::LongName" -msgid "Tuesday" -msgstr "मंगलवार" - -#: kcalendarsystemgregorian.cpp:341 kcalendarsystemhebrew.cpp:851 -#, fuzzy -#| msgid "Wednesday" -msgctxt "Gregorian weekday 3 - KLocale::LongName" -msgid "Wednesday" -msgstr "बुधवार" - -#: kcalendarsystemgregorian.cpp:343 kcalendarsystemhebrew.cpp:853 -#, fuzzy -#| msgid "Thursday" -msgctxt "Gregorian weekday 4 - KLocale::LongName" -msgid "Thursday" -msgstr "गुरुवार" - -#: kcalendarsystemgregorian.cpp:345 kcalendarsystemhebrew.cpp:855 -#, fuzzy -#| msgid "Friday" -msgctxt "Gregorian weekday 5 - KLocale::LongName" -msgid "Friday" -msgstr "शुक्रवार" - -#: kcalendarsystemgregorian.cpp:347 kcalendarsystemhebrew.cpp:857 -#, fuzzy -#| msgid "Saturday" -msgctxt "Gregorian weekday 6 - KLocale::LongName" -msgid "Saturday" -msgstr "शनिवार" - -#: kcalendarsystemgregorian.cpp:349 kcalendarsystemhebrew.cpp:859 -#, fuzzy -#| msgid "Sunday" -msgctxt "Gregorian weekday 7 - KLocale::LongName" -msgid "Sunday" -msgstr "रविवार" - -#: kcalendarsystemhebrew.cpp:281 -msgctxt "Calendar Era: Hebrew Era, years > 0, LongFormat" -msgid "Anno Mundi" -msgstr "" - -#: kcalendarsystemhebrew.cpp:282 -msgctxt "Calendar Era: Hebrew Era, years > 0, ShortFormat" -msgid "AM" -msgstr "" - -#: kcalendarsystemhebrew.cpp:283 -#, c-format -msgctxt "" -"(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM" -msgid "%Ey %EC" -msgstr "" - -#: kcalendarsystemhebrew.cpp:625 -msgctxt "Hebrew month 1 - KLocale::NarrowName" -msgid "T" -msgstr "" - -#: kcalendarsystemhebrew.cpp:627 -msgctxt "Hebrew month 2 - KLocale::NarrowName" -msgid "H" -msgstr "" - -#: kcalendarsystemhebrew.cpp:629 -msgctxt "Hebrew month 3 - KLocale::NarrowName" -msgid "K" -msgstr "" - -#: kcalendarsystemhebrew.cpp:631 -msgctxt "Hebrew month 4 - KLocale::NarrowName" -msgid "T" -msgstr "" - -#: kcalendarsystemhebrew.cpp:633 -msgctxt "Hebrew month 5 - KLocale::NarrowName" -msgid "S" -msgstr "" - -#: kcalendarsystemhebrew.cpp:635 -#, fuzzy -#| msgid "Av" -msgctxt "Hebrew month 6 - KLocale::NarrowName" -msgid "A" -msgstr "एव" - -#: kcalendarsystemhebrew.cpp:637 -msgctxt "Hebrew month 7 - KLocale::NarrowName" -msgid "N" -msgstr "" - -#: kcalendarsystemhebrew.cpp:639 -msgctxt "Hebrew month 8 - KLocale::NarrowName" -msgid "I" -msgstr "" - -#: kcalendarsystemhebrew.cpp:641 -msgctxt "Hebrew month 9 - KLocale::NarrowName" -msgid "S" -msgstr "" - -#: kcalendarsystemhebrew.cpp:643 -msgctxt "Hebrew month 10 - KLocale::NarrowName" -msgid "T" -msgstr "" - -#: kcalendarsystemhebrew.cpp:645 -#, fuzzy -#| msgid "Av" -msgctxt "Hebrew month 11 - KLocale::NarrowName" -msgid "A" -msgstr "एव" - -#: kcalendarsystemhebrew.cpp:647 -msgctxt "Hebrew month 12 - KLocale::NarrowName" -msgid "E" -msgstr "" - -#: kcalendarsystemhebrew.cpp:649 -#, fuzzy -#| msgid "Av" -msgctxt "Hebrew month 13 - KLocale::NarrowName" -msgid "A" -msgstr "एव" - -#: kcalendarsystemhebrew.cpp:651 -#, fuzzy -#| msgid "Av" -msgctxt "Hebrew month 14 - KLocale::NarrowName" -msgid "A" -msgstr "एव" - -#: kcalendarsystemhebrew.cpp:660 -#, fuzzy -#| msgctxt "of Tir short" -#| msgid "of Tir" -msgctxt "Hebrew month 1 - KLocale::ShortName Possessive" -msgid "of Tis" -msgstr "तिर का" - -#: kcalendarsystemhebrew.cpp:662 -#, fuzzy -msgctxt "Hebrew month 2 - KLocale::ShortName Possessive" -msgid "of Hes" -msgstr "मेह का" - -#: kcalendarsystemhebrew.cpp:664 -#, fuzzy -msgctxt "Hebrew month 3 - KLocale::ShortName Possessive" -msgid "of Kis" -msgstr "निसान का" - -#: kcalendarsystemhebrew.cpp:666 -#, fuzzy -#| msgid "of Tevet" -msgctxt "Hebrew month 4 - KLocale::ShortName Possessive" -msgid "of Tev" -msgstr "तेवेत का" - -#: kcalendarsystemhebrew.cpp:668 -#, fuzzy -#| msgid "of Shvat" -msgctxt "Hebrew month 5 - KLocale::ShortName Possessive" -msgid "of Shv" -msgstr "शवत का" - -#: kcalendarsystemhebrew.cpp:670 -#, fuzzy -#| msgid "of Adar" -msgctxt "Hebrew month 6 - KLocale::ShortName Possessive" -msgid "of Ada" -msgstr "अदार का" - -#: kcalendarsystemhebrew.cpp:672 -#, fuzzy -#| msgid "of Nisan" -msgctxt "Hebrew month 7 - KLocale::ShortName Possessive" -msgid "of Nis" -msgstr "निसान का" - -#: kcalendarsystemhebrew.cpp:674 -#, fuzzy -#| msgid "of Iyar" -msgctxt "Hebrew month 8 - KLocale::ShortName Possessive" -msgid "of Iya" -msgstr "इयार का" - -#: kcalendarsystemhebrew.cpp:676 -#, fuzzy -#| msgid "of Sivan" -msgctxt "Hebrew month 9 - KLocale::ShortName Possessive" -msgid "of Siv" -msgstr "सिवान का" - -#: kcalendarsystemhebrew.cpp:678 -#, fuzzy -#| msgid "of Tamuz" -msgctxt "Hebrew month 10 - KLocale::ShortName Possessive" -msgid "of Tam" -msgstr "तमुज का" - -#: kcalendarsystemhebrew.cpp:680 -#, fuzzy -#| msgid "of Av" -msgctxt "Hebrew month 11 - KLocale::ShortName Possessive" -msgid "of Av" -msgstr "एव का" - -#: kcalendarsystemhebrew.cpp:682 -#, fuzzy -#| msgid "of Elul" -msgctxt "Hebrew month 12 - KLocale::ShortName Possessive" -msgid "of Elu" -msgstr "एलुल का" - -#: kcalendarsystemhebrew.cpp:684 -#, fuzzy -#| msgid "of Adar" -msgctxt "Hebrew month 13 - KLocale::ShortName Possessive" -msgid "of Ad1" -msgstr "अदार का" - -#: kcalendarsystemhebrew.cpp:686 -#, fuzzy -#| msgid "of Adar" -msgctxt "Hebrew month 14 - KLocale::ShortName Possessive" -msgid "of Ad2" -msgstr "अदार का" - -#: kcalendarsystemhebrew.cpp:695 -#, fuzzy -#| msgctxt "Tir short" -#| msgid "Tir" -msgctxt "Hebrew month 1 - KLocale::ShortName" -msgid "Tis" -msgstr "तिर" - -#: kcalendarsystemhebrew.cpp:697 -#, fuzzy -msgctxt "Hebrew month 2 - KLocale::ShortName" -msgid "Hes" -msgstr "हाँ" - -#: kcalendarsystemhebrew.cpp:699 -#, fuzzy -#| msgid "Kislev" -msgctxt "Hebrew month 3 - KLocale::ShortName" -msgid "Kis" -msgstr "किस्लेव" - -#: kcalendarsystemhebrew.cpp:701 -#, fuzzy -#| msgid "Tevet" -msgctxt "Hebrew month 4 - KLocale::ShortName" -msgid "Tev" -msgstr "तेवत" - -#: kcalendarsystemhebrew.cpp:703 -#, fuzzy -#| msgid "Shvat" -msgctxt "Hebrew month 5 - KLocale::ShortName" -msgid "Shv" -msgstr "श्वत" - -#: kcalendarsystemhebrew.cpp:705 -#, fuzzy -#| msgid "Adar" -msgctxt "Hebrew month 6 - KLocale::ShortName" -msgid "Ada" -msgstr "अदर" - -#: kcalendarsystemhebrew.cpp:707 -#, fuzzy -#| msgid "Nisan" -msgctxt "Hebrew month 7 - KLocale::ShortName" -msgid "Nis" -msgstr "निसान" - -#: kcalendarsystemhebrew.cpp:709 -#, fuzzy -#| msgid "Iyar" -msgctxt "Hebrew month 8 - KLocale::ShortName" -msgid "Iya" -msgstr "इयार" - -#: kcalendarsystemhebrew.cpp:711 -#, fuzzy -#| msgid "Sivan" -msgctxt "Hebrew month 9 - KLocale::ShortName" -msgid "Siv" -msgstr "सिवान" - -#: kcalendarsystemhebrew.cpp:713 -#, fuzzy -#| msgid "Tamuz" -msgctxt "Hebrew month 10 - KLocale::ShortName" -msgid "Tam" -msgstr "तामुज" - -#: kcalendarsystemhebrew.cpp:715 -#, fuzzy -#| msgid "Av" -msgctxt "Hebrew month 11 - KLocale::ShortName" -msgid "Av" -msgstr "एव" - -#: kcalendarsystemhebrew.cpp:717 -#, fuzzy -#| msgid "Elul" -msgctxt "Hebrew month 12 - KLocale::ShortName" -msgid "Elu" -msgstr "एलुल" - -#: kcalendarsystemhebrew.cpp:719 -#, fuzzy -#| msgid "Ahd" -msgctxt "Hebrew month 13 - KLocale::ShortName" -msgid "Ad1" -msgstr "रवि" - -#: kcalendarsystemhebrew.cpp:721 -#, fuzzy -#| msgid "Ahd" -msgctxt "Hebrew month 14 - KLocale::ShortName" -msgid "Ad2" -msgstr "रवि" - -#: kcalendarsystemhebrew.cpp:730 -#, fuzzy -#| msgid "of Tishrey" -msgctxt "Hebrew month 1 - KLocale::LongName Possessive" -msgid "of Tishrey" -msgstr "तिशरे का" - -#: kcalendarsystemhebrew.cpp:732 -#, fuzzy -#| msgid "of Heshvan" -msgctxt "Hebrew month 2 - KLocale::LongName Possessive" -msgid "of Heshvan" -msgstr "हेशवान का" - -#: kcalendarsystemhebrew.cpp:734 -#, fuzzy -#| msgid "of Kislev" -msgctxt "Hebrew month 3 - KLocale::LongName Possessive" -msgid "of Kislev" -msgstr "किसलेव का" - -#: kcalendarsystemhebrew.cpp:736 -#, fuzzy -#| msgid "of Tevet" -msgctxt "Hebrew month 4 - KLocale::LongName Possessive" -msgid "of Tevet" -msgstr "तेवेत का" - -#: kcalendarsystemhebrew.cpp:738 -#, fuzzy -#| msgid "of Shvat" -msgctxt "Hebrew month 5 - KLocale::LongName Possessive" -msgid "of Shvat" -msgstr "शवत का" - -#: kcalendarsystemhebrew.cpp:740 -#, fuzzy -#| msgid "of Adar" -msgctxt "Hebrew month 6 - KLocale::LongName Possessive" -msgid "of Adar" -msgstr "अदार का" - -#: kcalendarsystemhebrew.cpp:742 -#, fuzzy -#| msgid "of Nisan" -msgctxt "Hebrew month 7 - KLocale::LongName Possessive" -msgid "of Nisan" -msgstr "निसान का" - -#: kcalendarsystemhebrew.cpp:744 -#, fuzzy -#| msgid "of Iyar" -msgctxt "Hebrew month 8 - KLocale::LongName Possessive" -msgid "of Iyar" -msgstr "इयार का" - -#: kcalendarsystemhebrew.cpp:746 -#, fuzzy -#| msgid "of Sivan" -msgctxt "Hebrew month 9 - KLocale::LongName Possessive" -msgid "of Sivan" -msgstr "सिवान का" - -#: kcalendarsystemhebrew.cpp:748 -#, fuzzy -#| msgid "of Tamuz" -msgctxt "Hebrew month 10 - KLocale::LongName Possessive" -msgid "of Tamuz" -msgstr "तमुज का" - -#: kcalendarsystemhebrew.cpp:750 -#, fuzzy -#| msgid "of Av" -msgctxt "Hebrew month 11 - KLocale::LongName Possessive" -msgid "of Av" -msgstr "एव का" - -#: kcalendarsystemhebrew.cpp:752 -#, fuzzy -#| msgid "of Elul" -msgctxt "Hebrew month 12 - KLocale::LongName Possessive" -msgid "of Elul" -msgstr "एलुल का" - -#: kcalendarsystemhebrew.cpp:754 -#, fuzzy -#| msgid "of Adar I" -msgctxt "Hebrew month 13 - KLocale::LongName Possessive" -msgid "of Adar I" -msgstr "अदार I का" - -#: kcalendarsystemhebrew.cpp:756 -#, fuzzy -#| msgid "of Adar II" -msgctxt "Hebrew month 14 - KLocale::LongName Possessive" -msgid "of Adar II" -msgstr "अदार II का" - -#: kcalendarsystemhebrew.cpp:765 -#, fuzzy -#| msgid "Tishrey" -msgctxt "Hebrew month 1 - KLocale::LongName" -msgid "Tishrey" -msgstr "तिशरे" - -#: kcalendarsystemhebrew.cpp:767 -#, fuzzy -#| msgid "Heshvan" -msgctxt "Hebrew month 2 - KLocale::LongName" -msgid "Heshvan" -msgstr "हेश्वान" - -#: kcalendarsystemhebrew.cpp:769 -#, fuzzy -#| msgid "Kislev" -msgctxt "Hebrew month 3 - KLocale::LongName" -msgid "Kislev" -msgstr "किस्लेव" - -#: kcalendarsystemhebrew.cpp:771 -#, fuzzy -#| msgid "Tevet" -msgctxt "Hebrew month 4 - KLocale::LongName" -msgid "Tevet" -msgstr "तेवत" - -#: kcalendarsystemhebrew.cpp:773 -#, fuzzy -#| msgid "Shvat" -msgctxt "Hebrew month 5 - KLocale::LongName" -msgid "Shvat" -msgstr "श्वत" - -#: kcalendarsystemhebrew.cpp:775 -#, fuzzy -#| msgid "Adar" -msgctxt "Hebrew month 6 - KLocale::LongName" -msgid "Adar" -msgstr "अदर" - -#: kcalendarsystemhebrew.cpp:777 -#, fuzzy -#| msgid "Nisan" -msgctxt "Hebrew month 7 - KLocale::LongName" -msgid "Nisan" -msgstr "निसान" - -#: kcalendarsystemhebrew.cpp:779 -#, fuzzy -#| msgid "Iyar" -msgctxt "Hebrew month 8 - KLocale::LongName" -msgid "Iyar" -msgstr "इयार" - -#: kcalendarsystemhebrew.cpp:781 -#, fuzzy -#| msgid "Sivan" -msgctxt "Hebrew month 9 - KLocale::LongName" -msgid "Sivan" -msgstr "सिवान" - -#: kcalendarsystemhebrew.cpp:783 -#, fuzzy -#| msgid "Tamuz" -msgctxt "Hebrew month 10 - KLocale::LongName" -msgid "Tamuz" -msgstr "तामुज" - -#: kcalendarsystemhebrew.cpp:785 -#, fuzzy -#| msgid "Av" -msgctxt "Hebrew month 11 - KLocale::LongName" -msgid "Av" -msgstr "एव" - -#: kcalendarsystemhebrew.cpp:787 -#, fuzzy -#| msgid "Elul" -msgctxt "Hebrew month 12 - KLocale::LongName" -msgid "Elul" -msgstr "एलुल" - -#: kcalendarsystemhebrew.cpp:789 -#, fuzzy -#| msgid "Adar I" -msgctxt "Hebrew month 13 - KLocale::LongName" -msgid "Adar I" -msgstr "अदर I" - -#: kcalendarsystemhebrew.cpp:791 -#, fuzzy -#| msgid "Adar II" -msgctxt "Hebrew month 14 - KLocale::LongName" -msgid "Adar II" -msgstr "अदर II" - -#: kcalendarsystemindiannational.cpp:66 -#, fuzzy -#| msgid "Safar" -msgctxt "Calendar Era: Indian National Saka Era, years > 0, LongFormat" -msgid "Saka Era" -msgstr "सफर" - -#: kcalendarsystemindiannational.cpp:67 -msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat" -msgid "SE" -msgstr "" - -#: kcalendarsystemindiannational.cpp:68 -#, c-format -msgctxt "" -"(kdedt-format) Indian National, SE, full era year format used for %EY, e.g. " -"2000 SE" -msgid "%Ey %EC" -msgstr "" - -#: kcalendarsystemindiannational.cpp:158 -msgctxt "Indian National month 1 - KLocale::NarrowName" -msgid "C" -msgstr "" - -#: kcalendarsystemindiannational.cpp:160 -msgctxt "Indian National month 2 - KLocale::NarrowName" -msgid "V" -msgstr "" - -#: kcalendarsystemindiannational.cpp:162 -msgctxt "Indian National month 3 - KLocale::NarrowName" -msgid "J" -msgstr "" - -#: kcalendarsystemindiannational.cpp:164 -#, fuzzy -msgctxt "Indian National month 4 - KLocale::NarrowName" -msgid "Ā" -msgstr "खोर का" - -#: kcalendarsystemindiannational.cpp:166 -msgctxt "Indian National month 5 - KLocale::NarrowName" -msgid "S" -msgstr "" - -#: kcalendarsystemindiannational.cpp:168 -msgctxt "Indian National month 6 - KLocale::NarrowName" -msgid "B" -msgstr "" - -#: kcalendarsystemindiannational.cpp:170 -#, fuzzy -msgctxt "Indian National month 7 - KLocale::NarrowName" -msgid "Ā" -msgstr "खोर का" - -#: kcalendarsystemindiannational.cpp:172 -msgctxt "Indian National month 8 - KLocale::NarrowName" -msgid "K" -msgstr "" - -#: kcalendarsystemindiannational.cpp:174 -#, fuzzy -#| msgid "Av" -msgctxt "Indian National month 9 - KLocale::NarrowName" -msgid "A" -msgstr "एव" - -#: kcalendarsystemindiannational.cpp:176 -msgctxt "Indian National month 10 - KLocale::NarrowName" -msgid "P" -msgstr "" - -#: kcalendarsystemindiannational.cpp:178 -msgctxt "Indian National month 11 - KLocale::NarrowName" -msgid "M" -msgstr "" - -#: kcalendarsystemindiannational.cpp:180 -msgctxt "Indian National month 12 - KLocale::NarrowName" -msgid "P" -msgstr "" - -#: kcalendarsystemindiannational.cpp:189 -#, fuzzy -msgctxt "Indian National month 1 - KLocale::ShortName Possessive" -msgid "of Cha" -msgstr "शाह का" - -#: kcalendarsystemindiannational.cpp:191 -#, fuzzy -msgctxt "Indian National month 2 - KLocale::ShortName Possessive" -msgid "of Vai" -msgstr "फर का" - -#: kcalendarsystemindiannational.cpp:193 -#, fuzzy -msgctxt "Indian National month 3 - KLocale::ShortName Possessive" -msgid "of Jya" -msgstr "जनवरी का" - -#: kcalendarsystemindiannational.cpp:195 -#, fuzzy -msgctxt "Indian National month 4 - KLocale::ShortName Possessive" -msgid "of Āsh" -msgstr "खोर का" - -#: kcalendarsystemindiannational.cpp:197 -#, fuzzy -msgctxt "Indian National month 5 - KLocale::ShortName Possessive" -msgid "of Shr" -msgstr "शाह का" - -#: kcalendarsystemindiannational.cpp:199 -#, fuzzy -msgctxt "Indian National month 6 - KLocale::ShortName Possessive" -msgid "of Bhā" -msgstr "बाह का" - -#: kcalendarsystemindiannational.cpp:201 -#, fuzzy -msgctxt "Indian National month 7 - KLocale::ShortName Possessive" -msgid "of Āsw" -msgstr "एसफ का" - -#: kcalendarsystemindiannational.cpp:203 -#, fuzzy -msgctxt "Indian National month 8 - KLocale::ShortName Possessive" -msgid "of Kār" -msgstr "फर का" - -#: kcalendarsystemindiannational.cpp:205 -#, fuzzy -msgctxt "Indian National month 9 - KLocale::ShortName Possessive" -msgid "of Agr" -msgstr "अप्रैल का" - -#: kcalendarsystemindiannational.cpp:207 -#, fuzzy -msgctxt "Indian National month 10 - KLocale::ShortName Possessive" -msgid "of Pau" -msgstr "तमुज का" - -#: kcalendarsystemindiannational.cpp:209 -#, fuzzy -msgctxt "Indian National month 11 - KLocale::ShortName Possessive" -msgid "of Māg" -msgstr "मोर का" - -#: kcalendarsystemindiannational.cpp:211 -#, fuzzy -msgctxt "Indian National month 12 - KLocale::ShortName Possessive" -msgid "of Phā" -msgstr "खोर का" - -#: kcalendarsystemindiannational.cpp:220 -#, fuzzy -msgctxt "Indian National month 1 - KLocale::ShortName" -msgid "Cha" -msgstr "गुरु" - -#: kcalendarsystemindiannational.cpp:222 -#, fuzzy -msgctxt "Indian National month 2 - KLocale::ShortName" -msgid "Vai" -msgstr "फर का" - -#: kcalendarsystemindiannational.cpp:224 -#, fuzzy -msgctxt "Indian National month 3 - KLocale::ShortName" -msgid "Jya" -msgstr "जन." - -#: kcalendarsystemindiannational.cpp:226 -#, fuzzy -msgctxt "Indian National month 4 - KLocale::ShortName" -msgid "Āsh" -msgstr "खोर का" - -#: kcalendarsystemindiannational.cpp:228 -#, fuzzy -msgctxt "Indian National month 5 - KLocale::ShortName" -msgid "Shr" -msgstr "शा" - -#: kcalendarsystemindiannational.cpp:230 -#, fuzzy -msgctxt "Indian National month 6 - KLocale::ShortName" -msgid "Bhā" -msgstr "बाह का" - -#: kcalendarsystemindiannational.cpp:232 -#, fuzzy -msgctxt "Indian National month 7 - KLocale::ShortName" -msgid "Āsw" -msgstr "एसफ का" - -#: kcalendarsystemindiannational.cpp:234 -#, fuzzy -msgctxt "Indian National month 8 - KLocale::ShortName" -msgid "Kār" -msgstr "फर का" - -#: kcalendarsystemindiannational.cpp:236 -#, fuzzy -msgctxt "Indian National month 9 - KLocale::ShortName" -msgid "Agr" -msgstr "बुध" - -#: kcalendarsystemindiannational.cpp:238 -#, fuzzy -msgctxt "Indian National month 10 - KLocale::ShortName" -msgid "Pau" -msgstr "ठहरें" - -#: kcalendarsystemindiannational.cpp:240 -#, fuzzy -msgctxt "Indian National month 11 - KLocale::ShortName" -msgid "Māg" -msgstr "मोर का" - -#: kcalendarsystemindiannational.cpp:242 -#, fuzzy -msgctxt "Indian National month 12 - KLocale::ShortName" -msgid "Phā" -msgstr "खोर का" - -#: kcalendarsystemindiannational.cpp:251 -#, fuzzy -msgctxt "Indian National month 1 - KLocale::LongName Possessive" -msgid "of Chaitra" -msgstr "मोहर्रम का" - -#: kcalendarsystemindiannational.cpp:253 -#, fuzzy -msgctxt "Indian National month 2 - KLocale::LongName Possessive" -msgid "of Vaishākh" -msgstr "फर का" - -#: kcalendarsystemindiannational.cpp:255 -#, fuzzy -msgctxt "Indian National month 3 - KLocale::LongName Possessive" -msgid "of Jyaishtha" -msgstr "निसान का" - -#: kcalendarsystemindiannational.cpp:257 -#, fuzzy -msgctxt "Indian National month 4 - KLocale::LongName Possessive" -msgid "of Āshādha" -msgstr "खोर का" - -#: kcalendarsystemindiannational.cpp:259 -#, fuzzy -msgctxt "Indian National month 5 - KLocale::LongName Possessive" -msgid "of Shrāvana" -msgstr "शवत का" - -#: kcalendarsystemindiannational.cpp:261 -#, fuzzy -msgctxt "Indian National month 6 - KLocale::LongName Possessive" -msgid "of Bhādrapad" -msgstr "खोरदाद का" - -#: kcalendarsystemindiannational.cpp:263 -#, fuzzy -msgctxt "Indian National month 7 - KLocale::LongName Possessive" -msgid "of Āshwin" -msgstr "हेशवान का" - -#: kcalendarsystemindiannational.cpp:265 -#, fuzzy -msgctxt "Indian National month 8 - KLocale::LongName Possessive" -msgid "of Kārtik" -msgstr "फर का" - -#: kcalendarsystemindiannational.cpp:267 -#, fuzzy -msgctxt "Indian National month 9 - KLocale::LongName Possessive" -msgid "of Agrahayana" -msgstr "बहमान का" - -#: kcalendarsystemindiannational.cpp:269 -#, fuzzy -msgctxt "Indian National month 10 - KLocale::LongName Possessive" -msgid "of Paush" -msgstr "बाह का" - -#: kcalendarsystemindiannational.cpp:271 -#, fuzzy -msgctxt "Indian National month 11 - KLocale::LongName Possessive" -msgid "of Māgh" -msgstr "मेह का" - -#: kcalendarsystemindiannational.cpp:273 -#, fuzzy -msgctxt "Indian National month 12 - KLocale::LongName Possessive" -msgid "of Phālgun" -msgstr "खोर का" - -#: kcalendarsystemindiannational.cpp:282 -#, fuzzy -msgctxt "Indian National month 1 - KLocale::LongName" -msgid "Chaitra" -msgstr "मोहर्रम का" - -#: kcalendarsystemindiannational.cpp:284 -#, fuzzy -msgctxt "Indian National month 2 - KLocale::LongName" -msgid "Vaishākh" -msgstr "फर का" - -#: kcalendarsystemindiannational.cpp:286 -#, fuzzy -msgctxt "Indian National month 3 - KLocale::LongName" -msgid "Jyaishtha" -msgstr "निसान का" - -#: kcalendarsystemindiannational.cpp:288 -#, fuzzy -msgctxt "Indian National month 4 - KLocale::LongName" -msgid "Āshādha" -msgstr "खोर का" - -#: kcalendarsystemindiannational.cpp:290 -#, fuzzy -msgctxt "Indian National month 5 - KLocale::LongName" -msgid "Shrāvana" -msgstr "शवत का" - -#: kcalendarsystemindiannational.cpp:292 -#, fuzzy -msgctxt "Indian National month 6 - KLocale::LongName" -msgid "Bhādrapad" -msgstr "खोरदाद का" - -#: kcalendarsystemindiannational.cpp:294 -#, fuzzy -msgctxt "Indian National month 7 - KLocale::LongName" -msgid "Āshwin" -msgstr "हेशवान का" - -#: kcalendarsystemindiannational.cpp:296 -#, fuzzy -msgctxt "Indian National month 8 - KLocale::LongName" -msgid "Kārtik" -msgstr "फर का" - -#: kcalendarsystemindiannational.cpp:298 -#, fuzzy -msgctxt "Indian National month 9 - KLocale::LongName" -msgid "Agrahayana" -msgstr "थाना" - -#: kcalendarsystemindiannational.cpp:300 -#, fuzzy -msgctxt "Indian National month 10 - KLocale::LongName" -msgid "Paush" -msgstr "ठहरें" - -#: kcalendarsystemindiannational.cpp:302 -#, fuzzy -msgctxt "Indian National month 11 - KLocale::LongName" -msgid "Māgh" -msgstr "मेह का" - -#: kcalendarsystemindiannational.cpp:304 -#, fuzzy -msgctxt "Indian National month 12 - KLocale::LongName" -msgid "Phālgun" -msgstr "खोर का" - -#: kcalendarsystemindiannational.cpp:317 -msgctxt "Indian National weekday 1 - KLocale::NarrowName " -msgid "S" -msgstr "" - -#: kcalendarsystemindiannational.cpp:319 -msgctxt "Indian National weekday 2 - KLocale::NarrowName " -msgid "M" -msgstr "" - -#: kcalendarsystemindiannational.cpp:321 -msgctxt "Indian National weekday 3 - KLocale::NarrowName " -msgid "B" -msgstr "" - -#: kcalendarsystemindiannational.cpp:323 -msgctxt "Indian National weekday 4 - KLocale::NarrowName " -msgid "G" -msgstr "" - -#: kcalendarsystemindiannational.cpp:325 -msgctxt "Indian National weekday 5 - KLocale::NarrowName " -msgid "S" -msgstr "" - -#: kcalendarsystemindiannational.cpp:327 -msgctxt "Indian National weekday 6 - KLocale::NarrowName " -msgid "S" -msgstr "" - -#: kcalendarsystemindiannational.cpp:329 -msgctxt "Indian National weekday 7 - KLocale::NarrowName " -msgid "R" -msgstr "" - -#: kcalendarsystemindiannational.cpp:338 -#, fuzzy -msgctxt "Indian National weekday 1 - KLocale::ShortName" -msgid "Som" -msgstr "Jom" - -#: kcalendarsystemindiannational.cpp:340 -msgctxt "Indian National weekday 2 - KLocale::ShortName" -msgid "Mañ" -msgstr "" - -#: kcalendarsystemindiannational.cpp:342 -#, fuzzy -msgctxt "Indian National weekday 3 - KLocale::ShortName" -msgid "Bud" -msgstr "बुहीद" - -#: kcalendarsystemindiannational.cpp:344 -msgctxt "Indian National weekday 4 - KLocale::ShortName" -msgid "Gur" -msgstr "" - -#: kcalendarsystemindiannational.cpp:346 -#, fuzzy -msgctxt "Indian National weekday 5 - KLocale::ShortName" -msgid "Suk" -msgstr "रवि" - -#: kcalendarsystemindiannational.cpp:348 -#, fuzzy -msgctxt "Indian National weekday 6 - KLocale::ShortName" -msgid "San" -msgstr "सिवान" - -#: kcalendarsystemindiannational.cpp:350 -msgctxt "Indian National weekday 7 - KLocale::ShortName" -msgid "Rav" -msgstr "" - -#: kcalendarsystemindiannational.cpp:357 -msgctxt "Indian National weekday 1 - KLocale::LongName" -msgid "Somavãra" -msgstr "" - -#: kcalendarsystemindiannational.cpp:359 -msgctxt "Indian National weekday 2 - KLocale::LongName" -msgid "Mañgalvã" -msgstr "" - -#: kcalendarsystemindiannational.cpp:361 -msgctxt "Indian National weekday 3 - KLocale::LongName" -msgid "Budhavãra" -msgstr "" - -#: kcalendarsystemindiannational.cpp:363 -msgctxt "Indian National weekday 4 - KLocale::LongName" -msgid "Guruvãra" -msgstr "" - -#: kcalendarsystemindiannational.cpp:365 -msgctxt "Indian National weekday 5 - KLocale::LongName" -msgid "Sukravãra" -msgstr "" - -#: kcalendarsystemindiannational.cpp:367 -msgctxt "Indian National weekday 6 - KLocale::LongName" -msgid "Sanivãra" -msgstr "" - -#: kcalendarsystemindiannational.cpp:369 -msgctxt "Indian National weekday 7 - KLocale::LongName" -msgid "Raviãra" -msgstr "" - -#: kcalendarsystemislamiccivil.cpp:66 -msgctxt "Calendar Era: Hijri Islamic Era, years > 0, LongFormat" -msgid "Anno Hegirae" -msgstr "" - -#: kcalendarsystemislamiccivil.cpp:67 -msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat" -msgid "AH" -msgstr "" - -#: kcalendarsystemislamiccivil.cpp:68 -#, c-format -msgctxt "" -"(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH" -msgid "%Ey %EC" -msgstr "" - -#: kcalendarsystemislamiccivil.cpp:166 -msgctxt "Hijri month 1 - KLocale::NarrowName" -msgid "M" -msgstr "" - -#: kcalendarsystemislamiccivil.cpp:168 -msgctxt "Hijri month 2 - KLocale::NarrowName" -msgid "S" -msgstr "" - -#: kcalendarsystemislamiccivil.cpp:170 -#, fuzzy -#| msgid "Av" -msgctxt "Hijri month 3 - KLocale::NarrowName" -msgid "A" -msgstr "एव" - -#: kcalendarsystemislamiccivil.cpp:172 -msgctxt "Hijri month 4 - KLocale::NarrowName" -msgid "T" -msgstr "" - -#: kcalendarsystemislamiccivil.cpp:174 -#, fuzzy -#| msgid "Av" -msgctxt "Hijri month 5 - KLocale::NarrowName" -msgid "A" -msgstr "एव" - -#: kcalendarsystemislamiccivil.cpp:176 -msgctxt "Hijri month 6 - KLocale::NarrowName" -msgid "T" -msgstr "" - -#: kcalendarsystemislamiccivil.cpp:178 -msgctxt "Hijri month 7 - KLocale::NarrowName" -msgid "R" -msgstr "" - -#: kcalendarsystemislamiccivil.cpp:180 -msgctxt "Hijri month 8 - KLocale::NarrowName" -msgid "S" -msgstr "" - -#: kcalendarsystemislamiccivil.cpp:182 -msgctxt "Hijri month 9 - KLocale::NarrowName" -msgid "R" -msgstr "" - -#: kcalendarsystemislamiccivil.cpp:184 -msgctxt "Hijri month 10 - KLocale::NarrowName" -msgid "S" -msgstr "" - -#: kcalendarsystemislamiccivil.cpp:186 -msgctxt "Hijri month 11 - KLocale::NarrowName" -msgid "Q" -msgstr "" - -#: kcalendarsystemislamiccivil.cpp:188 -msgctxt "Hijri month 12 - KLocale::NarrowName" -msgid "H" -msgstr "" - -#: kcalendarsystemislamiccivil.cpp:197 -#, fuzzy -#| msgctxt "of Mehr short" -#| msgid "of Meh" -msgctxt "Hijri month 1 - KLocale::ShortName Possessive" -msgid "of Muh" -msgstr "मेह का" - -#: kcalendarsystemislamiccivil.cpp:199 -#, fuzzy -#| msgid "of Safar" -msgctxt "Hijri month 2 - KLocale::ShortName Possessive" -msgid "of Saf" -msgstr "सफर का" - -#: kcalendarsystemislamiccivil.cpp:201 -#, fuzzy -#| msgid "of R. Awal" -msgctxt "Hijri month 3 - KLocale::ShortName Possessive" -msgid "of R.A" -msgstr "र. अव्वल का" - -#: kcalendarsystemislamiccivil.cpp:203 -#, fuzzy -#| msgid "of R. Thaani" -msgctxt "Hijri month 4 - KLocale::ShortName Possessive" -msgid "of R.T" -msgstr "र. उस्सानी का" - -#: kcalendarsystemislamiccivil.cpp:205 -#, fuzzy -#| msgid "of J. Awal" -msgctxt "Hijri month 5 - KLocale::ShortName Possessive" -msgid "of J.A" -msgstr "ज. अव्वल का" - -#: kcalendarsystemislamiccivil.cpp:207 -#, fuzzy -#| msgid "of J. Thaani" -msgctxt "Hijri month 6 - KLocale::ShortName Possessive" -msgid "of J.T" -msgstr "ज. उस्सानी का" - -#: kcalendarsystemislamiccivil.cpp:209 -#, fuzzy -#| msgid "of Rajab" -msgctxt "Hijri month 7 - KLocale::ShortName Possessive" -msgid "of Raj" -msgstr "रज्जब का" - -#: kcalendarsystemislamiccivil.cpp:211 -#, fuzzy -#| msgctxt "of Shahrivar short" -#| msgid "of Sha" -msgctxt "Hijri month 8 - KLocale::ShortName Possessive" -msgid "of Sha" -msgstr "शाह का" - -#: kcalendarsystemislamiccivil.cpp:213 -#, fuzzy -msgctxt "Hijri month 9 - KLocale::ShortName Possessive" -msgid "of Ram" -msgstr "तमुज का" - -#: kcalendarsystemislamiccivil.cpp:215 -#, fuzzy -#| msgctxt "of Shahrivar short" -#| msgid "of Sha" -msgctxt "Hijri month 10 - KLocale::ShortName Possessive" -msgid "of Shw" -msgstr "शाह का" - -#: kcalendarsystemislamiccivil.cpp:217 -#, fuzzy -#| msgid "of Qi`dah" -msgctxt "Hijri month 11 - KLocale::ShortName Possessive" -msgid "of Qid" -msgstr "जिल्काद का" - -#: kcalendarsystemislamiccivil.cpp:219 -#, fuzzy -#| msgid "of Hijjah" -msgctxt "Hijri month 12 - KLocale::ShortName Possessive" -msgid "of Hij" -msgstr "जिल्हज का" - -#: kcalendarsystemislamiccivil.cpp:228 -#, fuzzy -#| msgctxt "Mehr short" -#| msgid "Meh" -msgctxt "Hijri month 1 - KLocale::ShortName" -msgid "Muh" -msgstr "मेह" - -#: kcalendarsystemislamiccivil.cpp:230 -#, fuzzy -#| msgid "Safar" -msgctxt "Hijri month 2 - KLocale::ShortName" -msgid "Saf" -msgstr "सफर" - -#: kcalendarsystemislamiccivil.cpp:232 -#, fuzzy -#| msgid "R. Awal" -msgctxt "Hijri month 3 - KLocale::ShortName" -msgid "R.A" -msgstr "र. अव्वल" - -#: kcalendarsystemislamiccivil.cpp:234 -msgctxt "Hijri month 4 - KLocale::ShortName" -msgid "R.T" -msgstr "" - -#: kcalendarsystemislamiccivil.cpp:236 -#, fuzzy -#| msgid "J. Awal" -msgctxt "Hijri month 5 - KLocale::ShortName" -msgid "J.A" -msgstr "ज. अव्वल" - -#: kcalendarsystemislamiccivil.cpp:238 -msgctxt "Hijri month 6 - KLocale::ShortName" -msgid "J.T" -msgstr "" - -#: kcalendarsystemislamiccivil.cpp:240 -#, fuzzy -#| msgid "Rajab" -msgctxt "Hijri month 7 - KLocale::ShortName" -msgid "Raj" -msgstr "रज्जब" - -#: kcalendarsystemislamiccivil.cpp:242 -#, fuzzy -#| msgctxt "Shahrivar short" -#| msgid "Sha" -msgctxt "Hijri month 8 - KLocale::ShortName" -msgid "Sha" -msgstr "शा" - -#: kcalendarsystemislamiccivil.cpp:244 -#, fuzzy -msgctxt "Hijri month 9 - KLocale::ShortName" -msgid "Ram" -msgstr "पूर्वाह्न" - -#: kcalendarsystemislamiccivil.cpp:246 -#, fuzzy -#| msgctxt "Shahrivar short" -#| msgid "Sha" -msgctxt "Hijri month 10 - KLocale::ShortName" -msgid "Shw" -msgstr "शा" - -#: kcalendarsystemislamiccivil.cpp:248 -#, fuzzy -#| msgid "Qi`dah" -msgctxt "Hijri month 11 - KLocale::ShortName" -msgid "Qid" -msgstr "जिल्काद" - -#: kcalendarsystemislamiccivil.cpp:250 -#, fuzzy -#| msgctxt "@item Calendar system" -#| msgid "Hijri" -msgctxt "Hijri month 12 - KLocale::ShortName" -msgid "Hij" -msgstr "हिजरी" - -#: kcalendarsystemislamiccivil.cpp:259 -#, fuzzy -#| msgid "of Muharram" -msgctxt "Hijri month 1 - KLocale::LongName Possessive" -msgid "of Muharram" -msgstr "मोहर्रम का" - -#: kcalendarsystemislamiccivil.cpp:261 -#, fuzzy -#| msgid "of Safar" -msgctxt "Hijri month 2 - KLocale::LongName Possessive" -msgid "of Safar" -msgstr "सफर का" - -#: kcalendarsystemislamiccivil.cpp:263 -#, fuzzy -#| msgid "of Rabi` al-Awal" -msgctxt "Hijri month 3 - KLocale::LongName Possessive" -msgid "of Rabi` al-Awal" -msgstr "रबी उल-अव्वल का" - -#: kcalendarsystemislamiccivil.cpp:265 -#, fuzzy -#| msgid "of Rabi` al-Thaani" -msgctxt "Hijri month 4 - KLocale::LongName Possessive" -msgid "of Rabi` al-Thaani" -msgstr "रबी उस्सानी का " - -#: kcalendarsystemislamiccivil.cpp:267 -#, fuzzy -#| msgid "of Jumaada al-Awal" -msgctxt "Hijri month 5 - KLocale::LongName Possessive" -msgid "of Jumaada al-Awal" -msgstr "जमादिल अव्वल" - -#: kcalendarsystemislamiccivil.cpp:269 -#, fuzzy -#| msgid "of Jumaada al-Thaani" -msgctxt "Hijri month 6 - KLocale::LongName Possessive" -msgid "of Jumaada al-Thaani" -msgstr "जमादिल उस्सानी" - -#: kcalendarsystemislamiccivil.cpp:271 -#, fuzzy -#| msgid "of Rajab" -msgctxt "Hijri month 7 - KLocale::LongName Possessive" -msgid "of Rajab" -msgstr "रज्जब का" - -#: kcalendarsystemislamiccivil.cpp:273 -#, fuzzy -#| msgid "of Sha`ban" -msgctxt "Hijri month 8 - KLocale::LongName Possessive" -msgid "of Sha`ban" -msgstr "शाबान का" - -#: kcalendarsystemislamiccivil.cpp:275 -#, fuzzy -#| msgid "of Ramadan" -msgctxt "Hijri month 9 - KLocale::LongName Possessive" -msgid "of Ramadan" -msgstr "रमज़ान का" - -#: kcalendarsystemislamiccivil.cpp:277 -#, fuzzy -#| msgid "of Shawwal" -msgctxt "Hijri month 10 - KLocale::LongName Possessive" -msgid "of Shawwal" -msgstr "शब्बाल का" - -#: kcalendarsystemislamiccivil.cpp:279 -#, fuzzy -#| msgid "of Thu al-Qi`dah" -msgctxt "Hijri month 11 - KLocale::LongName Possessive" -msgid "of Thu al-Qi`dah" -msgstr "तू जिल्काद का" - -#: kcalendarsystemislamiccivil.cpp:281 -#, fuzzy -#| msgid "of Thu al-Hijjah" -msgctxt "Hijri month 12 - KLocale::LongName Possessive" -msgid "of Thu al-Hijjah" -msgstr "तू जिल्हज का " - -#: kcalendarsystemislamiccivil.cpp:290 -#, fuzzy -#| msgid "Muharram" -msgctxt "Hijri month 1 - KLocale::LongName" -msgid "Muharram" -msgstr "मोहर्रम" - -#: kcalendarsystemislamiccivil.cpp:292 -#, fuzzy -#| msgid "Safar" -msgctxt "Hijri month 2 - KLocale::LongName" -msgid "Safar" -msgstr "सफर" - -#: kcalendarsystemislamiccivil.cpp:294 -#, fuzzy -#| msgid "Rabi` al-Awal" -msgctxt "Hijri month 3 - KLocale::LongName" -msgid "Rabi` al-Awal" -msgstr "रबि उल-अव्वल" - -#: kcalendarsystemislamiccivil.cpp:296 -#, fuzzy -#| msgid "Rabi` al-Thaani" -msgctxt "Hijri month 4 - KLocale::LongName" -msgid "Rabi` al-Thaani" -msgstr "रबि उस्सानी" - -#: kcalendarsystemislamiccivil.cpp:298 -#, fuzzy -#| msgid "Jumaada al-Awal" -msgctxt "Hijri month 5 - KLocale::LongName" -msgid "Jumaada al-Awal" -msgstr "जमादिल अव्वल" - -#: kcalendarsystemislamiccivil.cpp:300 -#, fuzzy -#| msgid "Jumaada al-Thaani" -msgctxt "Hijri month 6 - KLocale::LongName" -msgid "Jumaada al-Thaani" -msgstr "जमादिल उस्सानी" - -#: kcalendarsystemislamiccivil.cpp:302 -#, fuzzy -#| msgid "Rajab" -msgctxt "Hijri month 7 - KLocale::LongName" -msgid "Rajab" -msgstr "रज्जब" - -#: kcalendarsystemislamiccivil.cpp:304 -#, fuzzy -#| msgid "Sha`ban" -msgctxt "Hijri month 8 - KLocale::LongName" -msgid "Sha`ban" -msgstr "शाबान" - -#: kcalendarsystemislamiccivil.cpp:306 -#, fuzzy -#| msgid "Ramadan" -msgctxt "Hijri month 9 - KLocale::LongName" -msgid "Ramadan" -msgstr "रमज़ान" - -#: kcalendarsystemislamiccivil.cpp:308 -#, fuzzy -#| msgid "Shawwal" -msgctxt "Hijri month 10 - KLocale::LongName" -msgid "Shawwal" -msgstr "शब्बाल" - -#: kcalendarsystemislamiccivil.cpp:310 -#, fuzzy -#| msgid "Thu al-Qi`dah" -msgctxt "Hijri month 11 - KLocale::LongName" -msgid "Thu al-Qi`dah" -msgstr "तू जिल्काद" - -#: kcalendarsystemislamiccivil.cpp:312 -#, fuzzy -#| msgid "Thu al-Hijjah" -msgctxt "Hijri month 12 - KLocale::LongName" -msgid "Thu al-Hijjah" -msgstr "तू जिल्हज" - -#: kcalendarsystemislamiccivil.cpp:325 -msgctxt "Hijri weekday 1 - KLocale::NarrowName " -msgid "I" -msgstr "" - -#: kcalendarsystemislamiccivil.cpp:327 -msgctxt "Hijri weekday 2 - KLocale::NarrowName " -msgid "T" -msgstr "" - -#: kcalendarsystemislamiccivil.cpp:329 -#, fuzzy -#| msgid "Av" -msgctxt "Hijri weekday 3 - KLocale::NarrowName " -msgid "A" -msgstr "एव" - -#: kcalendarsystemislamiccivil.cpp:331 -msgctxt "Hijri weekday 4 - KLocale::NarrowName " -msgid "K" -msgstr "" - -#: kcalendarsystemislamiccivil.cpp:333 -msgctxt "Hijri weekday 5 - KLocale::NarrowName " -msgid "J" -msgstr "" - -#: kcalendarsystemislamiccivil.cpp:335 -msgctxt "Hijri weekday 6 - KLocale::NarrowName " -msgid "S" -msgstr "" - -#: kcalendarsystemislamiccivil.cpp:337 -#, fuzzy -#| msgid "Av" -msgctxt "Hijri weekday 7 - KLocale::NarrowName " -msgid "A" -msgstr "एव" - -#: kcalendarsystemislamiccivil.cpp:346 -#, fuzzy -#| msgid "Ith" -msgctxt "Hijri weekday 1 - KLocale::ShortName" -msgid "Ith" -msgstr "सोम" - -#: kcalendarsystemislamiccivil.cpp:348 -#, fuzzy -#| msgid "Thl" -msgctxt "Hijri weekday 2 - KLocale::ShortName" -msgid "Thl" -msgstr "मंगल" - -#: kcalendarsystemislamiccivil.cpp:350 -#, fuzzy -#| msgid "Arb" -msgctxt "Hijri weekday 3 - KLocale::ShortName" -msgid "Arb" -msgstr "बुध" - -#: kcalendarsystemislamiccivil.cpp:352 -#, fuzzy -#| msgid "Kha" -msgctxt "Hijri weekday 4 - KLocale::ShortName" -msgid "Kha" -msgstr "गुरु" - -#: kcalendarsystemislamiccivil.cpp:354 -#, fuzzy -#| msgid "Jum" -msgctxt "Hijri weekday 5 - KLocale::ShortName" -msgid "Jum" -msgstr "शुक्र" - -#: kcalendarsystemislamiccivil.cpp:356 -#, fuzzy -#| msgid "Sab" -msgctxt "Hijri weekday 6 - KLocale::ShortName" -msgid "Sab" -msgstr "शनि" - -#: kcalendarsystemislamiccivil.cpp:358 -#, fuzzy -#| msgid "Ahd" -msgctxt "Hijri weekday 7 - KLocale::ShortName" -msgid "Ahd" -msgstr "रवि" - -#: kcalendarsystemislamiccivil.cpp:365 -#, fuzzy -#| msgid "Yaum al-Ithnain" -msgctxt "Hijri weekday 1 - KLocale::LongName" -msgid "Yaum al-Ithnain" -msgstr "यम अल-इथन" - -#: kcalendarsystemislamiccivil.cpp:367 -#, fuzzy -#| msgid "Yau al-Thulatha" -msgctxt "Hijri weekday 2 - KLocale::LongName" -msgid "Yau al-Thulatha" -msgstr "या अल-दलथ" - -#: kcalendarsystemislamiccivil.cpp:369 -#, fuzzy -#| msgid "Yaum al-Arbi'a" -msgctxt "Hijri weekday 3 - KLocale::LongName" -msgid "Yaum al-Arbi'a" -msgstr "यम अल-अरबिया" - -#: kcalendarsystemislamiccivil.cpp:371 -#, fuzzy -#| msgid "Yaum al-Khamees" -msgctxt "Hijri weekday 4 - KLocale::LongName" -msgid "Yaum al-Khamees" -msgstr "यम अल-खमीज़" - -#: kcalendarsystemislamiccivil.cpp:373 -#, fuzzy -#| msgid "Yaum al-Jumma" -msgctxt "Hijri weekday 5 - KLocale::LongName" -msgid "Yaum al-Jumma" -msgstr "यम अल-जुमा" - -#: kcalendarsystemislamiccivil.cpp:375 -#, fuzzy -#| msgid "Yaum al-Sabt" -msgctxt "Hijri weekday 6 - KLocale::LongName" -msgid "Yaum al-Sabt" -msgstr "यम अल-सब्त" - -#: kcalendarsystemislamiccivil.cpp:377 -#, fuzzy -#| msgid "Yaum al-Ahad" -msgctxt "Hijri weekday 7 - KLocale::LongName" -msgid "Yaum al-Ahad" -msgstr "यम अल-अहद" - -#: kcalendarsystemjalali.cpp:74 -msgctxt "Calendar Era: Jalali Islamic Era, years > 0, LongFormat" -msgid "Anno Persico" -msgstr "" - -#: kcalendarsystemjalali.cpp:75 -msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat" -msgid "AP" -msgstr "" - -#: kcalendarsystemjalali.cpp:76 -#, c-format -msgctxt "" -"(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP" -msgid "%Ey %EC" -msgstr "" - -#: kcalendarsystemjalali.cpp:172 -msgctxt "Jalali month 1 - KLocale::NarrowName" -msgid "F" -msgstr "" - -#: kcalendarsystemjalali.cpp:174 -msgctxt "Jalali month 2 - KLocale::NarrowName" -msgid "O" -msgstr "" - -#: kcalendarsystemjalali.cpp:176 -msgctxt "Jalali month 3 - KLocale::NarrowName" -msgid "K" -msgstr "" - -#: kcalendarsystemjalali.cpp:178 -msgctxt "Jalali month 4 - KLocale::NarrowName" -msgid "T" -msgstr "" - -#: kcalendarsystemjalali.cpp:180 -msgctxt "Jalali month 5 - KLocale::NarrowName" -msgid "M" -msgstr "" - -#: kcalendarsystemjalali.cpp:182 -msgctxt "Jalali month 6 - KLocale::NarrowName" -msgid "S" -msgstr "" - -#: kcalendarsystemjalali.cpp:184 -msgctxt "Jalali month 7 - KLocale::NarrowName" -msgid "M" -msgstr "" - -#: kcalendarsystemjalali.cpp:186 -#, fuzzy -#| msgid "Av" -msgctxt "Jalali month 8 - KLocale::NarrowName" -msgid "A" -msgstr "एव" - -#: kcalendarsystemjalali.cpp:188 -#, fuzzy -#| msgid "Av" -msgctxt "Jalali month 9 - KLocale::NarrowName" -msgid "A" -msgstr "एव" - -#: kcalendarsystemjalali.cpp:190 -msgctxt "Jalali month 10 - KLocale::NarrowName" -msgid "D" -msgstr "" - -#: kcalendarsystemjalali.cpp:192 -msgctxt "Jalali month 11 - KLocale::NarrowName" -msgid "B" -msgstr "" - -#: kcalendarsystemjalali.cpp:194 -msgctxt "Jalali month 12 - KLocale::NarrowName" -msgid "E" -msgstr "" - -#: kcalendarsystemjalali.cpp:203 -#, fuzzy -#| msgctxt "of Farvardin short" -#| msgid "of Far" -msgctxt "Jalali month 1 - KLocale::ShortName Possessive" -msgid "of Far" -msgstr "फर का" - -#: kcalendarsystemjalali.cpp:205 -#, fuzzy -#| msgctxt "of Ordibehesht short" -#| msgid "of Ord" -msgctxt "Jalali month 2 - KLocale::ShortName Possessive" -msgid "of Ord" -msgstr "ओरदी का" - -#: kcalendarsystemjalali.cpp:207 -#, fuzzy -#| msgctxt "of Khordad short" -#| msgid "of Kho" -msgctxt "Jalali month 3 - KLocale::ShortName Possessive" -msgid "of Kho" -msgstr "खोर का" - -#: kcalendarsystemjalali.cpp:209 -#, fuzzy -#| msgctxt "of Tir short" -#| msgid "of Tir" -msgctxt "Jalali month 4 - KLocale::ShortName Possessive" -msgid "of Tir" -msgstr "तिर का" - -#: kcalendarsystemjalali.cpp:211 -#, fuzzy -#| msgctxt "of Mordad short" -#| msgid "of Mor" -msgctxt "Jalali month 5 - KLocale::ShortName Possessive" -msgid "of Mor" -msgstr "मोर का" - -#: kcalendarsystemjalali.cpp:213 -#, fuzzy -#| msgctxt "of Shahrivar short" -#| msgid "of Sha" -msgctxt "Jalali month 6 - KLocale::ShortName Possessive" -msgid "of Sha" -msgstr "शाह का" - -#: kcalendarsystemjalali.cpp:215 -#, fuzzy -#| msgctxt "of Mehr short" -#| msgid "of Meh" -msgctxt "Jalali month 7 - KLocale::ShortName Possessive" -msgid "of Meh" -msgstr "मेह का" - -#: kcalendarsystemjalali.cpp:217 -#, fuzzy -#| msgctxt "of Aban short" -#| msgid "of Aba" -msgctxt "Jalali month 8 - KLocale::ShortName Possessive" -msgid "of Aba" -msgstr "अबा का" - -#: kcalendarsystemjalali.cpp:219 -#, fuzzy -#| msgctxt "of Azar short" -#| msgid "of Aza" -msgctxt "Jalali month 9 - KLocale::ShortName Possessive" -msgid "of Aza" -msgstr "अज का" - -#: kcalendarsystemjalali.cpp:221 -#, fuzzy -#| msgctxt "of Dei short" -#| msgid "of Dei" -msgctxt "Jalali month 10 - KLocale::ShortName Possessive" -msgid "of Dei" -msgstr "देई का" - -#: kcalendarsystemjalali.cpp:223 -#, fuzzy -#| msgctxt "of Bahman short" -#| msgid "of Bah" -msgctxt "Jalali month 11 - KLocale::ShortName Possessive" -msgid "of Bah" -msgstr "बाह का" - -#: kcalendarsystemjalali.cpp:225 -#, fuzzy -#| msgctxt "of Esfand short" -#| msgid "of Esf" -msgctxt "Jalali month 12 - KLocale::ShortName Possessive" -msgid "of Esf" -msgstr "एसफ का" - -#: kcalendarsystemjalali.cpp:234 -#, fuzzy -#| msgctxt "Farvardin short" -#| msgid "Far" -msgctxt "Jalali month 1 - KLocale::ShortName" -msgid "Far" -msgstr "फर" - -#: kcalendarsystemjalali.cpp:236 -#, fuzzy -#| msgctxt "Ordibehesht short" -#| msgid "Ord" -msgctxt "Jalali month 2 - KLocale::ShortName" -msgid "Ord" -msgstr "आर्द" - -#: kcalendarsystemjalali.cpp:238 -#, fuzzy -#| msgctxt "Khordad short" -#| msgid "Kho" -msgctxt "Jalali month 3 - KLocale::ShortName" -msgid "Kho" -msgstr "खोर" - -#: kcalendarsystemjalali.cpp:240 -#, fuzzy -#| msgctxt "Tir short" -#| msgid "Tir" -msgctxt "Jalali month 4 - KLocale::ShortName" -msgid "Tir" -msgstr "तिर" - -#: kcalendarsystemjalali.cpp:242 -#, fuzzy -#| msgctxt "Mordad short" -#| msgid "Mor" -msgctxt "Jalali month 5 - KLocale::ShortName" -msgid "Mor" -msgstr "मोर" - -#: kcalendarsystemjalali.cpp:244 -#, fuzzy -#| msgctxt "Shahrivar short" -#| msgid "Sha" -msgctxt "Jalali month 6 - KLocale::ShortName" -msgid "Sha" -msgstr "शा" - -#: kcalendarsystemjalali.cpp:246 -#, fuzzy -#| msgctxt "Mehr short" -#| msgid "Meh" -msgctxt "Jalali month 7 - KLocale::ShortName" -msgid "Meh" -msgstr "मेह" - -#: kcalendarsystemjalali.cpp:248 -#, fuzzy -#| msgctxt "Aban short" -#| msgid "Aba" -msgctxt "Jalali month 8 - KLocale::ShortName" -msgid "Aba" -msgstr "अबा" - -#: kcalendarsystemjalali.cpp:250 -#, fuzzy -#| msgctxt "Azar short" -#| msgid "Aza" -msgctxt "Jalali month 9 - KLocale::ShortName" -msgid "Aza" -msgstr "अज" - -#: kcalendarsystemjalali.cpp:252 -#, fuzzy -#| msgctxt "Dei short" -#| msgid "Dei" -msgctxt "Jalali month 10 - KLocale::ShortName" -msgid "Dei" -msgstr "देई" - -#: kcalendarsystemjalali.cpp:254 -#, fuzzy -#| msgctxt "Bahman short" -#| msgid "Bah" -msgctxt "Jalali month 11 - KLocale::ShortName" -msgid "Bah" -msgstr "बाह" - -#: kcalendarsystemjalali.cpp:256 -#, fuzzy -#| msgctxt "Esfand" -#| msgid "Esf" -msgctxt "Jalali month 12 - KLocale::ShortName" -msgid "Esf" -msgstr "एस" - -#: kcalendarsystemjalali.cpp:265 -#, fuzzy -#| msgid "of Farvardin" -msgctxt "Jalali month 1 - KLocale::LongName Possessive" -msgid "of Farvardin" -msgstr "फवरदीन का" - -#: kcalendarsystemjalali.cpp:267 -#, fuzzy -#| msgid "of Ordibehesht" -msgctxt "Jalali month 2 - KLocale::LongName Possessive" -msgid "of Ordibehesht" -msgstr "ऑरदीबेहेस्त का" - -#: kcalendarsystemjalali.cpp:269 -#, fuzzy -#| msgid "of Khordad" -msgctxt "Jalali month 3 - KLocale::LongName Possessive" -msgid "of Khordad" -msgstr "खोरदाद का" - -#: kcalendarsystemjalali.cpp:271 -#, fuzzy -#| msgctxt "of Tir short" -#| msgid "of Tir" -msgctxt "Jalali month 4 - KLocale::LongName Possessive" -msgid "of Tir" -msgstr "तिर का" - -#: kcalendarsystemjalali.cpp:273 -#, fuzzy -#| msgid "of Mordad" -msgctxt "Jalali month 5 - KLocale::LongName Possessive" -msgid "of Mordad" -msgstr "मोरदाद का" - -#: kcalendarsystemjalali.cpp:275 -#, fuzzy -#| msgid "of Shahrivar" -msgctxt "Jalali month 6 - KLocale::LongName Possessive" -msgid "of Shahrivar" -msgstr "शाहहिरवार का" - -#: kcalendarsystemjalali.cpp:277 -#, fuzzy -#| msgid "of Mehr" -msgctxt "Jalali month 7 - KLocale::LongName Possessive" -msgid "of Mehr" -msgstr "मेहर का" - -#: kcalendarsystemjalali.cpp:279 -#, fuzzy -#| msgid "of Aban" -msgctxt "Jalali month 8 - KLocale::LongName Possessive" -msgid "of Aban" -msgstr "अबान का" - -#: kcalendarsystemjalali.cpp:281 -#, fuzzy -#| msgid "of Azar" -msgctxt "Jalali month 9 - KLocale::LongName Possessive" -msgid "of Azar" -msgstr "अजर का" - -#: kcalendarsystemjalali.cpp:283 -#, fuzzy -#| msgctxt "of Dei short" -#| msgid "of Dei" -msgctxt "Jalali month 10 - KLocale::LongName Possessive" -msgid "of Dei" -msgstr "देई का" - -#: kcalendarsystemjalali.cpp:285 -#, fuzzy -#| msgid "of Bahman" -msgctxt "Jalali month 11 - KLocale::LongName Possessive" -msgid "of Bahman" -msgstr "बहमान का" - -#: kcalendarsystemjalali.cpp:287 -#, fuzzy -#| msgid "of Esfand" -msgctxt "Jalali month 12 - KLocale::LongName Possessive" -msgid "of Esfand" -msgstr "एसफंद का" - -#: kcalendarsystemjalali.cpp:296 -#, fuzzy -#| msgid "Farvardin" -msgctxt "Jalali month 1 - KLocale::LongName" -msgid "Farvardin" -msgstr "फरवरदीन" - -#: kcalendarsystemjalali.cpp:298 -#, fuzzy -#| msgid "Ordibehesht" -msgctxt "Jalali month 2 - KLocale::LongName" -msgid "Ordibehesht" -msgstr "ओरदीबेहेस्त" - -#: kcalendarsystemjalali.cpp:300 -#, fuzzy -#| msgid "Khordad" -msgctxt "Jalali month 3 - KLocale::LongName" -msgid "Khordad" -msgstr "खोरदाद" - -#: kcalendarsystemjalali.cpp:302 -#, fuzzy -#| msgctxt "Tir short" -#| msgid "Tir" -msgctxt "Jalali month 4 - KLocale::LongName" -msgid "Tir" -msgstr "तिर" - -#: kcalendarsystemjalali.cpp:304 -#, fuzzy -#| msgid "Mordad" -msgctxt "Jalali month 5 - KLocale::LongName" -msgid "Mordad" -msgstr "मोरदाद" - -#: kcalendarsystemjalali.cpp:306 -#, fuzzy -#| msgid "Shahrivar" -msgctxt "Jalali month 6 - KLocale::LongName" -msgid "Shahrivar" -msgstr "शाहरिवार" - -#: kcalendarsystemjalali.cpp:308 -#, fuzzy -#| msgid "Mehr" -msgctxt "Jalali month 7 - KLocale::LongName" -msgid "Mehr" -msgstr "मेहर" - -#: kcalendarsystemjalali.cpp:310 -#, fuzzy -#| msgid "Aban" -msgctxt "Jalali month 8 - KLocale::LongName" -msgid "Aban" -msgstr "अबान" - -#: kcalendarsystemjalali.cpp:312 -#, fuzzy -#| msgid "Azar" -msgctxt "Jalali month 9 - KLocale::LongName" -msgid "Azar" -msgstr "अजर" - -#: kcalendarsystemjalali.cpp:314 -#, fuzzy -#| msgctxt "Dei short" -#| msgid "Dei" -msgctxt "Jalali month 10 - KLocale::LongName" -msgid "Dei" -msgstr "देई" - -#: kcalendarsystemjalali.cpp:316 -#, fuzzy -#| msgid "Bahman" -msgctxt "Jalali month 11 - KLocale::LongName" -msgid "Bahman" -msgstr "बहमान" - -#: kcalendarsystemjalali.cpp:318 -#, fuzzy -#| msgid "Esfand" -msgctxt "Jalali month 12 - KLocale::LongName" -msgid "Esfand" -msgstr "एसफंद" - -#: kcalendarsystemjalali.cpp:331 -msgctxt "Jalali weekday 1 - KLocale::NarrowName " -msgid "2" -msgstr "" - -#: kcalendarsystemjalali.cpp:333 -msgctxt "Jalali weekday 2 - KLocale::NarrowName " -msgid "3" -msgstr "" - -#: kcalendarsystemjalali.cpp:335 -msgctxt "Jalali weekday 3 - KLocale::NarrowName " -msgid "4" -msgstr "" - -#: kcalendarsystemjalali.cpp:337 -msgctxt "Jalali weekday 4 - KLocale::NarrowName " -msgid "5" -msgstr "" - -#: kcalendarsystemjalali.cpp:339 -msgctxt "Jalali weekday 5 - KLocale::NarrowName " -msgid "J" -msgstr "" - -#: kcalendarsystemjalali.cpp:341 -msgctxt "Jalali weekday 6 - KLocale::NarrowName " -msgid "S" -msgstr "" - -#: kcalendarsystemjalali.cpp:343 -msgctxt "Jalali weekday 7 - KLocale::NarrowName " -msgid "1" -msgstr "" - -#: kcalendarsystemjalali.cpp:352 -#, fuzzy -#| msgctxt "Do shanbe short" -#| msgid "2sh" -msgctxt "Jalali weekday 1 - KLocale::ShortName" -msgid "2sh" -msgstr "2sh" - -#: kcalendarsystemjalali.cpp:354 -#, fuzzy -#| msgctxt "Se shanbe short" -#| msgid "3sh" -msgctxt "Jalali weekday 2 - KLocale::ShortName" -msgid "3sh" -msgstr "3sh" - -#: kcalendarsystemjalali.cpp:356 -#, fuzzy -#| msgctxt "Chahar shanbe short" -#| msgid "4sh" -msgctxt "Jalali weekday 3 - KLocale::ShortName" -msgid "4sh" -msgstr "4sh" - -#: kcalendarsystemjalali.cpp:358 -#, fuzzy -#| msgctxt "Panj shanbe short" -#| msgid "5sh" -msgctxt "Jalali weekday 4 - KLocale::ShortName" -msgid "5sh" -msgstr "5sh" - -#: kcalendarsystemjalali.cpp:360 -#, fuzzy -#| msgctxt "Jumee short" -#| msgid "Jom" -msgctxt "Jalali weekday 5 - KLocale::ShortName" -msgid "Jom" -msgstr "Jom" - -#: kcalendarsystemjalali.cpp:362 -#, fuzzy -#| msgid "Shanbe" -msgctxt "Jalali weekday 6 - KLocale::ShortName" -msgid "Shn" -msgstr "शान्बे" - -#: kcalendarsystemjalali.cpp:364 -#, fuzzy -#| msgctxt "Yek-shanbe short" -#| msgid "1sh" -msgctxt "Jalali weekday 7 - KLocale::ShortName" -msgid "1sh" -msgstr "1sh" - -#: kcalendarsystemjalali.cpp:371 -#, fuzzy -#| msgid "Do shanbe" -msgctxt "Jalali weekday 1 - KLocale::LongName" -msgid "Do shanbe" -msgstr "दो शान्बे" - -#: kcalendarsystemjalali.cpp:373 -#, fuzzy -#| msgid "Se shanbe" -msgctxt "Jalali weekday 2 - KLocale::LongName" -msgid "Se shanbe" -msgstr "से शान्बे" - -#: kcalendarsystemjalali.cpp:375 -#, fuzzy -#| msgid "Chahar shanbe" -msgctxt "Jalali weekday 3 - KLocale::LongName" -msgid "Chahar shanbe" -msgstr "चहर शान्बे" - -#: kcalendarsystemjalali.cpp:377 -#, fuzzy -#| msgid "Panj shanbe" -msgctxt "Jalali weekday 4 - KLocale::LongName" -msgid "Panj shanbe" -msgstr "पंज शान्बे" - -#: kcalendarsystemjalali.cpp:379 -#, fuzzy -#| msgid "Jumee" -msgctxt "Jalali weekday 5 - KLocale::LongName" -msgid "Jumee" -msgstr "जूमी" - -#: kcalendarsystemjalali.cpp:381 -#, fuzzy -#| msgid "Shanbe" -msgctxt "Jalali weekday 6 - KLocale::LongName" -msgid "Shanbe" -msgstr "शान्बे" - -#: kcalendarsystemjalali.cpp:383 -#, fuzzy -#| msgid "Yek-shanbe" -msgctxt "Jalali weekday 7 - KLocale::LongName" -msgid "Yek-shanbe" -msgstr "येक-शान्बे" - -#: kcalendarsystemjapanese.cpp:62 -msgctxt "Calendar Era: Japanese Nengō, Meiji Era, LongFormat" -msgid "Meiji" -msgstr "" - -#: kcalendarsystemjapanese.cpp:64 -#, c-format -msgctxt "" -"(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1, " -"e.g. Meiji 1" -msgid "%EC Gannen" -msgstr "" - -#: kcalendarsystemjapanese.cpp:66 -#, c-format -msgctxt "" -"(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1, " -"e.g. Meiji 22" -msgid "%EC %Ey" -msgstr "" - -#: kcalendarsystemjapanese.cpp:69 -msgctxt "Calendar Era: Japanese Nengō, Taishō Era, LongFormat" -msgid "Taishō" -msgstr "" - -#: kcalendarsystemjapanese.cpp:71 -#, c-format -msgctxt "" -"(kdedt-format) Japanese, Taishō, full era year format used for %EY, year = " -"1, e.g. Taishō 1" -msgid "%EC Gannen" -msgstr "" - -#: kcalendarsystemjapanese.cpp:73 -#, c-format -msgctxt "" -"(kdedt-format) Japanese, Taishō, full era year format used for %EY, year > " -"1, e.g. Taishō 22" -msgid "%EC %Ey" -msgstr "" - -#: kcalendarsystemjapanese.cpp:76 -#, fuzzy -#| msgctxt "Shahrivar short" -#| msgid "Sha" -msgctxt "Calendar Era: Japanese Nengō, Shōwa Era, LongFormat" -msgid "Shōwa" -msgstr "शा" - -#: kcalendarsystemjapanese.cpp:78 -#, c-format -msgctxt "" -"(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year = 1, " -"e.g. Shōwa 1" -msgid "%EC Gannen" -msgstr "" - -#: kcalendarsystemjapanese.cpp:80 -#, c-format -msgctxt "" -"(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year > 1, " -"e.g. Shōwa 22" -msgid "%EC %Ey" -msgstr "" - -#: kcalendarsystemjapanese.cpp:83 -msgctxt "Calendar Era: Japanese Nengō, Heisei Era, LongFormat" -msgid "Heisei" -msgstr "" - -#: kcalendarsystemjapanese.cpp:85 -#, c-format -msgctxt "" -"(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = " -"1, e.g. Heisei 1" -msgid "%EC Gannen" -msgstr "" - -#: kcalendarsystemjapanese.cpp:87 -#, c-format -msgctxt "" -"(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > " -"1, e.g. Heisei 22" -msgid "%EC %Ey" -msgstr "" - -#: kcalendarsystemjapanese.cpp:164 -#, fuzzy -msgctxt "Japanese year 1 of era" -msgid "Gannen" -msgstr "हराः" - -#: kcalendarsystemjulian.cpp:73 -msgctxt "Calendar Era: Julian Common Era, years < 0, LongFormat" -msgid "Before Common Era" -msgstr "" - -#: kcalendarsystemjulian.cpp:74 -msgctxt "Calendar Era: Julian Common Era, years < 0, ShortFormat" -msgid "BCE" -msgstr "" - -#: kcalendarsystemjulian.cpp:76 -msgctxt "Calendar Era: Julian Christian Era, years < 0, LongFormat" -msgid "Before Christ" -msgstr "" - -#: kcalendarsystemjulian.cpp:77 -msgctxt "Calendar Era: Julian Christian Era, years < 0, ShortFormat" -msgid "BC" -msgstr "" - -#: kcalendarsystemjulian.cpp:79 -#, c-format -msgctxt "" -"(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC" -msgid "%Ey %EC" -msgstr "" - -#: kcalendarsystemjulian.cpp:83 -msgctxt "Calendar Era: Julian Common Era, years > 0, LongFormat" -msgid "Common Era" -msgstr "" - -#: kcalendarsystemjulian.cpp:84 -msgctxt "Calendar Era: Julian Common Era, years > 0, ShortFormat" -msgid "CE" -msgstr "" - -#: kcalendarsystemjulian.cpp:86 -msgctxt "Calendar Era: Julian Christian Era, years > 0, LongFormat" -msgid "Anno Domini" -msgstr "" - -#: kcalendarsystemjulian.cpp:87 -msgctxt "Calendar Era: Julian Christian Era, years > 0, ShortFormat" -msgid "AD" -msgstr "" - -#: kcalendarsystemjulian.cpp:89 -#, c-format -msgctxt "" -"(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD" -msgid "%Ey %EC" -msgstr "" - -#: kcalendarsystemjulian.cpp:172 -msgctxt "Julian month 1 - KLocale::NarrowName" -msgid "J" -msgstr "" - -#: kcalendarsystemjulian.cpp:174 -msgctxt "Julian month 2 - KLocale::NarrowName" -msgid "F" -msgstr "" - -#: kcalendarsystemjulian.cpp:176 -msgctxt "Julian month 3 - KLocale::NarrowName" -msgid "M" -msgstr "" - -#: kcalendarsystemjulian.cpp:178 -#, fuzzy -#| msgid "Av" -msgctxt "Julian month 4 - KLocale::NarrowName" -msgid "A" -msgstr "एव" - -#: kcalendarsystemjulian.cpp:180 -msgctxt "Julian month 5 - KLocale::NarrowName" -msgid "M" -msgstr "" - -#: kcalendarsystemjulian.cpp:182 -msgctxt "Julian month 6 - KLocale::NarrowName" -msgid "J" -msgstr "" - -#: kcalendarsystemjulian.cpp:184 -msgctxt "Julian month 7 - KLocale::NarrowName" -msgid "J" -msgstr "" - -#: kcalendarsystemjulian.cpp:186 -#, fuzzy -#| msgid "Av" -msgctxt "Julian month 8 - KLocale::NarrowName" -msgid "A" -msgstr "एव" - -#: kcalendarsystemjulian.cpp:188 -msgctxt "Julian month 9 - KLocale::NarrowName" -msgid "S" -msgstr "" - -#: kcalendarsystemjulian.cpp:190 -msgctxt "Julian month 10 - KLocale::NarrowName" -msgid "O" -msgstr "" - -#: kcalendarsystemjulian.cpp:192 -msgctxt "Julian month 11 - KLocale::NarrowName" -msgid "N" -msgstr "" - -#: kcalendarsystemjulian.cpp:194 -msgctxt "Julian month 12 - KLocale::NarrowName" -msgid "D" -msgstr "" - -#: kcalendarsystemjulian.cpp:203 -#, fuzzy -#| msgctxt "of January" -#| msgid "of Jan" -msgctxt "Julian month 1 - KLocale::ShortName Possessive" -msgid "of Jan" -msgstr "जनवरी का" - -#: kcalendarsystemjulian.cpp:205 -#, fuzzy -#| msgctxt "of February" -#| msgid "of Feb" -msgctxt "Julian month 2 - KLocale::ShortName Possessive" -msgid "of Feb" -msgstr "फरवरी का" - -#: kcalendarsystemjulian.cpp:207 -#, fuzzy -#| msgctxt "of March" -#| msgid "of Mar" -msgctxt "Julian month 3 - KLocale::ShortName Possessive" -msgid "of Mar" -msgstr "मार्च का" - -#: kcalendarsystemjulian.cpp:209 -#, fuzzy -#| msgctxt "of April" -#| msgid "of Apr" -msgctxt "Julian month 4 - KLocale::ShortName Possessive" -msgid "of Apr" -msgstr "अप्रैल का" - -#: kcalendarsystemjulian.cpp:211 -#, fuzzy -#| msgctxt "of May short" -#| msgid "of May" -msgctxt "Julian month 5 - KLocale::ShortName Possessive" -msgid "of May" -msgstr "मई का" - -#: kcalendarsystemjulian.cpp:213 -#, fuzzy -#| msgctxt "of June" -#| msgid "of Jun" -msgctxt "Julian month 6 - KLocale::ShortName Possessive" -msgid "of Jun" -msgstr "जून का" - -#: kcalendarsystemjulian.cpp:215 -#, fuzzy -#| msgctxt "of July" -#| msgid "of Jul" -msgctxt "Julian month 7 - KLocale::ShortName Possessive" -msgid "of Jul" -msgstr "जुलाई का" - -#: kcalendarsystemjulian.cpp:217 -#, fuzzy -#| msgctxt "of August" -#| msgid "of Aug" -msgctxt "Julian month 8 - KLocale::ShortName Possessive" -msgid "of Aug" -msgstr "अग. का" - -#: kcalendarsystemjulian.cpp:219 -#, fuzzy -#| msgctxt "of September" -#| msgid "of Sep" -msgctxt "Julian month 9 - KLocale::ShortName Possessive" -msgid "of Sep" -msgstr "सित. का" - -#: kcalendarsystemjulian.cpp:221 -#, fuzzy -#| msgctxt "of October" -#| msgid "of Oct" -msgctxt "Julian month 10 - KLocale::ShortName Possessive" -msgid "of Oct" -msgstr "अक्तू. का" - -#: kcalendarsystemjulian.cpp:223 -#, fuzzy -#| msgctxt "of November" -#| msgid "of Nov" -msgctxt "Julian month 11 - KLocale::ShortName Possessive" -msgid "of Nov" -msgstr "नवं. का" - -#: kcalendarsystemjulian.cpp:225 -#, fuzzy -#| msgctxt "of December" -#| msgid "of Dec" -msgctxt "Julian month 12 - KLocale::ShortName Possessive" -msgid "of Dec" -msgstr "दिस. का" - -#: kcalendarsystemjulian.cpp:234 -#, fuzzy -#| msgctxt "January" -#| msgid "Jan" -msgctxt "Julian month 1 - KLocale::ShortName" -msgid "Jan" -msgstr "जन." - -#: kcalendarsystemjulian.cpp:236 -#, fuzzy -#| msgctxt "February" -#| msgid "Feb" -msgctxt "Julian month 2 - KLocale::ShortName" -msgid "Feb" -msgstr "फर." - -#: kcalendarsystemjulian.cpp:238 -#, fuzzy -#| msgctxt "March" -#| msgid "Mar" -msgctxt "Julian month 3 - KLocale::ShortName" -msgid "Mar" -msgstr "मार्च" - -#: kcalendarsystemjulian.cpp:240 -#, fuzzy -#| msgctxt "April" -#| msgid "Apr" -msgctxt "Julian month 4 - KLocale::ShortName" -msgid "Apr" -msgstr "अप्रै." - -#: kcalendarsystemjulian.cpp:242 -#, fuzzy -#| msgctxt "May short" -#| msgid "May" -msgctxt "Julian month 5 - KLocale::ShortName" -msgid "May" -msgstr "मई" - -#: kcalendarsystemjulian.cpp:244 -#, fuzzy -#| msgctxt "June" -#| msgid "Jun" -msgctxt "Julian month 6 - KLocale::ShortName" -msgid "Jun" -msgstr "जून" - -#: kcalendarsystemjulian.cpp:246 -#, fuzzy -#| msgctxt "July" -#| msgid "Jul" -msgctxt "Julian month 7 - KLocale::ShortName" -msgid "Jul" -msgstr "जु." - -#: kcalendarsystemjulian.cpp:248 -#, fuzzy -#| msgctxt "August" -#| msgid "Aug" -msgctxt "Julian month 8 - KLocale::ShortName" -msgid "Aug" -msgstr "अग." - -#: kcalendarsystemjulian.cpp:250 -#, fuzzy -#| msgctxt "September" -#| msgid "Sep" -msgctxt "Julian month 9 - KLocale::ShortName" -msgid "Sep" -msgstr "सित." - -#: kcalendarsystemjulian.cpp:252 -#, fuzzy -#| msgctxt "October" -#| msgid "Oct" -msgctxt "Julian month 10 - KLocale::ShortName" -msgid "Oct" -msgstr "अक्तू." - -#: kcalendarsystemjulian.cpp:254 -#, fuzzy -#| msgctxt "November" -#| msgid "Nov" -msgctxt "Julian month 11 - KLocale::ShortName" -msgid "Nov" -msgstr "नवं." - -#: kcalendarsystemjulian.cpp:256 -#, fuzzy -#| msgctxt "December" -#| msgid "Dec" -msgctxt "Julian month 12 - KLocale::ShortName" -msgid "Dec" -msgstr "दिसं." - -#: kcalendarsystemjulian.cpp:265 -#, fuzzy -#| msgid "of January" -msgctxt "Julian month 1 - KLocale::LongName Possessive" -msgid "of January" -msgstr "जनवरी का" - -#: kcalendarsystemjulian.cpp:267 -#, fuzzy -#| msgid "of February" -msgctxt "Julian month 2 - KLocale::LongName Possessive" -msgid "of February" -msgstr "फरवरी का" - -#: kcalendarsystemjulian.cpp:269 -#, fuzzy -#| msgid "of March" -msgctxt "Julian month 3 - KLocale::LongName Possessive" -msgid "of March" -msgstr "मार्च का" - -#: kcalendarsystemjulian.cpp:271 -#, fuzzy -#| msgid "of April" -msgctxt "Julian month 4 - KLocale::LongName Possessive" -msgid "of April" -msgstr "अप्रैल का" - -#: kcalendarsystemjulian.cpp:273 -#, fuzzy -#| msgctxt "of May short" -#| msgid "of May" -msgctxt "Julian month 5 - KLocale::LongName Possessive" -msgid "of May" -msgstr "मई का" - -#: kcalendarsystemjulian.cpp:275 -#, fuzzy -#| msgid "of June" -msgctxt "Julian month 6 - KLocale::LongName Possessive" -msgid "of June" -msgstr "जून का" - -#: kcalendarsystemjulian.cpp:277 -#, fuzzy -#| msgid "of July" -msgctxt "Julian month 7 - KLocale::LongName Possessive" -msgid "of July" -msgstr "जुलाई का" - -#: kcalendarsystemjulian.cpp:279 -#, fuzzy -#| msgid "of August" -msgctxt "Julian month 8 - KLocale::LongName Possessive" -msgid "of August" -msgstr "अगस्त का" - -#: kcalendarsystemjulian.cpp:281 -#, fuzzy -#| msgid "of September" -msgctxt "Julian month 9 - KLocale::LongName Possessive" -msgid "of September" -msgstr "सितम्बर का" - -#: kcalendarsystemjulian.cpp:283 -#, fuzzy -#| msgid "of October" -msgctxt "Julian month 10 - KLocale::LongName Possessive" -msgid "of October" -msgstr "अक्टूबर का" - -#: kcalendarsystemjulian.cpp:285 -#, fuzzy -#| msgid "of November" -msgctxt "Julian month 11 - KLocale::LongName Possessive" -msgid "of November" -msgstr "नवंबर का" - -#: kcalendarsystemjulian.cpp:287 -#, fuzzy -#| msgid "of December" -msgctxt "Julian month 12 - KLocale::LongName Possessive" -msgid "of December" -msgstr "दिसम्बर का" - -#: kcalendarsystemjulian.cpp:296 -#, fuzzy -#| msgid "January" -msgctxt "Julian month 1 - KLocale::LongName" -msgid "January" -msgstr "जनवरी" - -#: kcalendarsystemjulian.cpp:298 -#, fuzzy -#| msgid "February" -msgctxt "Julian month 2 - KLocale::LongName" -msgid "February" -msgstr "फरवरी" - -#: kcalendarsystemjulian.cpp:300 -#, fuzzy -#| msgctxt "March long" -#| msgid "March" -msgctxt "Julian month 3 - KLocale::LongName" -msgid "March" -msgstr "मार्च" - -#: kcalendarsystemjulian.cpp:302 -#, fuzzy -#| msgid "April" -msgctxt "Julian month 4 - KLocale::LongName" -msgid "April" -msgstr "अप्रैल" - -#: kcalendarsystemjulian.cpp:304 -#, fuzzy -#| msgctxt "May short" -#| msgid "May" -msgctxt "Julian month 5 - KLocale::LongName" -msgid "May" -msgstr "मई" - -#: kcalendarsystemjulian.cpp:306 -#, fuzzy -#| msgid "June" -msgctxt "Julian month 6 - KLocale::LongName" -msgid "June" -msgstr "जून" - -#: kcalendarsystemjulian.cpp:308 -#, fuzzy -#| msgid "July" -msgctxt "Julian month 7 - KLocale::LongName" -msgid "July" -msgstr "जुलाई" - -#: kcalendarsystemjulian.cpp:310 -#, fuzzy -#| msgctxt "August long" -#| msgid "August" -msgctxt "Julian month 8 - KLocale::LongName" -msgid "August" -msgstr "अगस्त" - -#: kcalendarsystemjulian.cpp:312 -#, fuzzy -#| msgid "September" -msgctxt "Julian month 9 - KLocale::LongName" -msgid "September" -msgstr "सितम्बर" - -#: kcalendarsystemjulian.cpp:314 -#, fuzzy -#| msgid "October" -msgctxt "Julian month 10 - KLocale::LongName" -msgid "October" -msgstr "अक्टूबर" - -#: kcalendarsystemjulian.cpp:316 -#, fuzzy -#| msgid "November" -msgctxt "Julian month 11 - KLocale::LongName" -msgid "November" -msgstr "नवम्बर" - -#: kcalendarsystemjulian.cpp:318 -#, fuzzy -#| msgid "December" -msgctxt "Julian month 12 - KLocale::LongName" -msgid "December" -msgstr "दिसम्बर" - -#: kcalendarsystemjulian.cpp:331 -msgctxt "Julian weekday 1 - KLocale::NarrowName " -msgid "M" -msgstr "" - -#: kcalendarsystemjulian.cpp:333 -msgctxt "Julian weekday 2 - KLocale::NarrowName " -msgid "T" -msgstr "" - -#: kcalendarsystemjulian.cpp:335 -msgctxt "Julian weekday 3 - KLocale::NarrowName " -msgid "W" -msgstr "" - -#: kcalendarsystemjulian.cpp:337 -msgctxt "Julian weekday 4 - KLocale::NarrowName " -msgid "T" -msgstr "" - -#: kcalendarsystemjulian.cpp:339 -msgctxt "Julian weekday 5 - KLocale::NarrowName " -msgid "F" -msgstr "" - -#: kcalendarsystemjulian.cpp:341 -msgctxt "Julian weekday 6 - KLocale::NarrowName " -msgid "S" -msgstr "" - -#: kcalendarsystemjulian.cpp:343 -msgctxt "Julian weekday 7 - KLocale::NarrowName " -msgid "S" -msgstr "" - -#: kcalendarsystemjulian.cpp:352 -#, fuzzy -#| msgctxt "Monday" -#| msgid "Mon" -msgctxt "Julian weekday 1 - KLocale::ShortName" -msgid "Mon" -msgstr "सोम" - -#: kcalendarsystemjulian.cpp:354 -#, fuzzy -#| msgctxt "Tuesday" -#| msgid "Tue" -msgctxt "Julian weekday 2 - KLocale::ShortName" -msgid "Tue" -msgstr "मंगल" - -#: kcalendarsystemjulian.cpp:356 -#, fuzzy -#| msgctxt "Wednesday" -#| msgid "Wed" -msgctxt "Julian weekday 3 - KLocale::ShortName" -msgid "Wed" -msgstr "बुध" - -#: kcalendarsystemjulian.cpp:358 -#, fuzzy -#| msgctxt "Thursday" -#| msgid "Thu" -msgctxt "Julian weekday 4 - KLocale::ShortName" -msgid "Thu" -msgstr "गुरू" - -#: kcalendarsystemjulian.cpp:360 -#, fuzzy -#| msgctxt "Friday" -#| msgid "Fri" -msgctxt "Julian weekday 5 - KLocale::ShortName" -msgid "Fri" -msgstr "शुक्र" - -#: kcalendarsystemjulian.cpp:362 -#, fuzzy -#| msgctxt "Saturday" -#| msgid "Sat" -msgctxt "Julian weekday 6 - KLocale::ShortName" -msgid "Sat" -msgstr "शनि" - -#: kcalendarsystemjulian.cpp:364 -#, fuzzy -#| msgctxt "Sunday" -#| msgid "Sun" -msgctxt "Julian weekday 7 - KLocale::ShortName" -msgid "Sun" -msgstr "रवि" - -#: kcalendarsystemjulian.cpp:371 -#, fuzzy -#| msgid "Monday" -msgctxt "Julian weekday 1 - KLocale::LongName" -msgid "Monday" -msgstr "सोमवार" - -#: kcalendarsystemjulian.cpp:373 -#, fuzzy -#| msgid "Tuesday" -msgctxt "Julian weekday 2 - KLocale::LongName" -msgid "Tuesday" -msgstr "मंगलवार" - -#: kcalendarsystemjulian.cpp:375 -#, fuzzy -#| msgid "Wednesday" -msgctxt "Julian weekday 3 - KLocale::LongName" -msgid "Wednesday" -msgstr "बुधवार" - -#: kcalendarsystemjulian.cpp:377 -#, fuzzy -#| msgid "Thursday" -msgctxt "Julian weekday 4 - KLocale::LongName" -msgid "Thursday" -msgstr "गुरुवार" - -#: kcalendarsystemjulian.cpp:379 -#, fuzzy -#| msgid "Friday" -msgctxt "Julian weekday 5 - KLocale::LongName" -msgid "Friday" -msgstr "शुक्रवार" - -#: kcalendarsystemjulian.cpp:381 -#, fuzzy -#| msgid "Saturday" -msgctxt "Julian weekday 6 - KLocale::LongName" -msgid "Saturday" -msgstr "शनिवार" - -#: kcalendarsystemjulian.cpp:383 -#, fuzzy -#| msgid "Sunday" -msgctxt "Julian weekday 7 - KLocale::LongName" -msgid "Sunday" -msgstr "रविवार" - -#: kcalendarsystemminguo.cpp:57 -msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, LongFormat" -msgid "Republic of China Era" -msgstr "" - -#: kcalendarsystemminguo.cpp:58 -msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, ShortFormat" -msgid "ROC" -msgstr "" - -#: kcalendarsystemminguo.cpp:59 -#, c-format -msgctxt "" -"(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99" -msgid "%EC %Ey" -msgstr "" - -#: kcalendarsystemthai.cpp:58 -msgctxt "Calendar Era: Thai Buddhist Era, years > 0, LongFormat" -msgid "Buddhist Era" -msgstr "" - -#: kcalendarsystemthai.cpp:59 -msgctxt "Calendar Era: Thai Buddhist Era, years > 0, ShortFormat" -msgid "BE" -msgstr "" - -#: kcalendarsystemthai.cpp:60 -#, c-format -msgctxt "" -"(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE" -msgid "%Ey %EC" -msgstr "" - -#, fuzzy -#~ msgctxt "@item Calendar system" -#~ msgid "Gregorian (Proleptic)" -#~ msgstr "ग्रेगोरियन" - -#, fuzzy -#~ msgctxt "Ethiopian month 1 - ShortNamePossessive" -#~ msgid "of Mes" -#~ msgstr "मेह का" - -#, fuzzy -#~ msgctxt "Ethiopian month 5 - LongNamePossessive" -#~ msgid "of Ter" -#~ msgstr "तिर का" - -#, fuzzy -#~ msgctxt "Ethiopian month 1 - ShortName" -#~ msgid "Mes" -#~ msgstr "हाँ" - -#, fuzzy -#~ msgctxt "Ethiopian month 5 - LongName" -#~ msgid "Ter" -#~ msgstr "मंगल" - -#, fuzzy -#~ msgctxt "Ethiopian weekday 4 - ShortDayName" -#~ msgid "Ham" -#~ msgstr "पूर्वाह्न" - -#, fuzzy -#~ msgctxt "Ethiopian weekday 5 - ShortDayName" -#~ msgid "Arb" -#~ msgstr "बुध" - -#, fuzzy -#~ msgctxt "Ethiopian weekday 3 - LongDayName" -#~ msgid "Rob" -#~ msgstr "कार्य" - -#, fuzzy -#~ msgctxt "Ethiopian weekday 5 - LongDayName" -#~ msgid "Arb" -#~ msgstr "बुध" - -#~ msgctxt "of May long" -#~ msgid "of May" -#~ msgstr "मई का" - -#~ msgctxt "May long" -#~ msgid "May" -#~ msgstr "मई" - -#~ msgid "R. Thaani" -#~ msgstr "र. उस्सानी" - -#~ msgid "J. Thaani" -#~ msgstr "ज. उस्सानी " - -#~ msgid "Hijjah" -#~ msgstr "जिल्हज" - -#~ msgctxt "of Tir long" -#~ msgid "of Tir" -#~ msgstr "तिर का" - -#~ msgctxt "of Dei long" -#~ msgid "of Dei" -#~ msgstr "देई का" - -#~ msgctxt "Tir long" -#~ msgid "Tir" -#~ msgstr "तिर" - -#~ msgctxt "Dei long" -#~ msgid "Dei" -#~ msgstr "देई" - -#~ msgctxt "Shanbe short" -#~ msgid "shn" -#~ msgstr "shn" diff -Nru kde-l10n-hi-4.12.97/messages/frameworks/kdelibs_colors4.po kde-l10n-hi-4.13.0/messages/frameworks/kdelibs_colors4.po --- kde-l10n-hi-4.12.97/messages/frameworks/kdelibs_colors4.po 2014-01-25 21:41:22.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/frameworks/kdelibs_colors4.po 1970-01-01 00:00:00.000000000 +0000 @@ -1,2286 +0,0 @@ -# translation of kdelib_colors1.po to Hindi -# Thomas Diehl , 2002,2003. -# Nilesh Bansal , 2003. -# G Karunakar , 2003. -# Ravishankar Shrivastava , 2004. -# G Karunakar , 2007. -# Copyright (C) -msgid "" -msgstr "" -"Project-Id-Version: kdelib_colors1\n" -"Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-01-24 18:50+0000\n" -"PO-Revision-Date: 2007-09-25 01:45+0530\n" -"Last-Translator: Ravishankar Shrivastava \n" -"Language-Team: Hindi \n" -"Language: hi\n" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" -"X-Generator: KBabel 1.11.4\n" -"Plural-Forms: nplurals=2; plural=(n!=1);\n" - -#: colors.cpp:1 -msgctxt "color" -msgid "AliceBlue" -msgstr "" - -#: colors.cpp:2 -msgctxt "color" -msgid "AntiqueWhite" -msgstr "एन्टीक-सफेद" - -#: colors.cpp:3 -msgctxt "color" -msgid "AntiqueWhite1" -msgstr "एन्टीक-सफेद1" - -#: colors.cpp:4 -msgctxt "color" -msgid "AntiqueWhite2" -msgstr "एन्टीक-सफेद2" - -#: colors.cpp:5 -msgctxt "color" -msgid "AntiqueWhite3" -msgstr "एन्टीक-सफेद3" - -#: colors.cpp:6 -msgctxt "color" -msgid "AntiqueWhite4" -msgstr "एन्टीक-सफेद4 " - -#: colors.cpp:7 -msgctxt "color" -msgid "BlanchedAlmond" -msgstr "ब्लाँच्ड-बादामी" - -#: colors.cpp:8 -msgctxt "color" -msgid "BlueViolet" -msgstr "बैंगनी" - -#: colors.cpp:9 -msgctxt "color" -msgid "CadetBlue" -msgstr "केडेट-नीला" - -#: colors.cpp:10 -msgctxt "color" -msgid "CadetBlue1" -msgstr "केडेट-नीला" - -#: colors.cpp:11 -msgctxt "color" -msgid "CadetBlue2" -msgstr "केडेट-नीला2" - -#: colors.cpp:12 -msgctxt "color" -msgid "CadetBlue3" -msgstr "केडेट-नीला3" - -#: colors.cpp:13 -msgctxt "color" -msgid "CadetBlue4" -msgstr "केडेट-नीला" - -#: colors.cpp:14 -msgctxt "color" -msgid "CornflowerBlue" -msgstr "कॉर्नफ्लावर-नीला" - -#: colors.cpp:15 -msgctxt "color" -msgid "DarkBlue" -msgstr "गहरा नीलाः" - -#: colors.cpp:16 -msgctxt "color" -msgid "DarkCyan" -msgstr "गहरा क्यानः" - -#: colors.cpp:17 -msgctxt "color" -msgid "DarkGoldenrod" -msgstr "" - -#: colors.cpp:18 -msgctxt "color" -msgid "DarkGoldenrod1" -msgstr "" - -#: colors.cpp:19 -msgctxt "color" -msgid "DarkGoldenrod2" -msgstr "" - -#: colors.cpp:20 -msgctxt "color" -msgid "DarkGoldenrod3" -msgstr "" - -#: colors.cpp:21 -msgctxt "color" -msgid "DarkGoldenrod4" -msgstr "" - -#: colors.cpp:22 -msgctxt "color" -msgid "DarkGray" -msgstr "गाढ़ा धूसर" - -#: colors.cpp:23 -msgctxt "color" -msgid "DarkGreen" -msgstr "गहरा हराः" - -#: colors.cpp:24 -msgctxt "color" -msgid "DarkGrey" -msgstr "गाढ़ा धूसर" - -#: colors.cpp:25 -msgctxt "color" -msgid "DarkKhaki" -msgstr "गहरा-खाकी" - -#: colors.cpp:26 -msgctxt "color" -msgid "DarkMagenta" -msgstr "मजेंटा" - -#: colors.cpp:27 -msgctxt "color" -msgid "DarkOliveGreen" -msgstr "गहरा-जैतूनी-हरा1" - -#: colors.cpp:28 -msgctxt "color" -msgid "DarkOliveGreen1" -msgstr "गहरा-जैतूनी-हरा1" - -#: colors.cpp:29 -msgctxt "color" -msgid "DarkOliveGreen2" -msgstr "गहरा-जैतूनी-हरा2" - -#: colors.cpp:30 -msgctxt "color" -msgid "DarkOliveGreen3" -msgstr "गहरा-जैतूनी-हरा1" - -#: colors.cpp:31 -msgctxt "color" -msgid "DarkOliveGreen4" -msgstr "गहरा-जैतूनी-हरा1" - -#: colors.cpp:32 -msgctxt "color" -msgid "DarkOrange" -msgstr "नारंगी" - -#: colors.cpp:33 -msgctxt "color" -msgid "DarkOrange1" -msgstr "नारंगी" - -#: colors.cpp:34 -msgctxt "color" -msgid "DarkOrange2" -msgstr "नारंगी" - -#: colors.cpp:35 -msgctxt "color" -msgid "DarkOrange3" -msgstr "नारंगी" - -#: colors.cpp:36 -msgctxt "color" -msgid "DarkOrange4" -msgstr "नारंगी" - -#: colors.cpp:37 -msgctxt "color" -msgid "DarkOrchid" -msgstr "ज्यादा गहरा" - -#: colors.cpp:38 -msgctxt "color" -msgid "DarkOrchid1" -msgstr "" - -#: colors.cpp:39 -msgctxt "color" -msgid "DarkOrchid2" -msgstr "" - -#: colors.cpp:40 -msgctxt "color" -msgid "DarkOrchid3" -msgstr "" - -#: colors.cpp:41 -msgctxt "color" -msgid "DarkOrchid4" -msgstr "" - -#: colors.cpp:42 -msgctxt "color" -msgid "DarkRed" -msgstr "ज्यादा गहरा" - -#: colors.cpp:43 -msgctxt "color" -msgid "DarkSalmon" -msgstr "गहरा-गेरूऑ" - -#: colors.cpp:44 -msgctxt "color" -msgid "DarkSeaGreen" -msgstr "गहरा-समुद्री-हरा" - -#: colors.cpp:45 -msgctxt "color" -msgid "DarkSeaGreen1" -msgstr "गहरा-समुद्री-हरा1" - -#: colors.cpp:46 -msgctxt "color" -msgid "DarkSeaGreen2" -msgstr "गहरा-समुद्री-हरा2" - -#: colors.cpp:47 -msgctxt "color" -msgid "DarkSeaGreen3" -msgstr "गहरा-समुद्री-हरा3" - -#: colors.cpp:48 -msgctxt "color" -msgid "DarkSeaGreen4" -msgstr "गहरा-समुद्री-हरा4" - -#: colors.cpp:49 -msgctxt "color" -msgid "DarkSlateBlue" -msgstr "स्लेटी-नीला1" - -#: colors.cpp:50 -msgctxt "color" -msgid "DarkSlateGray" -msgstr "गाढ़ा धूसर" - -#: colors.cpp:51 -msgctxt "color" -msgid "DarkSlateGray1" -msgstr "गहरा-स्लेटी-ग्रे1" - -#: colors.cpp:52 -msgctxt "color" -msgid "DarkSlateGray2" -msgstr "गहरा-स्लेटी-ग्रे2" - -#: colors.cpp:53 -msgctxt "color" -msgid "DarkSlateGray3" -msgstr "गहरा-स्लेटी-ग्रे3" - -#: colors.cpp:54 -msgctxt "color" -msgid "DarkSlateGray4" -msgstr "गहरा-स्लेटी-ग्रे1" - -#: colors.cpp:55 -msgctxt "color" -msgid "DarkSlateGrey" -msgstr "गहरा-स्लेटी-ग्रे1" - -#: colors.cpp:56 -msgctxt "color" -msgid "DarkTurquoise" -msgstr "" - -#: colors.cpp:57 -msgctxt "color" -msgid "DarkViolet" -msgstr "बैंगनी" - -#: colors.cpp:58 -msgctxt "color" -msgid "DeepPink" -msgstr "गहरा" - -#: colors.cpp:59 -msgctxt "color" -msgid "DeepPink1" -msgstr "गहरा" - -#: colors.cpp:60 -msgctxt "color" -msgid "DeepPink2" -msgstr "गहरा" - -#: colors.cpp:61 -msgctxt "color" -msgid "DeepPink3" -msgstr "गहरा" - -#: colors.cpp:62 -msgctxt "color" -msgid "DeepPink4" -msgstr "गहरा" - -#: colors.cpp:63 -msgctxt "color" -msgid "DeepSkyBlue" -msgstr "गहरा नीला" - -#: colors.cpp:64 -msgctxt "color" -msgid "DeepSkyBlue1" -msgstr "गहरा नीला" - -#: colors.cpp:65 -msgctxt "color" -msgid "DeepSkyBlue2" -msgstr "गहरा नीला" - -#: colors.cpp:66 -msgctxt "color" -msgid "DeepSkyBlue3" -msgstr "गहरा नीला" - -#: colors.cpp:67 -msgctxt "color" -msgid "DeepSkyBlue4" -msgstr "गहरा नीला" - -#: colors.cpp:68 -msgctxt "color" -msgid "DimGray" -msgstr "धूसर" - -#: colors.cpp:69 -msgctxt "color" -msgid "DimGrey" -msgstr "डिम-ग्रे" - -#: colors.cpp:70 -msgctxt "color" -msgid "DodgerBlue" -msgstr "गहरा नीला" - -#: colors.cpp:71 -msgctxt "color" -msgid "DodgerBlue1" -msgstr "गहरा नीला" - -#: colors.cpp:72 -msgctxt "color" -msgid "DodgerBlue2" -msgstr "गहरा नीला" - -#: colors.cpp:73 -msgctxt "color" -msgid "DodgerBlue3" -msgstr "गहरा नीला" - -#: colors.cpp:74 -msgctxt "color" -msgid "DodgerBlue4" -msgstr "गहरा नीला" - -#: colors.cpp:75 -msgctxt "color" -msgid "FloralWhite" -msgstr "फ्लोरल-सफेद" - -#: colors.cpp:76 -msgctxt "color" -msgid "ForestGreen" -msgstr "जंगल" - -#: colors.cpp:77 -msgctxt "color" -msgid "GhostWhite" -msgstr "के-घोस्ट-व्यू" - -#: colors.cpp:78 -msgctxt "color" -msgid "GreenYellow" -msgstr "पीला" - -#: colors.cpp:79 -msgctxt "color" -msgid "HotPink" -msgstr "गर्म-गुलाबी" - -#: colors.cpp:80 -msgctxt "color" -msgid "HotPink1" -msgstr "गर्म-गुलाबी1" - -#: colors.cpp:81 -msgctxt "color" -msgid "HotPink2" -msgstr "गर्म-गुलाबी2" - -#: colors.cpp:82 -msgctxt "color" -msgid "HotPink3" -msgstr "" - -#: colors.cpp:83 -msgctxt "color" -msgid "HotPink4" -msgstr "" - -#: colors.cpp:84 -msgctxt "color" -msgid "IndianRed" -msgstr "भारत" - -#: colors.cpp:85 -msgctxt "color" -msgid "IndianRed1" -msgstr "इंडियन-रेड1" - -#: colors.cpp:86 -msgctxt "color" -msgid "IndianRed2" -msgstr "इंडियन/माहे" - -#: colors.cpp:87 -msgctxt "color" -msgid "IndianRed3" -msgstr "इंडियन/माहे" - -#: colors.cpp:88 -msgctxt "color" -msgid "IndianRed4" -msgstr "इंडियन/माहे" - -#: colors.cpp:89 -msgctxt "color" -msgid "LavenderBlush" -msgstr "लैवेण्डर-ब्लश" - -#: colors.cpp:90 -msgctxt "color" -msgid "LavenderBlush1" -msgstr "लैवेण्डर-ब्लश1" - -#: colors.cpp:91 -msgctxt "color" -msgid "LavenderBlush2" -msgstr "लैवेण्डर-ब्लश2" - -#: colors.cpp:92 -msgctxt "color" -msgid "LavenderBlush3" -msgstr "लैवेण्डर-ब्लश3" - -#: colors.cpp:93 -msgctxt "color" -msgid "LavenderBlush4" -msgstr "लैवेण्डर-ब्लश4" - -#: colors.cpp:94 -msgctxt "color" -msgid "LawnGreen" -msgstr "हरा" - -#: colors.cpp:95 -msgctxt "color" -msgid "LemonChiffon" -msgstr "लेमन-शिफॉन" - -#: colors.cpp:96 -msgctxt "color" -msgid "LemonChiffon1" -msgstr "लेमन-शिफॉन1" - -#: colors.cpp:97 -msgctxt "color" -msgid "LemonChiffon2" -msgstr "लेमन-शिफॉन2" - -#: colors.cpp:98 -msgctxt "color" -msgid "LemonChiffon3" -msgstr "लेमन-शिफॉन3" - -#: colors.cpp:99 -msgctxt "color" -msgid "LemonChiffon4" -msgstr "लेमन-शिफॉन4" - -#: colors.cpp:100 -msgctxt "color" -msgid "LightBlue" -msgstr "हल्का" - -#: colors.cpp:101 -msgctxt "color" -msgid "LightBlue1" -msgstr "हल्का" - -#: colors.cpp:102 -msgctxt "color" -msgid "LightBlue2" -msgstr "हल्का" - -#: colors.cpp:103 -msgctxt "color" -msgid "LightBlue3" -msgstr "हल्का" - -#: colors.cpp:104 -msgctxt "color" -msgid "LightBlue4" -msgstr "हल्का" - -#: colors.cpp:105 -msgctxt "color" -msgid "LightCoral" -msgstr "हल्के रंग" - -#: colors.cpp:106 -msgctxt "color" -msgid "LightCyan" -msgstr "हल्का" - -#: colors.cpp:107 -msgctxt "color" -msgid "LightCyan1" -msgstr "हल्का-स्यान1" - -#: colors.cpp:108 -msgctxt "color" -msgid "LightCyan2" -msgstr "हल्का-स्यान2" - -#: colors.cpp:109 -msgctxt "color" -msgid "LightCyan3" -msgstr "हल्का-स्यान3" - -#: colors.cpp:110 -msgctxt "color" -msgid "LightCyan4" -msgstr "हल्का-स्यान4" - -#: colors.cpp:111 -msgctxt "color" -msgid "LightGoldenrod" -msgstr "हल्का-सुनहरादंड" - -#: colors.cpp:112 -msgctxt "color" -msgid "LightGoldenrod1" -msgstr "हल्का-सुनहरादंड1" - -#: colors.cpp:113 -msgctxt "color" -msgid "LightGoldenrod2" -msgstr "हल्का-सुनहरादंड2" - -#: colors.cpp:114 -msgctxt "color" -msgid "LightGoldenrod3" -msgstr "हल्का-सुनहरादंड3" - -#: colors.cpp:115 -msgctxt "color" -msgid "LightGoldenrod4" -msgstr "हल्का-सुनहरादंड" - -#: colors.cpp:116 -msgctxt "color" -msgid "LightGoldenrodYellow" -msgstr "हल्का-सुनहरादंड-पीला" - -#: colors.cpp:117 -msgctxt "color" -msgid "LightGray" -msgstr "हल्का धूसर" - -#: colors.cpp:118 -msgctxt "color" -msgid "LightGreen" -msgstr "हल्का हरा" - -#: colors.cpp:119 -msgctxt "color" -msgid "LightGrey" -msgstr "हल्का धूसर" - -#: colors.cpp:120 -msgctxt "color" -msgid "LightPink" -msgstr "बिजली-गिरना" - -#: colors.cpp:121 -msgctxt "color" -msgid "LightPink1" -msgstr "बिजली-गिरना" - -#: colors.cpp:122 -msgctxt "color" -msgid "LightPink2" -msgstr "बिजली-गिरना" - -#: colors.cpp:123 -msgctxt "color" -msgid "LightPink3" -msgstr "बिजली-गिरना" - -#: colors.cpp:124 -msgctxt "color" -msgid "LightPink4" -msgstr "बिजली-गिरना" - -#: colors.cpp:125 -msgctxt "color" -msgid "LightSalmon" -msgstr "हल्का-गेरूऑ" - -#: colors.cpp:126 -msgctxt "color" -msgid "LightSalmon1" -msgstr "हल्का-गेरूऑ1" - -#: colors.cpp:127 -msgctxt "color" -msgid "LightSalmon2" -msgstr "हल्का-गेरूऑ2" - -#: colors.cpp:128 -msgctxt "color" -msgid "LightSalmon3" -msgstr "हल्का-गेरूऑ" - -#: colors.cpp:129 -msgctxt "color" -msgid "LightSalmon4" -msgstr "हल्का-गेरूऑ" - -#: colors.cpp:130 -msgctxt "color" -msgid "LightSeaGreen" -msgstr "हल्का हरा" - -#: colors.cpp:131 -msgctxt "color" -msgid "LightSkyBlue" -msgstr "हल्का-आसमानी" - -#: colors.cpp:132 -msgctxt "color" -msgid "LightSkyBlue1" -msgstr "हल्का-आसमानी1" - -#: colors.cpp:133 -msgctxt "color" -msgid "LightSkyBlue2" -msgstr "हल्का-आसमानी2" - -#: colors.cpp:134 -msgctxt "color" -msgid "LightSkyBlue3" -msgstr "हल्का-आसमानी3" - -#: colors.cpp:135 -msgctxt "color" -msgid "LightSkyBlue4" -msgstr "हल्का-आसमानी" - -#: colors.cpp:136 -msgctxt "color" -msgid "LightSlateBlue" -msgstr "हल्का-स्लेटी-नीला" - -#: colors.cpp:137 -msgctxt "color" -msgid "LightSlateGray" -msgstr "हल्का-स्लेटी-ग्रे" - -#: colors.cpp:138 -msgctxt "color" -msgid "LightSlateGrey" -msgstr "हल्का-स्लेटी-ग्रे" - -#: colors.cpp:139 -msgctxt "color" -msgid "LightSteelBlue" -msgstr "हल्का-स्टील-ब्लू" - -#: colors.cpp:140 -msgctxt "color" -msgid "LightSteelBlue1" -msgstr "हल्का-स्टील-ब्लू1" - -#: colors.cpp:141 -msgctxt "color" -msgid "LightSteelBlue2" -msgstr "हल्का-स्टील-ब्लू12" - -#: colors.cpp:142 -msgctxt "color" -msgid "LightSteelBlue3" -msgstr "हल्का-स्टील-ब्लू13" - -#: colors.cpp:143 -msgctxt "color" -msgid "LightSteelBlue4" -msgstr "हल्का-स्टील-ब्लू14" - -#: colors.cpp:144 -msgctxt "color" -msgid "LightYellow" -msgstr "हल्का-पीला" - -#: colors.cpp:145 -msgctxt "color" -msgid "LightYellow1" -msgstr "हल्का-पीला1" - -#: colors.cpp:146 -msgctxt "color" -msgid "LightYellow2" -msgstr "हल्का-पीला2" - -#: colors.cpp:147 -msgctxt "color" -msgid "LightYellow3" -msgstr "हल्का-पीला3" - -#: colors.cpp:148 -msgctxt "color" -msgid "LightYellow4" -msgstr "हल्का-पीला4" - -#: colors.cpp:149 -msgctxt "color" -msgid "LimeGreen" -msgstr "हरा" - -#: colors.cpp:150 -msgctxt "color" -msgid "MediumAquamarine" -msgstr "मध्यम-अक्वॉमरीन" - -#: colors.cpp:151 -msgctxt "color" -msgid "MediumBlue" -msgstr "मध्यमनीला" - -#: colors.cpp:152 -msgctxt "color" -msgid "MediumOrchid" -msgstr "मध्यम-ऑर्चिड" - -#: colors.cpp:153 -msgctxt "color" -msgid "MediumOrchid1" -msgstr "मध्यम-ऑर्चिड" - -#: colors.cpp:154 -msgctxt "color" -msgid "MediumOrchid2" -msgstr "मध्यम-ऑर्चिड" - -#: colors.cpp:155 -msgctxt "color" -msgid "MediumOrchid3" -msgstr "मध्यम-ऑर्चिड" - -#: colors.cpp:156 -msgctxt "color" -msgid "MediumOrchid4" -msgstr "मध्यम-ऑर्चिड" - -#: colors.cpp:157 -msgctxt "color" -msgid "MediumPurple" -msgstr "मध्यम-जामुनी" - -#: colors.cpp:158 -msgctxt "color" -msgid "MediumPurple1" -msgstr "मध्यम-जामुनी1" - -#: colors.cpp:159 -msgctxt "color" -msgid "MediumPurple2" -msgstr "मध्यम-जामुनी2" - -#: colors.cpp:160 -msgctxt "color" -msgid "MediumPurple3" -msgstr "मध्यम-जामुनी3" - -#: colors.cpp:161 -msgctxt "color" -msgid "MediumPurple4" -msgstr "मध्यम-जामुनी" - -#: colors.cpp:162 -msgctxt "color" -msgid "MediumSeaGreen" -msgstr "प्रसंग चयन" - -#: colors.cpp:163 -msgctxt "color" -msgid "MediumSlateBlue" -msgstr "मध्यम-स्लेटी-नीला" - -#: colors.cpp:164 -msgctxt "color" -msgid "MediumSpringGreen" -msgstr "प्रसंग चयन" - -#: colors.cpp:165 -msgctxt "color" -msgid "MediumTurquoise" -msgstr "मध्यम आउटलाइन" - -#: colors.cpp:166 -msgctxt "color" -msgid "MediumVioletRed" -msgstr "मध्यम फ़ॉन्ट" - -#: colors.cpp:167 -msgctxt "color" -msgid "MidnightBlue" -msgstr "मध्यरात्रि (&M)" - -#: colors.cpp:168 -msgctxt "color" -msgid "MintCream" -msgstr "मिंट-क्रीम" - -#: colors.cpp:169 -msgctxt "color" -msgid "MistyRose" -msgstr "मिस्टी-रोज़" - -#: colors.cpp:170 -msgctxt "color" -msgid "MistyRose1" -msgstr "मिस्टी-रोज़1" - -#: colors.cpp:171 -msgctxt "color" -msgid "MistyRose2" -msgstr "मिस्टी-रोज़2" - -#: colors.cpp:172 -msgctxt "color" -msgid "MistyRose3" -msgstr "मिस्टी-रोज़3" - -#: colors.cpp:173 -msgctxt "color" -msgid "MistyRose4" -msgstr "मिस्टी-रोज़4" - -#: colors.cpp:174 -msgctxt "color" -msgid "NavajoWhite" -msgstr "नवाजो-सफेद" - -#: colors.cpp:175 -msgctxt "color" -msgid "NavajoWhite1" -msgstr "नवाजो-सफेद1" - -#: colors.cpp:176 -msgctxt "color" -msgid "NavajoWhite2" -msgstr "नवाजो-सफेद1" - -#: colors.cpp:177 -msgctxt "color" -msgid "NavajoWhite3" -msgstr "नवाजो-सफेद1" - -#: colors.cpp:178 -msgctxt "color" -msgid "NavajoWhite4" -msgstr "नवाजो-सफेद" - -#: colors.cpp:179 -msgctxt "color" -msgid "NavyBlue" -msgstr "नीला" - -#: colors.cpp:180 -msgctxt "color" -msgid "OldLace" -msgstr "ओल्ड-लेस" - -#: colors.cpp:181 -msgctxt "color" -msgid "OliveDrab" -msgstr "लाइव" - -#: colors.cpp:182 -msgctxt "color" -msgid "OliveDrab1" -msgstr "" - -#: colors.cpp:183 -msgctxt "color" -msgid "OliveDrab2" -msgstr "" - -#: colors.cpp:184 -msgctxt "color" -msgid "OliveDrab3" -msgstr "" - -#: colors.cpp:185 -msgctxt "color" -msgid "OliveDrab4" -msgstr "" - -#: colors.cpp:186 -msgctxt "color" -msgid "OrangeRed" -msgstr "नारंगी" - -#: colors.cpp:187 -msgctxt "color" -msgid "OrangeRed1" -msgstr "नारंगी" - -#: colors.cpp:188 -msgctxt "color" -msgid "OrangeRed2" -msgstr "नारंगी" - -#: colors.cpp:189 -msgctxt "color" -msgid "OrangeRed3" -msgstr "नारंगी" - -#: colors.cpp:190 -msgctxt "color" -msgid "OrangeRed4" -msgstr "नारंगी" - -#: colors.cpp:191 -msgctxt "color" -msgid "PaleGoldenrod" -msgstr "फ़ीका-स्वर्णदण्ड" - -#: colors.cpp:192 -msgctxt "color" -msgid "PaleGreen" -msgstr "हरा" - -#: colors.cpp:193 -msgctxt "color" -msgid "PaleGreen1" -msgstr "फ़ीका-हरा1" - -#: colors.cpp:194 -msgctxt "color" -msgid "PaleGreen2" -msgstr "फ़ीका-हरा2" - -#: colors.cpp:195 -msgctxt "color" -msgid "PaleGreen3" -msgstr "फ़ीका-हरा3" - -#: colors.cpp:196 -msgctxt "color" -msgid "PaleGreen4" -msgstr "हरा" - -#: colors.cpp:197 -msgctxt "color" -msgid "PaleTurquoise" -msgstr "फ़ीका-टर्किश" - -#: colors.cpp:198 -msgctxt "color" -msgid "PaleTurquoise1" -msgstr "फ़ीका-टर्किश" - -#: colors.cpp:199 -msgctxt "color" -msgid "PaleTurquoise2" -msgstr "फ़ीका-टर्किश" - -#: colors.cpp:200 -msgctxt "color" -msgid "PaleTurquoise3" -msgstr "फ़ीका-टर्किश" - -#: colors.cpp:201 -msgctxt "color" -msgid "PaleTurquoise4" -msgstr "फ़ीका-टर्किश" - -#: colors.cpp:202 -msgctxt "color" -msgid "PaleVioletRed" -msgstr "फ़ीका-बैंगनी-लाल" - -#: colors.cpp:203 -msgctxt "color" -msgid "PaleVioletRed1" -msgstr "फ़ीका-बैंगनी-लाल1" - -#: colors.cpp:204 -msgctxt "color" -msgid "PaleVioletRed2" -msgstr "फ़ीका-बैंगनी-लाल2" - -#: colors.cpp:205 -msgctxt "color" -msgid "PaleVioletRed3" -msgstr "फ़ीका-बैंगनी-लाल3" - -#: colors.cpp:206 -msgctxt "color" -msgid "PaleVioletRed4" -msgstr "फ़ीका-बैंगनी-लाल" - -#: colors.cpp:207 -msgctxt "color" -msgid "PapayaWhip" -msgstr "पापाया-व्हिप" - -#: colors.cpp:208 -msgctxt "color" -msgid "PeachPuff" -msgstr "पीच-पफ़" - -#: colors.cpp:209 -msgctxt "color" -msgid "PeachPuff1" -msgstr "पीच-पफ़1" - -#: colors.cpp:210 -msgctxt "color" -msgid "PeachPuff2" -msgstr "पीच-पफ़2" - -#: colors.cpp:211 -msgctxt "color" -msgid "PeachPuff3" -msgstr "पीच-पफ़3" - -#: colors.cpp:212 -msgctxt "color" -msgid "PeachPuff4" -msgstr "पीच-पफ़4" - -#: colors.cpp:213 -msgctxt "color" -msgid "PowderBlue" -msgstr "पाउडर-नीला" - -#: colors.cpp:214 -msgctxt "color" -msgid "RosyBrown" -msgstr "रोजी-ब्राउन" - -#: colors.cpp:215 -msgctxt "color" -msgid "RosyBrown1" -msgstr "रोजी-ब्राउन1" - -#: colors.cpp:216 -msgctxt "color" -msgid "RosyBrown2" -msgstr "रोजी-ब्राउन2" - -#: colors.cpp:217 -msgctxt "color" -msgid "RosyBrown3" -msgstr "रोजी-ब्राउन3" - -#: colors.cpp:218 -msgctxt "color" -msgid "RosyBrown4" -msgstr "रोजी-ब्राउन4" - -#: colors.cpp:219 -msgctxt "color" -msgid "RoyalBlue" -msgstr "रॉयल फ्लश" - -#: colors.cpp:220 -msgctxt "color" -msgid "RoyalBlue1" -msgstr "रॉयल फ्लश" - -#: colors.cpp:221 -msgctxt "color" -msgid "RoyalBlue2" -msgstr "रॉयल फ्लश" - -#: colors.cpp:222 -msgctxt "color" -msgid "RoyalBlue3" -msgstr "रॉयल फ्लश" - -#: colors.cpp:223 -msgctxt "color" -msgid "RoyalBlue4" -msgstr "रॉयल फ्लश" - -#: colors.cpp:224 -msgctxt "color" -msgid "SaddleBrown" -msgstr "" - -#: colors.cpp:225 -msgctxt "color" -msgid "SandyBrown" -msgstr "भूराः" - -#: colors.cpp:226 -msgctxt "color" -msgid "SeaGreen" -msgstr "हरा" - -#: colors.cpp:227 -msgctxt "color" -msgid "SeaGreen1" -msgstr "हरा" - -#: colors.cpp:228 -msgctxt "color" -msgid "SeaGreen2" -msgstr "हरा" - -#: colors.cpp:229 -msgctxt "color" -msgid "SeaGreen3" -msgstr "हरा" - -#: colors.cpp:230 -msgctxt "color" -msgid "SeaGreen4" -msgstr "हरा" - -#: colors.cpp:231 -msgctxt "color" -msgid "SkyBlue" -msgstr "नीला" - -#: colors.cpp:232 -msgctxt "color" -msgid "SkyBlue1" -msgstr "नीला" - -#: colors.cpp:233 -msgctxt "color" -msgid "SkyBlue2" -msgstr "नीला" - -#: colors.cpp:234 -msgctxt "color" -msgid "SkyBlue3" -msgstr "नीला" - -#: colors.cpp:235 -msgctxt "color" -msgid "SkyBlue4" -msgstr "नीला" - -#: colors.cpp:236 -msgctxt "color" -msgid "SlateBlue" -msgstr "स्लेटी-नीला1" - -#: colors.cpp:237 -msgctxt "color" -msgid "SlateBlue1" -msgstr "स्लेटी-नीला1" - -#: colors.cpp:238 -msgctxt "color" -msgid "SlateBlue2" -msgstr "स्लेटी-नीला2" - -#: colors.cpp:239 -msgctxt "color" -msgid "SlateBlue3" -msgstr "स्लेटी-नीला1" - -#: colors.cpp:240 -msgctxt "color" -msgid "SlateBlue4" -msgstr "स्लेटी-नीला1" - -#: colors.cpp:241 -msgctxt "color" -msgid "SlateGray" -msgstr "स्लेटी-ग्रे" - -#: colors.cpp:242 -msgctxt "color" -msgid "SlateGray1" -msgstr "स्लेटी-ग्रे1" - -#: colors.cpp:243 -msgctxt "color" -msgid "SlateGray2" -msgstr "स्लेटी-ग्रे2" - -#: colors.cpp:244 -msgctxt "color" -msgid "SlateGray3" -msgstr "स्लेटी-ग्रे3" - -#: colors.cpp:245 -msgctxt "color" -msgid "SlateGray4" -msgstr "स्लेटी-ग्रे4" - -#: colors.cpp:246 -msgctxt "color" -msgid "SlateGrey" -msgstr "स्लेटी-ग्रे" - -#: colors.cpp:247 -msgctxt "color" -msgid "SpringGreen" -msgstr "स्प्रिंगीनेस" - -#: colors.cpp:248 -msgctxt "color" -msgid "SpringGreen1" -msgstr "स्प्रिंगीनेस" - -#: colors.cpp:249 -msgctxt "color" -msgid "SpringGreen2" -msgstr "स्प्रिंगीनेस" - -#: colors.cpp:250 -msgctxt "color" -msgid "SpringGreen3" -msgstr "स्प्रिंगीनेस" - -#: colors.cpp:251 -msgctxt "color" -msgid "SpringGreen4" -msgstr "स्प्रिंगीनेस" - -#: colors.cpp:252 -msgctxt "color" -msgid "SteelBlue" -msgstr "गहरा नीला" - -#: colors.cpp:253 -msgctxt "color" -msgid "SteelBlue1" -msgstr "गहरा नीला" - -#: colors.cpp:254 -msgctxt "color" -msgid "SteelBlue2" -msgstr "गहरा नीला" - -#: colors.cpp:255 -msgctxt "color" -msgid "SteelBlue3" -msgstr "गहरा नीला" - -#: colors.cpp:256 -msgctxt "color" -msgid "SteelBlue4" -msgstr "गहरा नीला" - -#: colors.cpp:257 -msgctxt "color" -msgid "VioletRed" -msgstr "बैंगनी" - -#: colors.cpp:258 -msgctxt "color" -msgid "VioletRed1" -msgstr "बैंगनी" - -#: colors.cpp:259 -msgctxt "color" -msgid "VioletRed2" -msgstr "बैंगनी" - -#: colors.cpp:260 -msgctxt "color" -msgid "VioletRed3" -msgstr "बैंगनी" - -#: colors.cpp:261 -msgctxt "color" -msgid "VioletRed4" -msgstr "बैंगनी" - -#: colors.cpp:262 -msgctxt "color" -msgid "WhiteSmoke" -msgstr "धुँधला-सफेद" - -#: colors.cpp:263 -msgctxt "color" -msgid "YellowGreen" -msgstr "पीला" - -#: colors.cpp:264 -msgctxt "color" -msgid "aquamarine" -msgstr "अक्वॉमरीन" - -#: colors.cpp:265 -msgctxt "color" -msgid "aquamarine1" -msgstr "अक्वॉमरीन1" - -#: colors.cpp:266 -msgctxt "color" -msgid "aquamarine2" -msgstr "अक्वॉमरीन2" - -#: colors.cpp:267 -msgctxt "color" -msgid "aquamarine3" -msgstr "अक्वॉमरीन3" - -#: colors.cpp:268 -msgctxt "color" -msgid "aquamarine4" -msgstr "अक्वॉमरीन" - -#: colors.cpp:269 -msgctxt "color" -msgid "azure" -msgstr "" - -#: colors.cpp:270 -msgctxt "color" -msgid "azure1" -msgstr "" - -#: colors.cpp:271 -msgctxt "color" -msgid "azure2" -msgstr "" - -#: colors.cpp:272 -msgctxt "color" -msgid "azure3" -msgstr "" - -#: colors.cpp:273 -msgctxt "color" -msgid "azure4" -msgstr "" - -#: colors.cpp:274 -msgctxt "color" -msgid "beige" -msgstr "" - -#: colors.cpp:275 -msgctxt "color" -msgid "bisque" -msgstr "बास्क" - -#: colors.cpp:276 -msgctxt "color" -msgid "bisque1" -msgstr "बास्क" - -#: colors.cpp:277 -msgctxt "color" -msgid "bisque2" -msgstr "बास्क" - -#: colors.cpp:278 -msgctxt "color" -msgid "bisque3" -msgstr "बास्क" - -#: colors.cpp:279 -msgctxt "color" -msgid "bisque4" -msgstr "बास्क" - -#: colors.cpp:280 -msgctxt "color" -msgid "black" -msgstr "काला" - -#: colors.cpp:281 -msgctxt "color" -msgid "blue" -msgstr "नीलाः" - -#: colors.cpp:282 -msgctxt "color" -msgid "blue1" -msgstr "नीलाः" - -#: colors.cpp:283 -msgctxt "color" -msgid "blue2" -msgstr "नीलाः" - -#: colors.cpp:284 -msgctxt "color" -msgid "blue3" -msgstr "नीलाः" - -#: colors.cpp:285 -msgctxt "color" -msgid "blue4" -msgstr "नीलाः" - -#: colors.cpp:286 -msgctxt "color" -msgid "brown" -msgstr "भूराः" - -#: colors.cpp:287 -msgctxt "color" -msgid "brown1" -msgstr "भूराः" - -#: colors.cpp:288 -msgctxt "color" -msgid "brown2" -msgstr "भूराः" - -#: colors.cpp:289 -msgctxt "color" -msgid "brown3" -msgstr "भूराः" - -#: colors.cpp:290 -msgctxt "color" -msgid "brown4" -msgstr "भूराः" - -#: colors.cpp:291 -msgctxt "color" -msgid "burlywood" -msgstr "बर्ली-वुड" - -#: colors.cpp:292 -msgctxt "color" -msgid "burlywood1" -msgstr "बर्ली-वुड1" - -#: colors.cpp:293 -msgctxt "color" -msgid "burlywood2" -msgstr "बर्ली-वुड2" - -#: colors.cpp:294 -msgctxt "color" -msgid "burlywood3" -msgstr "बर्ली-वुड3" - -#: colors.cpp:295 -msgctxt "color" -msgid "burlywood4" -msgstr "बर्ली-वुड" - -#: colors.cpp:296 -msgctxt "color" -msgid "chartreuse" -msgstr "" - -#: colors.cpp:297 -msgctxt "color" -msgid "chartreuse1" -msgstr "" - -#: colors.cpp:298 -msgctxt "color" -msgid "chartreuse2" -msgstr "" - -#: colors.cpp:299 -msgctxt "color" -msgid "chartreuse3" -msgstr "" - -#: colors.cpp:300 -msgctxt "color" -msgid "chartreuse4" -msgstr "" - -#: colors.cpp:301 -msgctxt "color" -msgid "chocolate" -msgstr "मिलाएँ" - -#: colors.cpp:302 -msgctxt "color" -msgid "chocolate1" -msgstr "" - -#: colors.cpp:303 -msgctxt "color" -msgid "chocolate2" -msgstr "" - -#: colors.cpp:304 -msgctxt "color" -msgid "chocolate3" -msgstr "" - -#: colors.cpp:305 -msgctxt "color" -msgid "chocolate4" -msgstr "" - -#: colors.cpp:306 -msgctxt "color" -msgid "coral" -msgstr "मूंगा" - -#: colors.cpp:307 -msgctxt "color" -msgid "coral1" -msgstr "मूंगा" - -#: colors.cpp:308 -msgctxt "color" -msgid "coral2" -msgstr "मूंगा" - -#: colors.cpp:309 -msgctxt "color" -msgid "coral3" -msgstr "मूंगा" - -#: colors.cpp:310 -msgctxt "color" -msgid "coral4" -msgstr "मूंगा" - -#: colors.cpp:311 -msgctxt "color" -msgid "cornsilk" -msgstr "कॉर्न-सिल्क" - -#: colors.cpp:312 -msgctxt "color" -msgid "cornsilk1" -msgstr "कॉर्न-सिल्क1" - -#: colors.cpp:313 -msgctxt "color" -msgid "cornsilk2" -msgstr "कॉर्न-सिल्क2" - -#: colors.cpp:314 -msgctxt "color" -msgid "cornsilk3" -msgstr "कॉर्न-सिल्क3" - -#: colors.cpp:315 -msgctxt "color" -msgid "cornsilk4" -msgstr "कॉर्न-सिल्क4" - -#: colors.cpp:316 -msgctxt "color" -msgid "cyan" -msgstr "" - -#: colors.cpp:317 -msgctxt "color" -msgid "cyan1" -msgstr "" - -#: colors.cpp:318 -msgctxt "color" -msgid "cyan2" -msgstr "" - -#: colors.cpp:319 -msgctxt "color" -msgid "cyan3" -msgstr "" - -#: colors.cpp:320 -msgctxt "color" -msgid "cyan4" -msgstr "" - -#: colors.cpp:321 -msgctxt "color" -msgid "firebrick" -msgstr "" - -#: colors.cpp:322 -msgctxt "color" -msgid "firebrick1" -msgstr "" - -#: colors.cpp:323 -msgctxt "color" -msgid "firebrick2" -msgstr "" - -#: colors.cpp:324 -msgctxt "color" -msgid "firebrick3" -msgstr "" - -#: colors.cpp:325 -msgctxt "color" -msgid "firebrick4" -msgstr "" - -#: colors.cpp:326 -msgctxt "color" -msgid "gainsboro" -msgstr "गेन्स-बोरो" - -#: colors.cpp:327 -msgctxt "color" -msgid "gold" -msgstr "" - -#: colors.cpp:328 -msgctxt "color" -msgid "gold1" -msgstr "" - -#: colors.cpp:329 -msgctxt "color" -msgid "gold2" -msgstr "" - -#: colors.cpp:330 -msgctxt "color" -msgid "gold3" -msgstr "" - -#: colors.cpp:331 -msgctxt "color" -msgid "gold4" -msgstr "" - -#: colors.cpp:332 -msgctxt "color" -msgid "goldenrod" -msgstr "फ़ोल्डर (&F)" - -#: colors.cpp:333 -msgctxt "color" -msgid "goldenrod1" -msgstr "" - -#: colors.cpp:334 -msgctxt "color" -msgid "goldenrod2" -msgstr "" - -#: colors.cpp:335 -msgctxt "color" -msgid "goldenrod3" -msgstr "" - -#: colors.cpp:336 -msgctxt "color" -msgid "goldenrod4" -msgstr "" - -#: colors.cpp:337 -msgctxt "color" -msgid "green" -msgstr "हराः" - -#: colors.cpp:338 -msgctxt "color" -msgid "green1" -msgstr "हराः" - -#: colors.cpp:339 -msgctxt "color" -msgid "green2" -msgstr "हराः" - -#: colors.cpp:340 -msgctxt "color" -msgid "green3" -msgstr "हराः" - -#: colors.cpp:341 -msgctxt "color" -msgid "green4" -msgstr "हराः" - -#: colors.cpp:342 -msgctxt "color" -msgid "honeydew" -msgstr "हनी-ड्यू" - -#: colors.cpp:343 -msgctxt "color" -msgid "honeydew1" -msgstr "हनी-ड्यू1" - -#: colors.cpp:344 -msgctxt "color" -msgid "honeydew2" -msgstr "हनी-ड्यू2" - -#: colors.cpp:345 -msgctxt "color" -msgid "honeydew3" -msgstr "हनी-ड्यू3" - -#: colors.cpp:346 -msgctxt "color" -msgid "honeydew4" -msgstr "हनी-ड्यू4" - -#: colors.cpp:347 -msgctxt "color" -msgid "ivory" -msgstr "डी-वाइस" - -#: colors.cpp:348 -msgctxt "color" -msgid "ivory1" -msgstr "" - -#: colors.cpp:349 -msgctxt "color" -msgid "ivory2" -msgstr "" - -#: colors.cpp:350 -msgctxt "color" -msgid "ivory3" -msgstr "" - -#: colors.cpp:351 -msgctxt "color" -msgid "ivory4" -msgstr "" - -#: colors.cpp:352 -msgctxt "color" -msgid "khaki" -msgstr "" - -#: colors.cpp:353 -msgctxt "color" -msgid "khaki1" -msgstr "" - -#: colors.cpp:354 -msgctxt "color" -msgid "khaki2" -msgstr "" - -#: colors.cpp:355 -msgctxt "color" -msgid "khaki3" -msgstr "" - -#: colors.cpp:356 -msgctxt "color" -msgid "khaki4" -msgstr "" - -#: colors.cpp:357 -msgctxt "color" -msgid "lavender" -msgstr "" - -#: colors.cpp:358 -msgctxt "color" -msgid "linen" -msgstr "" - -#: colors.cpp:359 -msgctxt "color" -msgid "magenta" -msgstr "मजेंटा" - -#: colors.cpp:360 -msgctxt "color" -msgid "magenta1" -msgstr "मजेंटा" - -#: colors.cpp:361 -msgctxt "color" -msgid "magenta2" -msgstr "मजेंटा" - -#: colors.cpp:362 -msgctxt "color" -msgid "magenta3" -msgstr "मजेंटा" - -#: colors.cpp:363 -msgctxt "color" -msgid "magenta4" -msgstr "मजेंटा" - -#: colors.cpp:364 -msgctxt "color" -msgid "maroon" -msgstr "कैमरून" - -#: colors.cpp:365 -msgctxt "color" -msgid "maroon1" -msgstr "कैमरून" - -#: colors.cpp:366 -msgctxt "color" -msgid "maroon2" -msgstr "कैमरून" - -#: colors.cpp:367 -msgctxt "color" -msgid "maroon3" -msgstr "कैमरून" - -#: colors.cpp:368 -msgctxt "color" -msgid "maroon4" -msgstr "कैमरून" - -#: colors.cpp:369 -msgctxt "color" -msgid "moccasin" -msgstr "मोकासिन" - -#: colors.cpp:370 -msgctxt "color" -msgid "navy" -msgstr "" - -#: colors.cpp:371 -msgctxt "color" -msgid "orange" -msgstr "नारंगी" - -#: colors.cpp:372 -msgctxt "color" -msgid "orange1" -msgstr "नारंगी" - -#: colors.cpp:373 -msgctxt "color" -msgid "orange2" -msgstr "नारंगी" - -#: colors.cpp:374 -msgctxt "color" -msgid "orange3" -msgstr "नारंगी" - -#: colors.cpp:375 -msgctxt "color" -msgid "orange4" -msgstr "नारंगी" - -#: colors.cpp:376 -msgctxt "color" -msgid "orchid" -msgstr "अभिलेखित (&A)" - -#: colors.cpp:377 -msgctxt "color" -msgid "orchid1" -msgstr "अभिलेखित (&A)" - -#: colors.cpp:378 -msgctxt "color" -msgid "orchid2" -msgstr "अभिलेखित (&A)" - -#: colors.cpp:379 -msgctxt "color" -msgid "orchid3" -msgstr "अभिलेखित (&A)" - -#: colors.cpp:380 -msgctxt "color" -msgid "orchid4" -msgstr "अभिलेखित (&A)" - -#: colors.cpp:381 -msgctxt "color" -msgid "peru" -msgstr "" - -#: colors.cpp:382 -msgctxt "color" -msgid "pink" -msgstr "" - -#: colors.cpp:383 -msgctxt "color" -msgid "pink1" -msgstr "" - -#: colors.cpp:384 -msgctxt "color" -msgid "pink2" -msgstr "" - -#: colors.cpp:385 -msgctxt "color" -msgid "pink3" -msgstr "" - -#: colors.cpp:386 -msgctxt "color" -msgid "pink4" -msgstr "" - -#: colors.cpp:387 -msgctxt "color" -msgid "plum" -msgstr "" - -#: colors.cpp:388 -msgctxt "color" -msgid "plum1" -msgstr "" - -#: colors.cpp:389 -msgctxt "color" -msgid "plum2" -msgstr "" - -#: colors.cpp:390 -msgctxt "color" -msgid "plum3" -msgstr "" - -#: colors.cpp:391 -msgctxt "color" -msgid "plum4" -msgstr "" - -#: colors.cpp:392 -msgctxt "color" -msgid "purple" -msgstr "बैंगनीः" - -#: colors.cpp:393 -msgctxt "color" -msgid "purple1" -msgstr "बैंगनीः" - -#: colors.cpp:394 -msgctxt "color" -msgid "purple2" -msgstr "बैंगनीः" - -#: colors.cpp:395 -msgctxt "color" -msgid "purple3" -msgstr "बैंगनीः" - -#: colors.cpp:396 -msgctxt "color" -msgid "purple4" -msgstr "बैंगनीः" - -#: colors.cpp:397 -msgctxt "color" -msgid "red" -msgstr "लालः" - -#: colors.cpp:398 -msgctxt "color" -msgid "red1" -msgstr "" - -#: colors.cpp:399 -msgctxt "color" -msgid "red2" -msgstr "" - -#: colors.cpp:400 -msgctxt "color" -msgid "red3" -msgstr "" - -#: colors.cpp:401 -msgctxt "color" -msgid "red4" -msgstr "" - -#: colors.cpp:402 -msgctxt "color" -msgid "salmon" -msgstr "" - -#: colors.cpp:403 -msgctxt "color" -msgid "salmon1" -msgstr "गेरूऑ1" - -#: colors.cpp:404 -msgctxt "color" -msgid "salmon2" -msgstr "" - -#: colors.cpp:405 -msgctxt "color" -msgid "salmon3" -msgstr "" - -#: colors.cpp:406 -msgctxt "color" -msgid "salmon4" -msgstr "" - -#: colors.cpp:407 -msgctxt "color" -msgid "seashell" -msgstr "सी-शैल" - -#: colors.cpp:408 -msgctxt "color" -msgid "seashell1" -msgstr "सी-शैल1" - -#: colors.cpp:409 -msgctxt "color" -msgid "seashell2" -msgstr "सी-शैल2" - -#: colors.cpp:410 -msgctxt "color" -msgid "seashell3" -msgstr "सी-शैल3" - -#: colors.cpp:411 -msgctxt "color" -msgid "seashell4" -msgstr "सी-शैल4" - -#: colors.cpp:412 -msgctxt "color" -msgid "sienna" -msgstr "" - -#: colors.cpp:413 -msgctxt "color" -msgid "sienna1" -msgstr "" - -#: colors.cpp:414 -msgctxt "color" -msgid "sienna2" -msgstr "" - -#: colors.cpp:415 -msgctxt "color" -msgid "sienna3" -msgstr "" - -#: colors.cpp:416 -msgctxt "color" -msgid "sienna4" -msgstr "" - -#: colors.cpp:417 -msgctxt "color" -msgid "snow" -msgstr "एक्स-स्नो" - -#: colors.cpp:418 -msgctxt "color" -msgid "snow1" -msgstr "एक्स-स्नो" - -#: colors.cpp:419 -msgctxt "color" -msgid "snow2" -msgstr "एक्स-स्नो" - -#: colors.cpp:420 -msgctxt "color" -msgid "snow3" -msgstr "एक्स-स्नो" - -#: colors.cpp:421 -msgctxt "color" -msgid "snow4" -msgstr "एक्स-स्नो" - -#: colors.cpp:422 -msgctxt "color" -msgid "tan" -msgstr "और" - -#: colors.cpp:423 -msgctxt "color" -msgid "tan1" -msgstr "" - -#: colors.cpp:424 -msgctxt "color" -msgid "tan2" -msgstr "" - -#: colors.cpp:425 -msgctxt "color" -msgid "tan3" -msgstr "" - -#: colors.cpp:426 -msgctxt "color" -msgid "tan4" -msgstr "" - -#: colors.cpp:427 -msgctxt "color" -msgid "thistle" -msgstr "सीटी" - -#: colors.cpp:428 -msgctxt "color" -msgid "thistle1" -msgstr "सीटी" - -#: colors.cpp:429 -msgctxt "color" -msgid "thistle2" -msgstr "सीटी" - -#: colors.cpp:430 -msgctxt "color" -msgid "thistle3" -msgstr "सीटी" - -#: colors.cpp:431 -msgctxt "color" -msgid "thistle4" -msgstr "सीटी" - -#: colors.cpp:432 -msgctxt "color" -msgid "tomato" -msgstr "स्वचलन" - -#: colors.cpp:433 -msgctxt "color" -msgid "tomato1" -msgstr "स्वचलन" - -#: colors.cpp:434 -msgctxt "color" -msgid "tomato2" -msgstr "स्वचलन" - -#: colors.cpp:435 -msgctxt "color" -msgid "tomato3" -msgstr "स्वचलन" - -#: colors.cpp:436 -msgctxt "color" -msgid "tomato4" -msgstr "स्वचलन" - -#: colors.cpp:437 -msgctxt "color" -msgid "turquoise" -msgstr "" - -#: colors.cpp:438 -msgctxt "color" -msgid "turquoise1" -msgstr "" - -#: colors.cpp:439 -msgctxt "color" -msgid "turquoise2" -msgstr "" - -#: colors.cpp:440 -msgctxt "color" -msgid "turquoise3" -msgstr "" - -#: colors.cpp:441 -msgctxt "color" -msgid "turquoise4" -msgstr "" - -#: colors.cpp:442 -msgctxt "color" -msgid "violet" -msgstr "बैंगनी" - -#: colors.cpp:443 -msgctxt "color" -msgid "wheat" -msgstr "चीट (&C)" - -#: colors.cpp:444 -msgctxt "color" -msgid "wheat1" -msgstr "चीट (&C)" - -#: colors.cpp:445 -msgctxt "color" -msgid "wheat2" -msgstr "चीट (&C)" - -#: colors.cpp:446 -msgctxt "color" -msgid "wheat3" -msgstr "चीट (&C)" - -#: colors.cpp:447 -msgctxt "color" -msgid "wheat4" -msgstr "चीट (&C)" - -#: colors.cpp:448 -msgctxt "color" -msgid "white" -msgstr "सफेद" - -#: colors.cpp:449 -msgctxt "color" -msgid "yellow" -msgstr "पीला" - -#: colors.cpp:450 -msgctxt "color" -msgid "yellow1" -msgstr "पीला" - -#: colors.cpp:451 -msgctxt "color" -msgid "yellow2" -msgstr "पीला" - -#: colors.cpp:452 -msgctxt "color" -msgid "yellow3" -msgstr "पीला" - -#: colors.cpp:453 -msgctxt "color" -msgid "yellow4" -msgstr "पीला" diff -Nru kde-l10n-hi-4.12.97/messages/frameworks/kfileaudiopreview5.po kde-l10n-hi-4.13.0/messages/frameworks/kfileaudiopreview5.po --- kde-l10n-hi-4.12.97/messages/frameworks/kfileaudiopreview5.po 2014-01-25 21:41:22.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/frameworks/kfileaudiopreview5.po 1970-01-01 00:00:00.000000000 +0000 @@ -1,34 +0,0 @@ -# translation of kfileaudiopreview4.po to Hindi -# Copyright (C) YEAR This_file_is_part_of_KDE -# This file is distributed under the same license as the PACKAGE package. -# -# Ravishankar Shrivastava , 2007. -msgid "" -msgstr "" -"Project-Id-Version: kfileaudiopreview4\n" -"Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-01-24 18:50+0000\n" -"PO-Revision-Date: 2007-11-15 17:58+0530\n" -"Last-Translator: Ravishankar Shrivastava \n" -"Language-Team: Hindi \n" -"Language: hi\n" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" -"X-Generator: KBabel 1.11.4\n" -"Plural-Forms: nplurals=2; plural=(n!=1);\n" - -#: kfileaudiopreview.cpp:80 -msgid "Play &automatically" -msgstr "स्वचलित बजाएँ (&a)" - -#: mediacontrols_p.h:51 -msgid "start playback" -msgstr "" - -#: mediacontrols_p.h:56 -msgid "pause playback" -msgstr "" - -#~ msgid "Media Player" -#~ msgstr "मीडिया-प्लेयर" diff -Nru kde-l10n-hi-4.12.97/messages/frameworks/ki18n.po kde-l10n-hi-4.13.0/messages/frameworks/ki18n.po --- kde-l10n-hi-4.12.97/messages/frameworks/ki18n.po 2014-02-20 03:39:16.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/frameworks/ki18n.po 1970-01-01 00:00:00.000000000 +0000 @@ -1,9265 +0,0 @@ -# translation of kdelibs4.po to Hindi -# Copyright (C) YEAR This_file_is_part_of_KDE -# This file is distributed under the same license as the PACKAGE package. -# -# Ravishankar Shrivastava , 2007. -# Ravishankar Shrivastava , 2008. -# G Karunakar , 2009, 2010, 2012. -msgid "" -msgstr "" -"Project-Id-Version: kdelibs4\n" -"Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-02-20 01:37+0000\n" -"PO-Revision-Date: 2012-06-25 15:27+0530\n" -"Last-Translator: G Karunakar \n" -"Language-Team: Hindi \n" -"Language: hi\n" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" -"Plural-Forms: nplurals=2; plural=(n!=1);\n" -"X-Generator: Lokalize 1.2\n" - -#. i18n: Decide which string is used to delimit keys in a keyboard -#. shortcut (e.g. + in Ctrl+Alt+Tab) in plain text. -#: kuitmarkup.cpp:294 -msgctxt "shortcut-key-delimiter/plain" -msgid "+" -msgstr "+" - -#. i18n: Decide which string is used to delimit keys in a keyboard -#. shortcut (e.g. + in Ctrl+Alt+Tab) in rich text. -#: kuitmarkup.cpp:298 -msgctxt "shortcut-key-delimiter/rich" -msgid "+" -msgstr "+" - -#. i18n: Decide which string is used to delimit elements in a GUI path -#. (e.g. -> in "Go to Settings->Advanced->Core tab.") in plain text. -#: kuitmarkup.cpp:302 -msgctxt "gui-path-delimiter/plain" -msgid "→" -msgstr "→" - -#. i18n: Decide which string is used to delimit elements in a GUI path -#. (e.g. -> in "Go to Settings->Advanced->Core tab.") in rich text. -#: kuitmarkup.cpp:306 -msgctxt "gui-path-delimiter/rich" -msgid "→" -msgstr "→" - -#. i18n: The messages with context "tag-format-pattern format" -#. are KUIT patterns for formatting the text found inside KUIT tags. -#. The format is either "plain" or "rich", and tells if the pattern -#. is used for plain text or rich text (which can use HTML tags). -#. You may be in general satisfied with the patterns as they are in the -#. original. Some things you may consider changing: -#. - the proper quotes, those used in msgid are English-standard -#. - the and tags, does your language script work well with them? -#: kuitmarkup.cpp:716 -#, fuzzy, kde-format -#| msgctxt "@title/plain" -#| msgid "== %1 ==" -msgctxt "tag-format-pattern plain" -msgid "== %1 ==" -msgstr "== %1 ==" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:721 -#, fuzzy, kde-format -#| msgctxt "@title/rich" -#| msgid "<h2>%1</h2>" -msgctxt "tag-format-pattern <title> rich" -msgid "<h2>%1</h2>" -msgstr "<h2>%1</h2>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:729 -#, fuzzy, kde-format -#| msgctxt "@subtitle/plain" -#| msgid "~ %1 ~" -msgctxt "tag-format-pattern <subtitle> plain" -msgid "~ %1 ~" -msgstr "~ %1 ~" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:734 -#, fuzzy, kde-format -#| msgctxt "@subtitle/rich" -#| msgid "<h3>%1</h3>" -msgctxt "tag-format-pattern <subtitle> rich" -msgid "<h3>%1</h3>" -msgstr "<h3>%1</h3>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:742 -#, fuzzy, kde-format -#| msgctxt "@application/plain" -#| msgid "%1" -msgctxt "tag-format-pattern <para> plain" -msgid "%1" -msgstr "%1" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:747 -#, fuzzy, kde-format -#| msgctxt "@shortcut/rich" -#| msgid "<b>%1</b>" -msgctxt "tag-format-pattern <para> rich" -msgid "<p>%1</p>" -msgstr "<b>%1</b>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:755 -#, fuzzy, kde-format -#| msgctxt "@application/plain" -#| msgid "%1" -msgctxt "tag-format-pattern <list> plain" -msgid "%1" -msgstr "%1" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:760 -#, fuzzy, kde-format -#| msgctxt "@item/rich" -#| msgid "<li>%1</li>" -msgctxt "tag-format-pattern <list> rich" -msgid "<ul>%1</ul>" -msgstr "<li>%1</li>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:768 -#, fuzzy, kde-format -#| msgctxt "@item/plain" -#| msgid " * %1" -msgctxt "tag-format-pattern <item> plain" -msgid " * %1" -msgstr " * %1" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:773 -#, fuzzy, kde-format -#| msgctxt "@item/rich" -#| msgid "<li>%1</li>" -msgctxt "tag-format-pattern <item> rich" -msgid "<li>%1</li>" -msgstr "<li>%1</li>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:780 -#, fuzzy, kde-format -#| msgctxt "@note/plain" -#| msgid "Note: %1" -msgctxt "tag-format-pattern <note> plain" -msgid "Note: %1" -msgstr "टीप: %1" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:785 -#, fuzzy, kde-format -#| msgctxt "@note/rich" -#| msgid "<i>Note</i>: %1" -msgctxt "tag-format-pattern <note> rich" -msgid "<i>Note</i>: %1" -msgstr "<i>टीप</i>: %1" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:791 -#, fuzzy, kde-format -#| msgid "Re: %1" -msgctxt "" -"tag-format-pattern <note label=> plain\n" -"%1 is the text, %2 is the note label" -msgid "%2: %1" -msgstr "जवाब: %1" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:797 -#, fuzzy, kde-format -#| msgctxt "" -#| "@note-with-label/rich\n" -#| "%1 is the note label, %2 is the text" -#| msgid "<i>%1</i>: %2" -msgctxt "" -"tag-format-pattern <note label=> rich\n" -"%1 is the text, %2 is the note label" -msgid "<i>%2</i>: %1" -msgstr "<i>%1</i>: %2" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:804 -#, fuzzy, kde-format -#| msgctxt "@warning/plain" -#| msgid "WARNING: %1" -msgctxt "tag-format-pattern <warning> plain" -msgid "WARNING: %1" -msgstr "चेतावनी: %1" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:809 -#, fuzzy, kde-format -#| msgctxt "@warning/rich" -#| msgid "<b>Warning</b>: %1" -msgctxt "tag-format-pattern <warning> rich" -msgid "<b>Warning</b>: %1" -msgstr "<b>चेतावनी</b>: %1" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:815 -#, fuzzy, kde-format -#| msgid "Re: %1" -msgctxt "" -"tag-format-pattern <warning label=> plain\n" -"%1 is the text, %2 is the warning label" -msgid "%2: %1" -msgstr "जवाब: %1" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:821 -#, fuzzy, kde-format -#| msgctxt "" -#| "@warning-with-label/rich\n" -#| "%1 is the warning label, %2 is the text" -#| msgid "<b>%1</b>: %2" -msgctxt "" -"tag-format-pattern <warning label=> rich\n" -"%1 is the text, %2 is the warning label" -msgid "<b>%2</b>: %1" -msgstr "<b>%1</b>: %2" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:828 -#, fuzzy, kde-format -#| msgctxt "@application/plain" -#| msgid "%1" -msgctxt "tag-format-pattern <link> plain" -msgid "%1" -msgstr "%1" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:833 -#, fuzzy, kde-format -#| msgctxt "" -#| "@link-with-description/rich\n" -#| "%1 is the URL, %2 is the descriptive text" -#| msgid "<a href=\"%1\">%2</a>" -msgctxt "tag-format-pattern <link> rich" -msgid "<a href=\"%1\">%1</a>" -msgstr "<a href=\"%1\">%2</a>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:839 -#, fuzzy, kde-format -#| msgctxt "name of digit set with digit string, e.g. 'Arabic (0123456789)'" -#| msgid "%1 (%2)" -msgctxt "" -"tag-format-pattern <link url=> plain\n" -"%1 is the descriptive text, %2 is the URL" -msgid "%1 (%2)" -msgstr "%1 (%2)" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:845 -#, fuzzy, kde-format -#| msgctxt "" -#| "@link-with-description/rich\n" -#| "%1 is the URL, %2 is the descriptive text" -#| msgid "<a href=\"%1\">%2</a>" -msgctxt "" -"tag-format-pattern <link url=> rich\n" -"%1 is the descriptive text, %2 is the URL" -msgid "<a href=\"%2\">%1</a>" -msgstr "<a href=\"%1\">%2</a>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:852 -#, fuzzy, kde-format -#| msgctxt "@filename/plain" -#| msgid "‘%1’" -msgctxt "tag-format-pattern <filename> plain" -msgid "‘%1’" -msgstr "‘%1’" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:857 -#, fuzzy, kde-format -#| msgctxt "@filename/rich" -#| msgid "<tt>%1</tt>" -msgctxt "tag-format-pattern <filename> rich" -msgid "<tt>%1</tt>" -msgstr "<tt>%1</tt>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:864 -#, fuzzy, kde-format -#| msgctxt "@application/plain" -#| msgid "%1" -msgctxt "tag-format-pattern <application> plain" -msgid "%1" -msgstr "%1" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:869 -#, fuzzy, kde-format -#| msgctxt "@application/plain" -#| msgid "%1" -msgctxt "tag-format-pattern <application> rich" -msgid "%1" -msgstr "%1" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:876 -#, fuzzy, kde-format -#| msgctxt "@application/plain" -#| msgid "%1" -msgctxt "tag-format-pattern <command> plain" -msgid "%1" -msgstr "%1" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:881 -#, fuzzy, kde-format -#| msgctxt "@filename/rich" -#| msgid "<tt>%1</tt>" -msgctxt "tag-format-pattern <command> rich" -msgid "<tt>%1</tt>" -msgstr "<tt>%1</tt>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:887 -#, fuzzy, kde-format -#| msgctxt "" -#| "@command-with-section/plain\n" -#| "%1 is the command name, %2 is its man section" -#| msgid "%1(%2)" -msgctxt "" -"tag-format-pattern <command section=> plain\n" -"%1 is the command name, %2 is its man section" -msgid "%1(%2)" -msgstr "%1 (%2)" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:893 -#, fuzzy, kde-format -#| msgctxt "" -#| "@command-with-section/rich\n" -#| "%1 is the command name, %2 is its man section" -#| msgid "<tt>%1(%2)</tt>" -msgctxt "" -"tag-format-pattern <command section=> rich\n" -"%1 is the command name, %2 is its man section" -msgid "<tt>%1(%2)</tt>" -msgstr "<tt>%1(%2)</tt>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:900 -#, fuzzy, kde-format -#| msgctxt "@resource/plain" -#| msgid "“%1”" -msgctxt "tag-format-pattern <resource> plain" -msgid "“%1”" -msgstr "“%1”" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:905 -#, fuzzy, kde-format -#| msgctxt "@resource/plain" -#| msgid "“%1”" -msgctxt "tag-format-pattern <resource> rich" -msgid "“%1”" -msgstr "“%1”" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:912 -#, fuzzy, kde-format -#| msgctxt "@resource/plain" -#| msgid "“%1”" -msgctxt "tag-format-pattern <icode> plain" -msgid "“%1”" -msgstr "“%1”" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:917 -#, fuzzy, kde-format -#| msgctxt "@filename/rich" -#| msgid "<tt>%1</tt>" -msgctxt "tag-format-pattern <icode> rich" -msgid "<tt>%1</tt>" -msgstr "<tt>%1</tt>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:924 -#, kde-format -msgctxt "tag-format-pattern <bcode> plain" -msgid "" -"\n" -"%1\n" -msgstr "" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:929 -#, fuzzy, kde-format -#| msgctxt "@shortcut/rich" -#| msgid "<b>%1</b>" -msgctxt "tag-format-pattern <bcode> rich" -msgid "<pre>%1</pre>" -msgstr "<b>%1</b>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:936 -#, fuzzy, kde-format -#| msgctxt "@application/plain" -#| msgid "%1" -msgctxt "tag-format-pattern <shortcut> plain" -msgid "%1" -msgstr "%1" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:941 -#, fuzzy, kde-format -#| msgctxt "@shortcut/rich" -#| msgid "<b>%1</b>" -msgctxt "tag-format-pattern <shortcut> rich" -msgid "<b>%1</b>" -msgstr "<b>%1</b>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:948 -#, fuzzy, kde-format -#| msgctxt "@interface/plain" -#| msgid "|%1|" -msgctxt "tag-format-pattern <interface> plain" -msgid "|%1|" -msgstr "|%1|" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:953 -#, fuzzy, kde-format -#| msgctxt "@interface/rich" -#| msgid "<i>%1</i>" -msgctxt "tag-format-pattern <interface> rich" -msgid "<i>%1</i>" -msgstr "<i>%1</i>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:960 -#, fuzzy, kde-format -#| msgctxt "@emphasis/plain" -#| msgid "*%1*" -msgctxt "tag-format-pattern <emphasis> plain" -msgid "*%1*" -msgstr "*%1*" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:965 -#, fuzzy, kde-format -#| msgctxt "@interface/rich" -#| msgid "<i>%1</i>" -msgctxt "tag-format-pattern <emphasis> rich" -msgid "<i>%1</i>" -msgstr "<i>%1</i>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:970 -#, fuzzy, kde-format -#| msgctxt "@emphasis-strong/plain" -#| msgid "**%1**" -msgctxt "tag-format-pattern <emphasis-strong> plain" -msgid "**%1**" -msgstr "**%1**" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:975 -#, fuzzy, kde-format -#| msgctxt "@shortcut/rich" -#| msgid "<b>%1</b>" -msgctxt "tag-format-pattern <emphasis-strong> rich" -msgid "<b>%1</b>" -msgstr "<b>%1</b>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:982 -#, fuzzy, kde-format -#| msgctxt "@placeholder/plain" -#| msgid "<%1>" -msgctxt "tag-format-pattern <placeholder> plain" -msgid "<%1>" -msgstr "<%1>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:987 -#, fuzzy, kde-format -#| msgctxt "@placeholder/rich" -#| msgid "<<i>%1</i>>" -msgctxt "tag-format-pattern <placeholder> rich" -msgid "<<i>%1</i>>" -msgstr "<<i>%1</i>>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:994 -#, fuzzy, kde-format -#| msgctxt "@placeholder/plain" -#| msgid "<%1>" -msgctxt "tag-format-pattern <email> plain" -msgid "<%1>" -msgstr "<%1>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:999 -#, fuzzy, kde-format -#| msgctxt "@email/rich" -#| msgid "<<a href=\"mailto:%1\">%1</a>>" -msgctxt "tag-format-pattern <email> rich" -msgid "<<a href=\"mailto:%1\">%1</a>>" -msgstr "<<a href=\"mailto:%1\">%1</a>>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:1005 -#, fuzzy, kde-format -#| msgctxt "" -#| "@email-with-name/plain\n" -#| "%1 is name, %2 is address" -#| msgid "%1 <%2>" -msgctxt "" -"tag-format-pattern <email address=> plain\n" -"%1 is name, %2 is address" -msgid "%1 <%2>" -msgstr "%1 <%2>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:1011 -#, fuzzy, kde-format -#| msgctxt "" -#| "@email-with-name/rich\n" -#| "%1 is name, %2 is address" -#| msgid "<a href=\"mailto:%2\">%1</a>" -msgctxt "" -"tag-format-pattern <email address=> rich\n" -"%1 is name, %2 is address" -msgid "<a href=\"mailto:%2\">%1</a>" -msgstr "<a href=\"mailto:%2\">%1</a>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:1018 -#, fuzzy, kde-format -#| msgctxt "@envar/plain" -#| msgid "$%1" -msgctxt "tag-format-pattern <envar> plain" -msgid "$%1" -msgstr "$%1" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:1023 -#, fuzzy, kde-format -#| msgctxt "@envar/rich" -#| msgid "<tt>$%1</tt>" -msgctxt "tag-format-pattern <envar> rich" -msgid "<tt>$%1</tt>" -msgstr "<tt>$%1</tt>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:1030 -#, fuzzy, kde-format -#| msgctxt "@message/plain" -#| msgid "/%1/" -msgctxt "tag-format-pattern <message> plain" -msgid "/%1/" -msgstr "/%1/" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:1035 -#, fuzzy, kde-format -#| msgctxt "@interface/rich" -#| msgid "<i>%1</i>" -msgctxt "tag-format-pattern <message> rich" -msgid "<i>%1</i>" -msgstr "<i>%1</i>" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:1042 -#, fuzzy, kde-format -#| msgctxt "@application/plain" -#| msgid "%1" -msgctxt "tag-format-pattern <nl> plain" -msgid "%1\n" -msgstr "%1" - -#. i18n: KUIT pattern, see the comment to the first of these entries above. -#: kuitmarkup.cpp:1047 -#, kde-format -msgctxt "tag-format-pattern <nl> rich" -msgid "%1<br/>" -msgstr "" - -#~ msgctxt "NAME OF TRANSLATORS" -#~ msgid "Your names" -#~ msgstr "करुणाकर गुंटुपल्ली" - -#~ msgctxt "EMAIL OF TRANSLATORS" -#~ msgid "Your emails" -#~ msgstr "karunakar@indlinux.org" - -#~ msgid "Name" -#~ msgstr "नाम" - -#~ msgid "Host" -#~ msgstr "होस्ट" - -#~ msgid "Port" -#~ msgstr "पोर्ट" - -#~ msgid "i18n() takes at least one argument" -#~ msgstr "i18n() कम से कम तर्क लेता है" - -#~ msgid "i18nc() takes at least two arguments" -#~ msgstr "i18nc() कम से कम दो तर्क लेता है" - -#~ msgid "i18np() takes at least two arguments" -#~ msgstr "i18np() कम से कम दो तर्क लेता है" - -#~ msgid "i18ncp() takes at least three arguments" -#~ msgstr "i18ncp() कम से कम तीन तर्क लेता है" - -#~ msgid "System Default (currently: %1)" -#~ msgstr "तंत्र डिफ़ॉल्ट (वर्तमान में: %1)" - -#~ msgid "Editor Chooser" -#~ msgstr "संपादक चयनकर्ता" - -#~ msgid "" -#~ "Please choose the default text editing component that you wish to use in " -#~ "this application. If you choose <B>System Default</B>, the application " -#~ "will honor your changes in the System Settings. All other choices will " -#~ "override that setting." -#~ msgstr "" -#~ "इस अनुप्रयोग में उपयोग के लिए कृपया डिफ़ॉल्ट पाठ संपादन अवयव चुनें. यदि आप <B>सिस्टम " -#~ "डिफ़ॉल्ट</B> चुनते हैं, अनुप्रयोग आपके परिवर्तनों को नियंत्रण केंद्र में रखेगा. अन्य सभी " -#~ "विकल्प इस सेटिंग से हट जाएंगे." - -#~ msgid "" -#~ "The template needs information about you, which is stored in your address " -#~ "book.\n" -#~ "However, the required plugin could not be loaded.\n" -#~ "\n" -#~ "Please install the KDEPIM/Kontact package for your system." -#~ msgstr "" -#~ "टैम्प्लेट को आपके बारे में जानकारी चाहिए जो कि आपके पता पुस्तिका में भंडारित है.\n" -#~ "हालाकि वांछित प्लगइन लोड नहीं किया जा सका.\n" -#~ "\n" -#~ "कृपया अपने तंत्र के लिए केडीईपीआईएम/कॉन्टेक्ट पैकेज संस्थापित करें." - -#~ msgid "TETest" -#~ msgstr "टीई-जांच" - -#~ msgid "Only local files are supported." -#~ msgstr "सिर्फ स्थानीय फ़ाइलें ही समर्थित." - -#~ msgid "Keep output results from scripts" -#~ msgstr "आउटपुट परिणामों को स्क्रिप्ट से दूर रखें" - -#~ msgid "Check whether config file itself requires updating" -#~ msgstr "जांचें कि कॉन्फ़िग फ़ाइल को स्वयं को अद्यतन होने की आवश्यकता तो नहीं है" - -#~ msgid "File to read update instructions from" -#~ msgstr "फ़ाइल जिसमें से अपडेट निर्देश पढ़ने हैं" - -#~ msgid "KConf Update" -#~ msgstr "के-कॉन्फ अद्यतन" - -#~ msgid "KDE Tool for updating user configuration files" -#~ msgstr "उपयोक्ता कॉन्फ़िगरेशन फ़ाइलों को अपडेट करने के लिए केडीई औज़ार" - -#~ msgid "(c) 2001, Waldo Bastian" -#~ msgstr "(C) 2001 वाल्दो बास्तियान" - -#~ msgid "Waldo Bastian" -#~ msgstr "वाल्दो बास्तियान" - -#~ msgid "??" -#~ msgstr "??" - -#~ msgid "&About" -#~ msgstr "के बारे में (&A)" - -#~ msgid "" -#~ "No information available.\n" -#~ "The supplied KAboutData object does not exist." -#~ msgstr "" -#~ "कोई जानकारी उपलब्ध नहीं.\n" -#~ " प्रेषित किया गया KAboutData ऑब्जेक्ट अस्तित्व में नहीं है." - -#~ msgid "A&uthor" -#~ msgstr "लेखक (&u)" - -#~ msgid "A&uthors" -#~ msgstr "लेखक गण (&u)" - -#~ msgid "" -#~ "Please use <a href=\"http://bugs.kde.org\">http://bugs.kde.org</a> to " -#~ "report bugs.\n" -#~ msgstr "" -#~ "कृपया <a href=\"http://bugs.kde.org\">http://bugs.kde.org</a> का उपयोग बग " -#~ "रिपोर्ट के लिए करें.\n" - -#~ msgid "Please report bugs to <a href=\"mailto:%1\">%2</a>.\n" -#~ msgstr "कृपया बग रिपोर्ट यहाँ <a href=\"mailto:%1\">%2</a> करें.\n" - -#~ msgid "&Thanks To" -#~ msgstr "इन्हें धन्यवाद (&T)" - -#~ msgid "T&ranslation" -#~ msgstr "अनुवाद (&r)" - -#~ msgid "&License Agreement" -#~ msgstr "लाइसेंस एग्रीमेंट (&L)" - -#~ msgid "Author" -#~ msgstr "लेखक" - -#~ msgid "Email" -#~ msgstr "ईमेल" - -#~ msgid "Homepage" -#~ msgstr "मुख पृष्ठ" - -#~ msgid "Task" -#~ msgstr "कार्य" - -#~ msgid "" -#~ "<html><font size=\"5\">%1</font><br/><b>version %2</b><br/>Using KDE %3</" -#~ "html>" -#~ msgstr "" -#~ "<html><font size=\"5\">%1</font><br/><b>संस्करण %2</b><br/>केडीई %3 प्रयोग में " -#~ "है</html>" - -#~ msgid "%1 %2, %3" -#~ msgstr "%1 %2, %3" - -#~ msgid "Other Contributors:" -#~ msgstr "अन्य सहयोगीः" - -#~ msgid "(No logo available)" -#~ msgstr "(कोई लोगो उपलब्ध नहीं)" - -#~ msgid "About %1" -#~ msgstr "%1 के बारे में" - -#~ msgid "Undo: %1" -#~ msgstr "पहले जैसा: %1" - -#~ msgid "Redo: %1" -#~ msgstr "दोहराएँ: %1" - -#~ msgid "&Undo" -#~ msgstr "पहले जैसा (&U)" - -#~ msgid "&Redo" -#~ msgstr "दोहराएँ (&R)" - -#~ msgid "&Undo: %1" -#~ msgstr "पहले जैसा: %1 (&U)" - -#~ msgid "&Redo: %1" -#~ msgstr "दोहराएँ: %1 (&R)" - -#~ msgid "Close" -#~ msgstr "बंद करें" - -#~ msgctxt "Freeze the window geometry" -#~ msgid "Freeze" -#~ msgstr "फ्रीज़" - -#~ msgctxt "Dock this window" -#~ msgid "Dock" -#~ msgstr "डॉक" - -#~ msgid "Detach" -#~ msgstr "अलग करें" - -#~ msgid "Hide %1" -#~ msgstr "छुपाएँ %1" - -#~ msgid "Show %1" -#~ msgstr "%1 दिखाएँ" - -#~ msgid "Search Columns" -#~ msgstr "खोज स्तम्भ" - -#~ msgid "All Visible Columns" -#~ msgstr "सभी द्ष्टिगोचर स्तम्भ" - -#~ msgctxt "Column number %1" -#~ msgid "Column No. %1" -#~ msgstr "स्तम्भ सं. %1" - -#~ msgid "S&earch:" -#~ msgstr "ढूंढें: (&e)" - -#~ msgid "&Password:" -#~ msgstr "पासवर्ड: (&P)" - -#~ msgid "&Keep password" -#~ msgstr "पासवर्ड याद रखें (&K)" - -#~ msgid "&Verify:" -#~ msgstr "सत्यापित: (&V)" - -#~ msgid "Password strength meter:" -#~ msgstr "पासवर्ड सामर्थ्य मीटर:" - -#~ msgid "Passwords do not match" -#~ msgstr "पासवर्ड मेल नहीं खाता." - -#~ msgid "You entered two different passwords. Please try again." -#~ msgstr "आपने दो भिन्न पासवर्ड भरे हैं. कृपया फिर से कोशिश करें." - -#~ msgid "Low Password Strength" -#~ msgstr "पासवर्ड कम सामर्थ्य" - -#~ msgid "Password Input" -#~ msgstr "पासवर्ड इनपुट" - -#~ msgid "Password is empty" -#~ msgstr "पासवर्ड रिक्त है" - -#~ msgid "Password must be at least 1 character long" -#~ msgid_plural "Password must be at least %1 characters long" -#~ msgstr[0] "पासवर्ड को कम से कम एक अक्षर लंबा होना चाहिए" -#~ msgstr[1] "पासवर्ड को कम से कम %1 अक्षर लंबा होना चाहिए" - -#~ msgid "Passwords match" -#~ msgstr "पासवर्ड मेल खाता है" - -#~ msgctxt "@option:check" -#~ msgid "Do Spellchecking" -#~ msgstr "वर्तनी की जांच करें" - -#~ msgctxt "@option:check" -#~ msgid "Create &root/affix combinations not in dictionary" -#~ msgstr " root/affix संयोजन बनाएँ जो शब्दकोश में न हों " - -#~ msgctxt "@option:check" -#~ msgid "Consider run-together &words as spelling errors" -#~ msgstr "एक साथ लिखे शब्दों को वर्तनी की गलतियों में लें (&w)" - -#~ msgctxt "@label:listbox" -#~ msgid "&Dictionary:" -#~ msgstr "शब्दकोश: (&D)" - -#~ msgctxt "@label:listbox" -#~ msgid "&Encoding:" -#~ msgstr "एनकोडिंग: (&E)" - -#~ msgctxt "@item:inlistbox Spell checker" -#~ msgid "International <application>Ispell</application>" -#~ msgstr "अंतर्राष्ट्रीय <application>आईस्पैल</application>" - -#~ msgctxt "@item:inlistbox Spell checker" -#~ msgid "<application>Aspell</application>" -#~ msgstr "<application>ए-स्पेल</application>" - -#~ msgctxt "@item:inlistbox Spell checker" -#~ msgid "<application>Hspell</application>" -#~ msgstr "<application>एच-स्पेल</application>" - -#~ msgctxt "@item:inlistbox Spell checker" -#~ msgid "<application>Zemberek</application>" -#~ msgstr "<application>जेम्बेरेक</application>" - -#~ msgctxt "@item:inlistbox Spell checker" -#~ msgid "<application>Hunspell</application>" -#~ msgstr "<application>हनस्पेल</application>" - -#~ msgctxt "@label:listbox" -#~ msgid "&Client:" -#~ msgstr "क्लाएंट: (&C)" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "Hebrew" -#~ msgstr "हिब्रू" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "Turkish" -#~ msgstr "तुर्की" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "English" -#~ msgstr "अंग्रेज़ी" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "Spanish" -#~ msgstr "स्पेनी" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "Danish" -#~ msgstr "दानिश" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "German" -#~ msgstr "जर्मन" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "German (new spelling)" -#~ msgstr "जर्मन (नई वर्तनी)" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "Brazilian Portuguese" -#~ msgstr "पुर्तगाली (ब्राजीलीयाइ)" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "Portuguese" -#~ msgstr "पुर्तगाली" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "Esperanto" -#~ msgstr "एस्परेन्तो" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "Norwegian" -#~ msgstr "नारवेजियाई " - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "Polish" -#~ msgstr "पोलिश" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "Russian" -#~ msgstr "रूसी" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "Slovenian" -#~ msgstr "स्लोवेनियाई" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "Slovak" -#~ msgstr "स्लोवाक" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "Czech" -#~ msgstr "चेक" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "Swedish" -#~ msgstr "स्वीडिश" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "Swiss German" -#~ msgstr "स्विस जर्मन" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "Ukrainian" -#~ msgstr "उक्रेनियाई" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "Lithuanian" -#~ msgstr "लिथुआनियाई" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "French" -#~ msgstr "फ्रांसीसी" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "Belarusian" -#~ msgstr "बेलारूसी" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "Hungarian" -#~ msgstr "हंगेरियाई" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "Unknown" -#~ msgstr "अज्ञात" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "<application>ISpell</application> Default" -#~ msgstr "<application>आईस्पैल</application> डिफ़ॉल्ट" - -#~ msgctxt "@item Spelling dictionary: %1 dictionary name, %2 file name" -#~ msgid "Default - %1 [%2]" -#~ msgstr "डिफ़ॉल्ट - %1 [%2]" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "<application>ASpell</application> Default" -#~ msgstr "<application>आस्पैल</application> डिफ़ॉल्ट" - -#~ msgctxt "@item Spelling dictionary: %1 dictionary name" -#~ msgid "Default - %1" -#~ msgstr "डिफ़ॉल्ट - %1" - -#~ msgctxt "@item Spelling dictionary" -#~ msgid "<application>Hunspell</application> Default" -#~ msgstr "<application>हनस्पैल</application> डिफ़ॉल्ट" - -#~ msgid "You have to restart the dialog for changes to take effect" -#~ msgstr "आपको इस संवाद को फिर से चालू करना होगा ताकि किए गए परिवर्तन लागू हो सकें" - -#~ msgid "Spell Checker" -#~ msgstr "वर्तनी शोधक" - -#~ msgid "Check Spelling" -#~ msgstr "वर्तनी जांचें" - -#~ msgid "&Finished" -#~ msgstr "पूर्ण (&F)" - -#~ msgid "Unknown word:" -#~ msgstr "अज्ञात शब्दः" - -#~ msgid "Unknown word" -#~ msgstr "अज्ञात शब्द" - -#~ msgid "<b>misspelled</b>" -#~ msgstr "<b>गलत वर्तनी</b>" - -#~ msgid "" -#~ "<qt>\n" -#~ "<p>Select the language of the document you are proofing here.</p>\n" -#~ "</qt>" -#~ msgstr "" -#~ "<qt>\n" -#~ "<p>दस्तावेज़ की भाषा चुनें जिसका प्रूफ आप यहाँ देख रहे हैं.</p>\n" -#~ "</qt>" - -#~ msgid "&Language:" -#~ msgstr "भाषा (&L):" - -#~ msgid "Text excerpt showing the unknown word in its context." -#~ msgstr "अज्ञात शब्द का सारांश कॉन्टेक्स्ट में दिखाया गया है." - -#~ msgid "... the <b>misspelled</b> word shown in context ..." -#~ msgstr "... <b>गलत लिखा शब्द</b> कॉन्टेक्स्ट में दिखाया गया है ..." - -#~ msgid "<< Add to Dictionary" -#~ msgstr "<< शब्दकोष में जोड़ें" - -#~ msgid "" -#~ "<qt>\n" -#~ "<p>Click here to replace all occurrences of the unknown text with the " -#~ "text in the edit box above (to the left).</p>\n" -#~ "</qt>" -#~ msgstr "" -#~ "<qt>\n" -#~ "<p>ऊपर(बाएं भाग में) संपादन बक्से में दिए शब्द से सभी अज्ञात शब्दों को बदलने के लिए यहाँ " -#~ "क्लिक करें.</p>\n" -#~ "</qt>" - -#~ msgid "R&eplace All" -#~ msgstr "सभी बदलें (&e)" - -#~ msgid "Suggestion List" -#~ msgstr "सुझाई सूची" - -#~ msgid "Suggested Words" -#~ msgstr "वैकल्पिक शब्द " - -#~ msgid "" -#~ "<qt>\n" -#~ "<p>Click here to replace this occurrence of the unknown text with the " -#~ "text in the edit box above (to the left).</p>\n" -#~ "</qt>" -#~ msgstr "" -#~ "<qt>\n" -#~ "<p>ऊपर(बाएं भाग में) संपादन बक्से में दिए शब्द से सभी अज्ञात शब्दों को बदलने के लिए यहाँ " -#~ "क्लिक करें.</p>\n" -#~ "</qt>" - -#~ msgid "&Replace" -#~ msgstr "बदलें (&R)" - -#~ msgid "Replace &with:" -#~ msgstr "से बदलें (&w):" - -#~ msgid "&Ignore" -#~ msgstr "नज़रअंदाज़ करें (&I)" - -#~ msgid "I&gnore All" -#~ msgstr "सभी नज़रअंदाज़ करें (&g)" - -#~ msgid "S&uggest" -#~ msgstr "सुझाएँ (&u)" - -#~ msgid "Language Selection" -#~ msgstr "भाषा चयन" - -#~ msgid "As-you-type spell checking enabled." -#~ msgstr "टाइप करने के दौरान वर्तनी जांच सक्षम रखें" - -#~ msgid "As-you-type spell checking disabled." -#~ msgstr "टाइप करने के दौरान वर्तनी जांच अक्षम रखें" - -#~ msgid "Incremental Spellcheck" -#~ msgstr "इंक्रीमेंटल वर्तनी जांच" - -#~ msgid "Too many misspelled words. As-you-type spell checking disabled." -#~ msgstr "खूब सारे गलत वर्तनी के शब्द हैं. टाइप करने के दौरान वर्तनी जांच बंद रखा गया है" - -#~ msgid "Check Spelling..." -#~ msgstr "वर्तनी जांचें" - -#~ msgid "Auto Spell Check" -#~ msgstr "स्वचालित वर्तनी जांच" - -#~ msgid "Allow Tabulations" -#~ msgstr "सारणीकरण स्वीकारें" - -#~ msgid "Spell Checking" -#~ msgstr "वर्तनी की जांच " - -#~ msgid "&Back" -#~ msgstr "पीछे (&B)" - -#~ msgctxt "Opposite to Back" -#~ msgid "&Next" -#~ msgstr "अगला (&N)" - -#~ msgid "Unknown View" -#~ msgstr "अज्ञात दृश्य" - -#~ msgid "" -#~ "A command-line application that can be used to run KUnitTest modules." -#~ msgstr "" -#~ "के-यूनिट-टेस्ट मॉड्यूल को चलाने के लिए प्रयोग में लिया जा सकने वाला कमांड लाइन अनुप्रयोग." - -#~ msgid "Only run modules whose filenames match the regexp." -#~ msgstr "सिर्फ वही मॉड्यूल चलाएं जिनके फ़ाइलनाम रेगएक्सपी से मेल खाते हैं." - -#~ msgid "" -#~ "Disables debug capturing. You typically use this option when you use the " -#~ "GUI." -#~ msgstr "" -#~ "डिबग कैप्चरिंग को अक्षम करें. आप यह विकल्प तब प्रयोग करते हैं जब आप जीयूआई इस्तेमाल करते " -#~ "हैं." - -#~ msgid "KUnitTest ModRunner" -#~ msgstr "के-यूनिट-टेस्ट मॉड-रनर" - -#~ msgid "(C) 2005 Jeroen Wijnhout" -#~ msgstr "(C) 2005 जेरोन विजहाउट" - -#~ msgid "Please contact your system administrator." -#~ msgstr "कृपया अपने तंत्र प्रशासक से संपर्क करें." - -#~ msgid "Configuration file \"%1\" not writable.\n" -#~ msgstr "कॉन्फ़िगरेशन फ़ाइल \"%1\" लिखने योग्य नहीं है.\n" - -#~ msgid "am" -#~ msgstr "पूर्वाह्न" - -#~ msgid "pm" -#~ msgstr "अपराह्न" - -#~ msgid "No target filename has been given." -#~ msgstr "कोई लक्षित फ़ाइलनाम नहीं दिया गया" - -#~ msgid "Already opened." -#~ msgstr "पहले से ही खुला है." - -#~ msgid "Insufficient permissions in target directory." -#~ msgstr "लक्ष्य डिरेक्ट्री में अपर्याप्त अनुमतियाँ." - -#, fuzzy -#~| msgid "Unable to open temporary file." -#~ msgid "Unable to open temporary file. Error was: %1." -#~ msgstr "अस्थायी फ़ाइल खोलने में अक्षम." - -#~ msgid "Synchronization to disk failed" -#~ msgstr "डिस्क पर सिंक्रोनाइज़ेशन असफल" - -#~ msgid "Error during rename." -#~ msgstr "नाम बदलने के दौरान त्रुटि हुई." - -#~ msgid "kde4-config" -#~ msgstr "केडीई4-कॉन्फ़िग" - -#~ msgid "A little program to output installation paths" -#~ msgstr "संस्थापना पथ आउटपुट के लिए छोटा सा प्रोग्राम" - -#~ msgid "(C) 2000 Stephan Kulow" -#~ msgstr "(c) 2000 स्टीफन कुलोव" - -#~ msgid "Left for legacy support" -#~ msgstr "लीजेसी समर्थन के लिए छोड़ा गया" - -#~ msgid "Compiled in prefix for KDE libraries" -#~ msgstr "केडीई लाइब्रेरी के लिए प्रीफ़िक्स में कम्पाइल किया गया" - -#~ msgid "Compiled in exec_prefix for KDE libraries" -#~ msgstr "केडीई लाइब्रेरी के लिए ईएक्सईसी_प्रीफ़िक्स में कम्पाइल किया गया" - -#~ msgid "Compiled in library path suffix" -#~ msgstr "लाइब्रेरी पथ सफ़िक्स में कम्पाइल किया गया" - -#~ msgid "Prefix in $HOME used to write files" -#~ msgstr "$HOME में प्रीफ़िक्स जो फ़ाइलें लिखने हेतु इस्तेमाल में लिया जाता है" - -#~ msgid "Compiled in version string for KDE libraries" -#~ msgstr "केडीई लाइब्रेरी के लिए वर्सन स्ट्रिंग में कम्पाइल किया गया" - -#~ msgid "Available KDE resource types" -#~ msgstr "उपलब्ध केडीई रिसोर्स क़िस्म" - -#~ msgid "Search path for resource type" -#~ msgstr "रिसोर्स किस्म के लिए ढूंढने का पथ" - -#~ msgid "Find filename inside the resource type given to --path" -#~ msgstr "--path रिसोर्स टाइप में अंदर दिए गए फ़ाइलनाम को ढूंढें" - -#~ msgid "User path: desktop|autostart|document" -#~ msgstr "उपयोक्ता पथ: desktop|autostart|document" - -#~ msgid "Prefix to install resource files to" -#~ msgstr "रिसोर्स फ़ाइलें संस्थापित करने के लिए प्रीफ़िक्स" - -#~ msgid "Installation prefix for Qt" -#~ msgstr "क्यूटी के लिए संस्थापना प्रीफ़िक्स" - -#~ msgid "Location of installed Qt binaries" -#~ msgstr "संस्थापित क्यूटी बाइनरीज़ के स्थान" - -#~ msgid "Location of installed Qt libraries" -#~ msgstr "संस्थापित क्यूटी लाइब्रेरीज़ के स्थान" - -#~ msgid "Location of installed Qt plugins" -#~ msgstr "संस्थापित क्यूटी प्लगइन्स के स्थान" - -#~ msgid "Applications menu (.desktop files)" -#~ msgstr "अनुप्रयोग मेन्यू (.डेस्कटॉप फ़ाइलें)" - -#~ msgid "Autostart directories" -#~ msgstr "स्वतःप्रारंभ डिरेक्ट्री" - -#~ msgid "CGIs to run from kdehelp" -#~ msgstr "केडीईहेल्प से चलाने हेतु सीजीआई" - -#~ msgid "Configuration files" -#~ msgstr "कॉन्फ़िगरेशन फ़ाइलें" - -#~ msgid "Where applications store data" -#~ msgstr "अनुप्रयोग जहाँ डाटा भंडारित करते हैं" - -#~ msgid "Emoticons" -#~ msgstr "इमोटिकॉन्स" - -#~ msgid "Executables in $prefix/bin" -#~ msgstr " $prefix/bin में चलाने योग्य वस्तुएँ" - -#~ msgid "HTML documentation" -#~ msgstr "एचटीएमएल दस्तावेज़" - -#~ msgid "Icons" -#~ msgstr "प्रतीक" - -#~ msgid "Configuration description files" -#~ msgstr "वर्णन फ़ाइलों का कॉन्फ़िगरेशन" - -#~ msgid "Libraries" -#~ msgstr "लाइब्रेरीज़" - -#~ msgid "Includes/Headers" -#~ msgstr "इनक्लूड्स/हेडर्स" - -#~ msgid "Translation files for KLocale" -#~ msgstr "केलोकेल के लिए अनुवाद फ़ाइलें" - -#~ msgid "Mime types" -#~ msgstr "माइम क़िस्म" - -#~ msgid "Loadable modules" -#~ msgstr "लोड किए जा सकने वाले मॉड्यूल्स" - -#~ msgid "Legacy pixmaps" -#~ msgstr "लीजेसी पिक्समेप्स" - -#~ msgid "Qt plugins" -#~ msgstr "क्यूटी प्लगइन्स" - -#~ msgid "Services" -#~ msgstr "सेवाएँ" - -#~ msgid "Service types" -#~ msgstr "सेवा क़िस्म" - -#~ msgid "Application sounds" -#~ msgstr "अनुप्रयोग ध्वनियाँ" - -#~ msgid "Templates" -#~ msgstr "प्रारूप" - -#~ msgid "Wallpapers" -#~ msgstr "वालपेपर्स" - -#~ msgid "XDG Application menu (.desktop files)" -#~ msgstr "एक्सडीजी अनुप्रयोग मेन्यू (.desktop फ़ाइलें)" - -#~ msgid "XDG Menu descriptions (.directory files)" -#~ msgstr "एक्सडीजी मेन्यू वर्णन (.directory फ़ाइलें)" - -#~ msgid "XDG Icons" -#~ msgstr "एक्सडीजी प्रतीक" - -#~ msgid "XDG Mime Types" -#~ msgstr "एक्सडीजी माइम क़िस्में" - -#~ msgid "XDG Menu layout (.menu files)" -#~ msgstr "एक्सडीजी मेन्यू खाका (.menu फ़ाइलें)" - -#~ msgid "XDG autostart directory" -#~ msgstr "XDG स्वतःप्रारंभ डिरेक्ट्री" - -#~ msgid "Temporary files (specific for both current host and current user)" -#~ msgstr "अस्थाई फ़ाइलें (वर्तमान होस्ट तथा वर्तमान उपयोक्ता दोनों के लिए विशिष्ट)" - -#~ msgid "UNIX Sockets (specific for both current host and current user)" -#~ msgstr "यूनिक्स सॉकेट (वर्तमान होस्ट तथा वर्तमान उपयोक्ता के लिए विशिष्ट)" - -#~ msgid "%1 - unknown type\n" -#~ msgstr "%1 - अज्ञात किस्म\n" - -#~ msgid "%1 - unknown type of userpath\n" -#~ msgstr "%1 - उपयोक्ता पथ का अज्ञात किस्म\n" - -#~ msgid "" -#~ "No licensing terms for this program have been specified.\n" -#~ "Please check the documentation or the source for any\n" -#~ "licensing terms.\n" -#~ msgstr "" -#~ "इस प्रोग्राम के लिए कोई लाइसेंसिंग शर्तें उल्लेखित नहीं हैं.\n" -#~ "कृपया लाइसेंसिंग शर्तों के लिए\n" -#~ "दस्तावेज़ या स्रोत देखें.\n" - -#~ msgid "This program is distributed under the terms of the %1." -#~ msgstr "यह प्रोग्राम %1 शर्तों के अधीन वितरित किया गया है." - -#~ msgctxt "@item license (short name)" -#~ msgid "GPL v2" -#~ msgstr "जीपीएल सं.२" - -#~ msgctxt "@item license" -#~ msgid "GNU General Public License Version 2" -#~ msgstr "जीएनयू जनरल पब्लिक लाइसेंस संस्करण २" - -#~ msgctxt "@item license (short name)" -#~ msgid "LGPL v2" -#~ msgstr "एलजीपीएल सं.२" - -#~ msgctxt "@item license" -#~ msgid "GNU Lesser General Public License Version 2" -#~ msgstr "जीएनयू लेसर जनरल पब्लिक लाइसेंस संस्करण २" - -#~ msgctxt "@item license (short name)" -#~ msgid "BSD License" -#~ msgstr "बीएसडी लाइसेंस" - -#~ msgctxt "@item license" -#~ msgid "BSD License" -#~ msgstr "बीएसडी लाइसेंस" - -#~ msgctxt "@item license (short name)" -#~ msgid "Artistic License" -#~ msgstr "आर्टिस्टिक लाइसेंस" - -#~ msgctxt "@item license" -#~ msgid "Artistic License" -#~ msgstr "आर्टिस्टिक लाइसेंस" - -#~ msgctxt "@item license (short name)" -#~ msgid "QPL v1.0" -#~ msgstr "क्यूपीएल सं.1.0" - -#~ msgctxt "@item license" -#~ msgid "Q Public License" -#~ msgstr "क्यू पब्लिक लाइसेंस" - -#~ msgctxt "@item license (short name)" -#~ msgid "GPL v3" -#~ msgstr "जीपीएल सं.३" - -#~ msgctxt "@item license" -#~ msgid "GNU General Public License Version 3" -#~ msgstr "जीएनयू जनरल पब्लिक लाइसेंस संस्करण ३" - -#~ msgctxt "@item license (short name)" -#~ msgid "LGPL v3" -#~ msgstr "एलजीपीएल सं.३" - -#~ msgctxt "@item license" -#~ msgid "GNU Lesser General Public License Version 3" -#~ msgstr "जीएनयू जनरल पब्लिक लाइसेंस संस्करण ३" - -#~ msgctxt "@item license" -#~ msgid "Custom" -#~ msgstr "मनपसंद" - -#~ msgctxt "@item license" -#~ msgid "Not specified" -#~ msgstr "उल्लेखित नहीं" - -#~ msgctxt "replace this with information about your translation team" -#~ msgid "" -#~ "<p>KDE is translated into many languages thanks to the work of the " -#~ "translation teams all over the world.</p><p>For more information on KDE " -#~ "internationalization visit <a href=\"http://l10n.kde.org\">http://l10n." -#~ "kde.org</a></p>" -#~ msgstr "" -#~ "<p>केडीई बहुत सी भाषाओं में अनूदित है. इस के लिए विश्व भर के अनुवादकों की टोलियों को " -#~ "हार्दिक धन्यवाद.</p><p>केडीई के अंतर्राष्ट्रीयकरण के बारे में और अधिक जानकारी के लिए " -#~ "यहाँ जाएँ: <a href=\"http://l10n.kde.org\">http://l10n.kde.org</a></p>" - -#~ msgid "Use the X-server display 'displayname'" -#~ msgstr "एक्स-सर्वर डिस्पले 'displayname' इस्तेमाल करें. " - -#~ msgid "Use the QWS display 'displayname'" -#~ msgstr "क्यूडब्ल्यूएस डिस्पले 'displayname' इस्तेमाल करें. " - -#~ msgid "Restore the application for the given 'sessionId'" -#~ msgstr "अनुप्रयोग को दिए 'sessionId' गए से पुनर्स्थापित करें." - -#~ msgid "" -#~ "Causes the application to install a private color\n" -#~ "map on an 8-bit display" -#~ msgstr "" -#~ "अनुप्रयोग को बाधित करता है कि वह मैप पर निजी रंग\n" -#~ "8-बिट डिस्प्ले पर संस्थापित करे." - -#~ msgid "tells Qt to never grab the mouse or the keyboard" -#~ msgstr "क्यूटी को बताता है कि माउस या कीबोर्ड को कभी नहीं पकड़े." - -#~ msgid "switches to synchronous mode for debugging" -#~ msgstr "डिबगिंग के लिए सिंक्रोनस मोड में बदलता है." - -#~ msgid "defines the application font" -#~ msgstr "अनुप्रयोग फ़ॉन्ट पारिभाषित करता है" - -#~ msgid "" -#~ "sets the default background color and an\n" -#~ "application palette (light and dark shades are\n" -#~ "calculated)" -#~ msgstr "" -#~ "डिफ़ॉल्ट पृष्ठभूमि रंग नियत करता है. तथा एक\n" -#~ "अनुप्रयोग पैलेट (हल्के और गहरे शेड्स का\n" -#~ "गणन किया जाता है)" - -#~ msgid "sets the default foreground color" -#~ msgstr "डिफ़ॉल्ट अग्रभूमि रंग सेट करता है" - -#~ msgid "sets the default button color" -#~ msgstr "डिफ़ॉल्ट बटन रंग सेट करता है" - -#~ msgid "sets the application name" -#~ msgstr "अनुप्रयोग नाम सेट करता है" - -#~ msgid "sets the application title (caption)" -#~ msgstr "अनुप्रयोग शीर्षक सेट करता है (कैप्शन)" - -#~ msgid "" -#~ "forces the application to use a TrueColor visual on\n" -#~ "an 8-bit display" -#~ msgstr "" -#~ "अनुप्रयोग को बाधित करता है कि वह ट्रू-कलर विजुअल\n" -#~ "8-बिट डिस्प्ले पर उपयोग करे." - -#~ msgid "set XIM server" -#~ msgstr "एक्सआईएम सर्वर सेट करें" - -#~ msgid "disable XIM" -#~ msgstr "एक्सआईएम अक्षम करें" - -#~ msgid "forces the application to run as QWS Server" -#~ msgstr "अनुप्रयोग को बाधित करता है कि वह क्यूडबल्यूएस सर्वर की तरह चले" - -#~ msgid "mirrors the whole layout of widgets" -#~ msgstr "विजेट के संपूर्ण ख़ाका की नक़ल बनाए" - -#~ msgid "applies the Qt stylesheet to the application widgets" -#~ msgstr "अनुप्रयोग विजेटों में क्यूटी स्टाइलशीट लागू करता है" - -#~ msgid "Use 'caption' as name in the titlebar" -#~ msgstr "शीर्षक पट्टी में 'कैप्शन' नाम की तरह इस्तेमाल करें" - -#~ msgid "Use 'icon' as the application icon" -#~ msgstr "प्रतीक को अनुप्रयोग 'प्रतीक' की तरह इस्तेमाल करें" - -#~ msgid "Use alternative configuration file" -#~ msgstr "वैकल्पिक कॉन्फ़िगरेशन फ़ाइल इस्तेमाल करें" - -#~ msgid "Disable crash handler, to get core dumps" -#~ msgstr "कोर डम्प पाने के लिए क्रेश हैंडलर अक्षम करें." - -#~ msgid "Waits for a WM_NET compatible windowmanager" -#~ msgstr "एक WM_NET कम्पेटिबल विंडो-प्रबंधक के लिए प्रतीक्षा रत" - -#~ msgid "sets the application GUI style" -#~ msgstr "अनुप्रयोग जीयूआई शैली सेट करता है" - -#~ msgid "KDE Application" -#~ msgstr "केडीई अनुप्रयोग" - -#~ msgid "Qt" -#~ msgstr "क्यूटी" - -#~ msgid "KDE" -#~ msgstr "केडीई" - -#~ msgid "Unknown option '%1'." -#~ msgstr "अज्ञात विकल्प '%1'." - -#~ msgctxt "@info:shell %1 is cmdoption name" -#~ msgid "'%1' missing." -#~ msgstr "'%1' खो गया है." - -#~ msgctxt "" -#~ "@info:shell message on appcmd --version; do not translate 'Development " -#~ "Platform'%3 application name, other %n version strings" -#~ msgid "" -#~ "Qt: %1\n" -#~ "KDE Development Platform: %2\n" -#~ "%3: %4\n" -#~ msgstr "" -#~ "Qt: %1\n" -#~ "KDE विकास मंच: %2\n" -#~ "%3: %4\n" - -#~ msgctxt "the 2nd argument is a list of name+address, one on each line" -#~ msgid "" -#~ "%1 was written by\n" -#~ "%2" -#~ msgstr "" -#~ "%1 को \n" -#~ "%2 के द्वारा लिखा गया" - -#~ msgid "" -#~ "This application was written by somebody who wants to remain anonymous." -#~ msgstr "" -#~ "इस अनुप्रयोग को किसी ऐसे व्यक्ति द्वारा लिखा गया है जो बेनाम बने रहना चाहते हैं." - -#~ msgid "Please use http://bugs.kde.org to report bugs.\n" -#~ msgstr "कृपया http://bugs.kde.org का उपयोग बग रिपोर्ट के लिए करें.\n" - -#~ msgid "Please report bugs to %1.\n" -#~ msgstr "कृपया बग रपट %1 को भेजें.\n" - -#~ msgid "Unexpected argument '%1'." -#~ msgstr "अप्रत्याशित आर्गुमेंट %1'." - -#~ msgid "Use --help to get a list of available command line options." -#~ msgstr " --help का उपयोग उपलब्ध कमांड लाइन विकल्पों की सूची पाने के लिए करें." - -#~ msgid "[options] " -#~ msgstr "[विकल्प]" - -#~ msgid "[%1-options]" -#~ msgstr "[%1-विकल्प]" - -#~ msgid "Usage: %1 %2\n" -#~ msgstr "उपयोगिता: %1 %2\n" - -#~ msgid "" -#~ "\n" -#~ "Generic options:\n" -#~ msgstr "" -#~ "\n" -#~ "जेनेरिक विकल्प:\n" - -#~ msgid "Show help about options" -#~ msgstr "विकल्पों के बारे में मदद बताएँ" - -#~ msgid "Show %1 specific options" -#~ msgstr "विशेष %1 विकल्प दिखाएँ" - -#~ msgid "Show all options" -#~ msgstr "सभी विकल्प दिखाएँ" - -#~ msgid "Show author information" -#~ msgstr "लेखक की जानकारी दिखाएँ" - -#~ msgid "Show version information" -#~ msgstr "वर्जन की जानकारी दिखाएँ" - -#~ msgid "Show license information" -#~ msgstr "लाइसेंस की जानकारी दिखाएँ" - -#~ msgid "End of options" -#~ msgstr "विकल्प ख़त्म" - -#~ msgid "" -#~ "\n" -#~ "%1 options:\n" -#~ msgstr "" -#~ "\n" -#~ "%1 विकल्प:\n" - -#~ msgid "" -#~ "\n" -#~ "Options:\n" -#~ msgstr "" -#~ "\n" -#~ "विकल्प:\n" - -#~ msgid "" -#~ "\n" -#~ "Arguments:\n" -#~ msgstr "" -#~ "\n" -#~ "आर्गुमेंट:\n" - -#~ msgid "The files/URLs opened by the application will be deleted after use" -#~ msgstr "" -#~ "जो फ़ाइलें/यूआरएल अनुप्रयोग द्वारा खोले गए हैं उन्हें इस्तेमाल के पश्चात मिटा दिया जाएगा" - -#~ msgid "KDE-tempfile" -#~ msgstr "केडीई-टेम्पफ़ाइल" - -#~ msgid "Function must be called from the main thread." -#~ msgstr "फंक्शन को मुख्य थ्रेड से काल किया जाना चाहिए." - -#~ msgid "" -#~ "KLauncher could not be reached via D-Bus. Error when calling %1:\n" -#~ "%2\n" -#~ msgstr "" -#~ "के लांचर डी_बस के जरिए पहुँच नहीं पाया. %1 को काल करने के दौरान त्रुटि:\n" -#~ "%2\n" - -#~ msgid "" -#~ "Could not launch the KDE Help Center:\n" -#~ "\n" -#~ "%1" -#~ msgstr "" -#~ "केडीई मदद केंद्र चालू नहीं कर सका:\n" -#~ "\n" -#~ "%1" - -#~ msgid "Could not Launch Help Center" -#~ msgstr "मदद केंद्र चालू नहीं कर सका" - -#~ msgid "" -#~ "Could not launch the mail client:\n" -#~ "\n" -#~ "%1" -#~ msgstr "" -#~ "मेल क्लाएंट को लोड नही कर सका:\n" -#~ "\n" -#~ "%1" - -#~ msgid "Could not launch Mail Client" -#~ msgstr "मेल क्लाएंट को लोड नही कर सका" - -#~ msgid "" -#~ "Could not launch the browser:\n" -#~ "\n" -#~ "%1" -#~ msgstr "" -#~ "ब्राउज़र को लोड नही कर सका:\n" -#~ "\n" -#~ "%1" - -#~ msgid "Could not launch Browser" -#~ msgstr "ब्राउज़र को चालू नहीं कर सके" - -#~ msgid "" -#~ "Could not launch the terminal client:\n" -#~ "\n" -#~ "%1" -#~ msgstr "" -#~ "टर्मिनल क्लाएंट को लोड नही कर सका:\n" -#~ "\n" -#~ "%1" - -#~ msgid "Could not launch Terminal Client" -#~ msgstr "टर्मिनल क्लाएंट को चालू नहीं कर सका" - -#~ msgctxt "@item Text character set" -#~ msgid "Western European" -#~ msgstr "पश्चिमी यूरोपीय" - -#~ msgctxt "@item Text character set" -#~ msgid "Central European" -#~ msgstr "मध्य यूरोपीय" - -#~ msgctxt "@item Text character set" -#~ msgid "Baltic" -#~ msgstr "बाल्टिक" - -#~ msgctxt "@item Text character set" -#~ msgid "South-Eastern Europe" -#~ msgstr "दक्षिण-पूर्वी यूरोप" - -#~ msgctxt "@item Text character set" -#~ msgid "Turkish" -#~ msgstr "तुर्की" - -#~ msgctxt "@item Text character set" -#~ msgid "Cyrillic" -#~ msgstr "साइरिलिक" - -#~ msgctxt "@item Text character set" -#~ msgid "Chinese Traditional" -#~ msgstr "चीनी (परम्परिक)" - -#~ msgctxt "@item Text character set" -#~ msgid "Chinese Simplified" -#~ msgstr "चीनी (सरल)" - -#~ msgctxt "@item Text character set" -#~ msgid "Korean" -#~ msgstr "कोरियाई" - -#~ msgctxt "@item Text character set" -#~ msgid "Japanese" -#~ msgstr "जापानी" - -#~ msgctxt "@item Text character set" -#~ msgid "Greek" -#~ msgstr "यूनानी" - -#~ msgctxt "@item Text character set" -#~ msgid "Arabic" -#~ msgstr "अरबी" - -#~ msgctxt "@item Text character set" -#~ msgid "Hebrew" -#~ msgstr "हिब्रू" - -#~ msgctxt "@item Text character set" -#~ msgid "Thai" -#~ msgstr "थाई" - -#~ msgctxt "@item Text character set" -#~ msgid "Unicode" -#~ msgstr "युनिकोड" - -#~ msgctxt "@item Text character set" -#~ msgid "Northern Saami" -#~ msgstr "उत्तरी सामी" - -#~ msgctxt "@item Text character set" -#~ msgid "Other" -#~ msgstr "अन्य" - -#~ msgctxt "@item %1 character set, %2 encoding" -#~ msgid "%1 ( %2 )" -#~ msgstr "%1 ( %2 )" - -#~ msgctxt "@item" -#~ msgid "Other encoding (%1)" -#~ msgstr "अन्य एनकोडिंग (%1)" - -#~ msgctxt "@item Text encoding: %1 character set, %2 encoding" -#~ msgid "%1 ( %2 )" -#~ msgstr "%1 ( %2 )" - -#~ msgctxt "@item Text character set" -#~ msgid "Disabled" -#~ msgstr "अक्षम करें" - -#~ msgctxt "@item Text character set" -#~ msgid "Universal" -#~ msgstr "सर्वव्यापी" - -#~ msgctxt "digit set" -#~ msgid "Arabic-Indic" -#~ msgstr "अरबी-हिन्द" - -#~ msgctxt "digit set" -#~ msgid "Bengali" -#~ msgstr "बंगाली" - -#~ msgctxt "digit set" -#~ msgid "Devanagari" -#~ msgstr "देवनागरी" - -#~ msgctxt "digit set" -#~ msgid "Eastern Arabic-Indic" -#~ msgstr "पुर्वी अरबी-हिन्द" - -#~ msgctxt "digit set" -#~ msgid "Gujarati" -#~ msgstr "गुजराती" - -#~ msgctxt "digit set" -#~ msgid "Gurmukhi" -#~ msgstr "गुरूमुखी" - -#~ msgctxt "digit set" -#~ msgid "Kannada" -#~ msgstr "कन्नड" - -#~ msgctxt "digit set" -#~ msgid "Khmer" -#~ msgstr "ख्मेर" - -#~ msgctxt "digit set" -#~ msgid "Malayalam" -#~ msgstr "मलयालम" - -#~ msgctxt "digit set" -#~ msgid "Oriya" -#~ msgstr "उड़िया" - -#~ msgctxt "digit set" -#~ msgid "Tamil" -#~ msgstr "तमिल" - -#~ msgctxt "digit set" -#~ msgid "Telugu" -#~ msgstr "तेलुगु" - -#~ msgctxt "digit set" -#~ msgid "Thai" -#~ msgstr "थाई" - -#~ msgctxt "digit set" -#~ msgid "Arabic" -#~ msgstr "अरबी" - -#~ msgctxt "size in bytes" -#~ msgid "%1 B" -#~ msgstr "%1 बा." - -#~ msgctxt "size in 1000 bytes" -#~ msgid "%1 kB" -#~ msgstr "%1 कि.बा." - -#~ msgctxt "size in 10^6 bytes" -#~ msgid "%1 MB" -#~ msgstr "%1 मे.बा." - -#~ msgctxt "size in 10^9 bytes" -#~ msgid "%1 GB" -#~ msgstr "%1 गी.बा." - -#~ msgctxt "size in 10^12 bytes" -#~ msgid "%1 TB" -#~ msgstr "%1 टे.बा." - -#~ msgctxt "size in 10^15 bytes" -#~ msgid "%1 PB" -#~ msgstr "%1 पे.बा." - -#~ msgctxt "size in 10^18 bytes" -#~ msgid "%1 EB" -#~ msgstr "%1 इ.बा." - -#~ msgctxt "size in 10^21 bytes" -#~ msgid "%1 ZB" -#~ msgstr "%1 जी.बा." - -#~ msgctxt "size in 10^24 bytes" -#~ msgid "%1 YB" -#~ msgstr "%1 य.बा." - -#~ msgctxt "memory size in 1024 bytes" -#~ msgid "%1 KB" -#~ msgstr "%1 कि.बा." - -#~ msgctxt "memory size in 2^20 bytes" -#~ msgid "%1 MB" -#~ msgstr "%1 मे.बा." - -#~ msgctxt "memory size in 2^30 bytes" -#~ msgid "%1 GB" -#~ msgstr "%1 गी.बा." - -#~ msgctxt "memory size in 2^40 bytes" -#~ msgid "%1 TB" -#~ msgstr "%1 टे.बा." - -#~ msgctxt "memory size in 2^50 bytes" -#~ msgid "%1 PB" -#~ msgstr "%1 पे.बा." - -#~ msgctxt "memory size in 2^60 bytes" -#~ msgid "%1 EB" -#~ msgstr "%1 इ.बा." - -#~ msgctxt "memory size in 2^70 bytes" -#~ msgid "%1 ZB" -#~ msgstr "%1 जी.बा." - -#~ msgctxt "memory size in 2^80 bytes" -#~ msgid "%1 YB" -#~ msgstr "%1 य.बा." - -#~ msgctxt "size in 1024 bytes" -#~ msgid "%1 KiB" -#~ msgstr "%1 कि.बा." - -#~ msgctxt "size in 2^20 bytes" -#~ msgid "%1 MiB" -#~ msgstr "%1 मे.बा." - -#~ msgctxt "size in 2^30 bytes" -#~ msgid "%1 GiB" -#~ msgstr "%1 गी.बा." - -#~ msgctxt "size in 2^40 bytes" -#~ msgid "%1 TiB" -#~ msgstr "%1 टे.बा." - -#~ msgctxt "size in 2^50 bytes" -#~ msgid "%1 PiB" -#~ msgstr "%1 पे.बा." - -#~ msgctxt "size in 2^60 bytes" -#~ msgid "%1 EiB" -#~ msgstr "%1 इ.बा." - -#~ msgctxt "size in 2^70 bytes" -#~ msgid "%1 ZiB" -#~ msgstr "%1 जी.बा." - -#~ msgctxt "size in 2^80 bytes" -#~ msgid "%1 YiB" -#~ msgstr "%1 य.बा." - -#~ msgctxt "@item:intext %1 is a real number, e.g. 1.23 days" -#~ msgid "%1 days" -#~ msgstr "%1 दिन" - -#~ msgctxt "@item:intext %1 is a real number, e.g. 1.23 hours" -#~ msgid "%1 hours" -#~ msgstr "%1 घंटे" - -#~ msgctxt "@item:intext %1 is a real number, e.g. 1.23 minutes" -#~ msgid "%1 minutes" -#~ msgstr "%1 मिनट" - -#~ msgctxt "@item:intext %1 is a real number, e.g. 1.23 seconds" -#~ msgid "%1 seconds" -#~ msgstr "%1 सेकण्ड" - -#~ msgctxt "@item:intext" -#~ msgid "%1 millisecond" -#~ msgid_plural "%1 milliseconds" -#~ msgstr[0] "%1 मिली-सेकण्ड्स" -#~ msgstr[1] "%1 मिली-सेकण्ड्स" - -#~ msgctxt "@item:intext" -#~ msgid "1 day" -#~ msgid_plural "%1 days" -#~ msgstr[0] "%1 दिन" -#~ msgstr[1] "%1 दिन" - -#~ msgctxt "@item:intext" -#~ msgid "1 hour" -#~ msgid_plural "%1 hours" -#~ msgstr[0] "%1 घंटा" -#~ msgstr[1] "%1 घंटे" - -#~ msgctxt "@item:intext" -#~ msgid "1 minute" -#~ msgid_plural "%1 minutes" -#~ msgstr[0] "%1 मिनट" -#~ msgstr[1] "%1 मिनट" - -#~ msgctxt "@item:intext" -#~ msgid "1 second" -#~ msgid_plural "%1 seconds" -#~ msgstr[0] "%1 सेकण्ड" -#~ msgstr[1] "%1 सेकण्ड" - -#~ msgctxt "" -#~ "@item:intext days and hours. This uses the previous item:intext messages. " -#~ "If this does not fit the grammar of your language please contact the i18n " -#~ "team to solve the problem" -#~ msgid "%1 and %2" -#~ msgstr "%1 और %2" - -#~ msgctxt "" -#~ "@item:intext hours and minutes. This uses the previous item:intext " -#~ "messages. If this does not fit the grammar of your language please " -#~ "contact the i18n team to solve the problem" -#~ msgid "%1 and %2" -#~ msgstr "%1 और %2" - -#~ msgctxt "" -#~ "@item:intext minutes and seconds. This uses the previous item:intext " -#~ "messages. If this does not fit the grammar of your language please " -#~ "contact the i18n team to solve the problem" -#~ msgid "%1 and %2" -#~ msgstr "%1 और %2" - -#~ msgctxt "Before Noon KLocale::LongName" -#~ msgid "Ante Meridiem" -#~ msgstr "पुर्वान्ह" - -#~ msgctxt "Before Noon KLocale::ShortName" -#~ msgid "AM" -#~ msgstr "पूर्वाह्न" - -#~ msgctxt "Before Noon KLocale::NarrowName" -#~ msgid "A" -#~ msgstr "पु" - -#~ msgctxt "After Noon KLocale::LongName" -#~ msgid "Post Meridiem" -#~ msgstr "अपरान्ह" - -#~ msgctxt "After Noon KLocale::ShortName" -#~ msgid "PM" -#~ msgstr "अपराह्न" - -#~ msgctxt "After Noon KLocale::NarrowName" -#~ msgid "P" -#~ msgstr "अ" - -#~ msgid "Today" -#~ msgstr "आज" - -#~ msgid "Yesterday" -#~ msgstr "कल" - -#~ msgctxt "concatenation of dates and time" -#~ msgid "%1 %2" -#~ msgstr "%1 %2" - -#~ msgctxt "concatenation of date/time and time zone" -#~ msgid "%1 %2" -#~ msgstr "%1 %2" - -#~ msgctxt "" -#~ "@note-with-label/plain\n" -#~ "%1 is the note label, %2 is the text" -#~ msgid "%1: %2" -#~ msgstr "%1: %2" - -#~ msgctxt "" -#~ "@warning-with-label/plain\n" -#~ "%1 is the warning label, %2 is the text" -#~ msgid "%1: %2" -#~ msgstr "%1: %2" - -#~ msgctxt "" -#~ "@link-with-description/plain\n" -#~ "%1 is the URL, %2 is the descriptive text" -#~ msgid "%2 (%1)" -#~ msgstr "%2 (%1)" - -#~ msgctxt "@application/rich" -#~ msgid "%1" -#~ msgstr "%1" - -#~ msgctxt "@command/plain" -#~ msgid "%1" -#~ msgstr "%1" - -#~ msgctxt "@command/rich" -#~ msgid "<tt>%1</tt>" -#~ msgstr "<tt>%1</tt>" - -#~ msgctxt "@resource/rich" -#~ msgid "“%1”" -#~ msgstr "“%1”" - -#~ msgctxt "@icode/plain" -#~ msgid "“%1”" -#~ msgstr "“%1”" - -#~ msgctxt "@icode/rich" -#~ msgid "<tt>%1</tt>" -#~ msgstr "<tt>%1</tt>" - -#~ msgctxt "@shortcut/plain" -#~ msgid "%1" -#~ msgstr "%1" - -#~ msgctxt "@emphasis/rich" -#~ msgid "<i>%1</i>" -#~ msgstr "<i>%1</i>" - -#~ msgctxt "@emphasis-strong/rich" -#~ msgid "<b>%1</b>" -#~ msgstr "<b>%1</b>" - -#~ msgctxt "@email/plain" -#~ msgid "<%1>" -#~ msgstr "<%1>" - -#~ msgctxt "@message/rich" -#~ msgid "<i>%1</i>" -#~ msgstr "<i>%1</i>" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Alt" -#~ msgstr "ऑल्ट" - -#~ msgctxt "keyboard-key-name" -#~ msgid "AltGr" -#~ msgstr "ऑल्टजीआर" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Backspace" -#~ msgstr "बैक-स्पेस" - -#~ msgctxt "keyboard-key-name" -#~ msgid "CapsLock" -#~ msgstr "केप्स-लॉक" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Control" -#~ msgstr "कंट्रोल" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Ctrl" -#~ msgstr "कंट्रोल" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Del" -#~ msgstr "डिलीट" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Delete" -#~ msgstr "मिटाएँ" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Down" -#~ msgstr "नीचे" - -#~ msgctxt "keyboard-key-name" -#~ msgid "End" -#~ msgstr "अंत" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Enter" -#~ msgstr "प्रविष्ट करें" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Esc" -#~ msgstr "एस्केप" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Escape" -#~ msgstr "एस्केप" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Home" -#~ msgstr "घर" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Hyper" -#~ msgstr "हाइपर" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Ins" -#~ msgstr "प्रविष्ट " - -#~ msgctxt "keyboard-key-name" -#~ msgid "Insert" -#~ msgstr "प्रविष्ट" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Left" -#~ msgstr "बायाँ" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Menu" -#~ msgstr "मेन्यू" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Meta" -#~ msgstr "मेटा" - -#~ msgctxt "keyboard-key-name" -#~ msgid "NumLock" -#~ msgstr "न्यूम-लॉक" - -#~ msgctxt "keyboard-key-name" -#~ msgid "PageDown" -#~ msgstr "पेज-डाउन" - -#~ msgctxt "keyboard-key-name" -#~ msgid "PageUp" -#~ msgstr "पेज-अप" - -#~ msgctxt "keyboard-key-name" -#~ msgid "PgDown" -#~ msgstr "पृष्ठनीचे" - -#~ msgctxt "keyboard-key-name" -#~ msgid "PgUp" -#~ msgstr "पृष्ठऊपर" - -#~ msgctxt "keyboard-key-name" -#~ msgid "PauseBreak" -#~ msgstr "ठहरें" - -#~ msgctxt "keyboard-key-name" -#~ msgid "PrintScreen" -#~ msgstr "प्रिंट-स्क्रीन" - -#~ msgctxt "keyboard-key-name" -#~ msgid "PrtScr" -#~ msgstr "प्रिंटस्क्रीन" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Return" -#~ msgstr "रिटर्न" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Right" -#~ msgstr "दायाँ" - -#~ msgctxt "keyboard-key-name" -#~ msgid "ScrollLock" -#~ msgstr "स्क्रॉल-लॉक" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Shift" -#~ msgstr "शिफ्ट" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Space" -#~ msgstr "खाली जगह" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Super" -#~ msgstr "सुपर" - -#~ msgctxt "keyboard-key-name" -#~ msgid "SysReq" -#~ msgstr "सिस-रेक्" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Tab" -#~ msgstr "टैब" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Up" -#~ msgstr "ऊपर" - -#~ msgctxt "keyboard-key-name" -#~ msgid "Win" -#~ msgstr "विन" - -#~ msgctxt "keyboard-key-name" -#~ msgid "F%1" -#~ msgstr "F%1" - -#~ msgid "no error" -#~ msgstr "कोई त्रुटि नहीं" - -#~ msgid "requested family not supported for this host name" -#~ msgstr "इस होस्ट नाम के लिए निवेदित परिवार समर्थित नहीं है" - -#~ msgid "temporary failure in name resolution" -#~ msgstr "नाम रिसॉल्यूशन में अस्थायी असफलता" - -#~ msgid "non-recoverable failure in name resolution" -#~ msgstr "नाम रिसॉल्यूशन में रिकवरी अयोग्य असफलता" - -#~ msgid "invalid flags" -#~ msgstr "अवैध फ्लैग्स" - -#~ msgid "memory allocation failure" -#~ msgstr "मेमोरी एलोकेशन असफलता" - -#~ msgid "name or service not known" -#~ msgstr "नाम या सेवा ज्ञात नहीं है" - -#~ msgid "requested family not supported" -#~ msgstr "निवेदित परिवार समर्थित नहीं है" - -#~ msgid "requested service not supported for this socket type" -#~ msgstr "इस सॉकेट क़िस्म के लिए निवेदित सेवा समर्थित नहीं है" - -#~ msgid "requested socket type not supported" -#~ msgstr "निवेदित सॉकेट क़िस्म समर्थित नहीं है" - -#~ msgid "unknown error" -#~ msgstr "अज्ञात त्रुटि" - -#~ msgctxt "1: the i18n'ed system error code, from errno" -#~ msgid "system error: %1" -#~ msgstr "तंत्र त्रुटि: %1" - -#~ msgid "request was canceled" -#~ msgstr "निवेदन रद्द किया गया" - -#~ msgctxt "1: the unknown socket address family number" -#~ msgid "Unknown family %1" -#~ msgstr "अज्ञात परिवार %1" - -#~ msgctxt "Socket error code NoError" -#~ msgid "no error" -#~ msgstr "कोई त्रुटि नहीं" - -#~ msgctxt "Socket error code LookupFailure" -#~ msgid "name lookup has failed" -#~ msgstr "नाम लुकअप असफल" - -#~ msgctxt "Socket error code AddressInUse" -#~ msgid "address already in use" -#~ msgstr "पता पहले से ही उपयोग में है" - -#~ msgctxt "Socket error code AlreadyBound" -#~ msgid "socket is already bound" -#~ msgstr "सॉकेट पहले से ही बाउण्ड है" - -#~ msgctxt "Socket error code AlreadyCreated" -#~ msgid "socket is already created" -#~ msgstr "सॉकेट पहले से ही बनाया हुआ है" - -#~ msgctxt "Socket error code NotBound" -#~ msgid "socket is not bound" -#~ msgstr "सॉकेट बाउण्ड नहीं है" - -#~ msgctxt "Socket error code NotCreated" -#~ msgid "socket has not been created" -#~ msgstr "सॉकेट बनाया नहीं जा सकता" - -#~ msgctxt "Socket error code WouldBlock" -#~ msgid "operation would block" -#~ msgstr "कार्य रोक दिया जाएगा" - -#~ msgctxt "Socket error code ConnectionRefused" -#~ msgid "connection actively refused" -#~ msgstr "कनेक्शन सक्रिय रूप से अस्वीकृत" - -#~ msgctxt "Socket error code ConnectionTimedOut" -#~ msgid "connection timed out" -#~ msgstr "कनेक्शन टाइम आउट" - -#~ msgctxt "Socket error code InProgress" -#~ msgid "operation is already in progress" -#~ msgstr "प्रक्रिया पहले से ही प्रगति में है" - -#~ msgctxt "Socket error code NetFailure" -#~ msgid "network failure occurred" -#~ msgstr "नेटवर्क असफल हो गया" - -#~ msgctxt "Socket error code NotSupported" -#~ msgid "operation is not supported" -#~ msgstr "प्रक्रिया समर्थित नहीं है" - -#~ msgctxt "Socket error code Timeout" -#~ msgid "timed operation timed out" -#~ msgstr "समयबद्ध प्रक्रिया टाइम आउट हो गया" - -#~ msgctxt "Socket error code UnknownError" -#~ msgid "an unknown/unexpected error has happened" -#~ msgstr "एक अज्ञात/अप्रत्याशित त्रुटि हुई" - -#~ msgctxt "Socket error code RemotelyDisconnected" -#~ msgid "remote host closed connection" -#~ msgstr "रिमोट होस्ट द्वारा कनेक्शन बन्द किया गया" - -#~ msgid "NEC SOCKS client" -#~ msgstr "एनईसी सॉक्स क्लाएंट" - -#~ msgid "Dante SOCKS client" -#~ msgstr "दांते सॉक्स क्लाएंट" - -#~ msgid "Specified socket path is invalid" -#~ msgstr "दिया गया सॉकेट पथ अवैध है" - -#~ msgid "The socket operation is not supported" -#~ msgstr "सॉकेट प्रक्रिया समर्थित नहीं है" - -#~ msgid "Connection refused" -#~ msgstr "कनेक्शन अस्वीकृत" - -#~ msgid "Permission denied" -#~ msgstr "अनुमति रोकी" - -#~ msgid "Connection timed out" -#~ msgstr "कनेक्शन टाइम आउट" - -#~ msgid "Unknown error" -#~ msgstr "अज्ञात त्रुटि" - -#~ msgid "Address is already in use" -#~ msgstr "पता पहले से ही उपयोग में है" - -#~ msgid "Path cannot be used" -#~ msgstr "पथ का प्रयोग नहीं किया जा सकता" - -#~ msgid "No such file or directory" -#~ msgstr "ऐसा कोई फ़ाइल या निर्देशिका नहीं है" - -#~ msgid "Not a directory" -#~ msgstr "डिरेक्ट्री नहीं है" - -#~ msgid "Read-only filesystem" -#~ msgstr "सिर्फ पढने योग्य फाइलसिस्टम" - -#~ msgid "Unknown socket error" -#~ msgstr "अज्ञात सॉकेट त्रुटि" - -#~ msgid "Operation not supported" -#~ msgstr "प्रक्रिया समर्थित नहीं है" - -#~ msgid "Timed out trying to connect to remote host" -#~ msgstr "रिमोट होस्ट से कनेक्ट होने की कोशिश में टाइमआउट हो गया" - -#~ msgctxt "SSL error" -#~ msgid "No error" -#~ msgstr "कोई त्रुटि नहीं" - -#~ msgctxt "SSL error" -#~ msgid "The certificate has expired" -#~ msgstr "यह प्रमाणपत्र समाप्त हो गया है" - -#~ msgctxt "SSL error" -#~ msgid "The certificate is invalid" -#~ msgstr "यह प्रमाणपत्र अवैध है" - -#~ msgctxt "SSL error" -#~ msgid "The certificate has been revoked" -#~ msgstr "यह प्रमाणपत्र रद्द किया गया है" - -#~ msgctxt "SSL error" -#~ msgid "The certificate is unsuitable for this purpose" -#~ msgstr "यह प्रमाणपत्र इस प्रयोजन के लिए अनुपयुक्त है" - -#~ msgctxt "SSL error" -#~ msgid "The certificate chain is too long" -#~ msgstr "प्रमाणपत्र कडी बहुत लंबी है" - -#~ msgctxt "SSL error" -#~ msgid "Unknown error" -#~ msgstr "अज्ञात त्रुटि" - -#~ msgid "address family for nodename not supported" -#~ msgstr "नोड नाम के लिए एड्रेस फैमिली समर्थित नहीं है" - -#~ msgid "invalid value for 'ai_flags'" -#~ msgstr " 'ai_flags' के लिए अवैध मान" - -#~ msgid "'ai_family' not supported" -#~ msgstr "'ai_family' समर्थित नहीं है" - -#~ msgid "no address associated with nodename" -#~ msgstr "नोड नाम के साथ कोई पता संबद्ध नहीं है" - -#~ msgid "servname not supported for ai_socktype" -#~ msgstr "ai_socktype के लिए सर्वनेम समर्थित नहीं है" - -#~ msgid "'ai_socktype' not supported" -#~ msgstr "'ai_socktype' समर्थित नहीं है" - -#~ msgid "system error" -#~ msgstr "तंत्र त्रुटि" - -#~ msgid "Could not find mime type <resource>%2</resource>" -#~ msgid_plural "" -#~ "Could not find mime types:\n" -#~ "<resource>%2</resource>" -#~ msgstr[0] "माइम क़िस्म <resource>%2</resource> नहीं मिला" -#~ msgstr[1] "माइम क़िस्में <resource>%2</resource> नहीं मिलीं" - -#~ msgid "No service matching the requirements was found" -#~ msgstr "आवश्यकता से मेल खाती कोई सेवा नहीं मिली" - -#~ msgid "" -#~ "The service '%1' does not provide an interface '%2' with keyword '%3'" -#~ msgstr "सेवा '%1' इंटरफ़ेस '%2' कुंजीशब्द '%3' के साथ प्रदाय नहीं करता है" - -#~ msgctxt "dictionary variant" -#~ msgid "40" -#~ msgstr "40" - -#~ msgctxt "dictionary variant" -#~ msgid "60" -#~ msgstr "60" - -#~ msgctxt "dictionary variant" -#~ msgid "80" -#~ msgstr "80" - -#~ msgctxt "dictionary variant" -#~ msgid "-ise suffixes" -#~ msgstr "-ise सफ़िक्सेस" - -#~ msgctxt "dictionary variant" -#~ msgid "-ize suffixes" -#~ msgstr "-ize सफ़िक्सेस" - -#~ msgctxt "dictionary variant" -#~ msgid "-ise suffixes and with accents" -#~ msgstr "-ise एसेंट के साथ सफ़िक्सेस" - -#~ msgctxt "dictionary variant" -#~ msgid "-ise suffixes and without accents" -#~ msgstr "-ise एसेंट के बगैर सफ़िक्सेस" - -#~ msgctxt "dictionary variant" -#~ msgid "-ize suffixes and with accents" -#~ msgstr "-ize एसेंट के साथ सफ़िक्सेस" - -#~ msgctxt "dictionary variant" -#~ msgid "-ize suffixes and without accents" -#~ msgstr "-ize एसेंट के बगैर सफ़िक्सेस" - -#~ msgctxt "dictionary variant" -#~ msgid "large" -#~ msgstr "बड़ा" - -#~ msgctxt "dictionary variant" -#~ msgid "medium" -#~ msgstr "मध्यम" - -#~ msgctxt "dictionary variant" -#~ msgid "small" -#~ msgstr "छोटा" - -#~ msgctxt "dictionary variant" -#~ msgid "variant 0" -#~ msgstr "वेरिएंट 0" - -#~ msgctxt "dictionary variant" -#~ msgid "variant 1" -#~ msgstr "वेरिएंट 1" - -#~ msgctxt "dictionary variant" -#~ msgid "variant 2" -#~ msgstr "वेरिएंट 2" - -#~ msgctxt "dictionary variant" -#~ msgid "without accents" -#~ msgstr "उच्चारणों के बगैर" - -#~ msgctxt "dictionary variant" -#~ msgid "with accents" -#~ msgstr "उच्चारणों के साथ" - -#~ msgctxt "dictionary variant" -#~ msgid "with ye" -#~ msgstr "ये के साथ " - -#~ msgctxt "dictionary variant" -#~ msgid "with yeyo" -#~ msgstr "येयो के साथ" - -#~ msgctxt "dictionary variant" -#~ msgid "with yo" -#~ msgstr "यो के साथ" - -#~ msgctxt "dictionary variant" -#~ msgid "extended" -#~ msgstr "विस्तारित" - -#~ msgctxt "dictionary name. %1-language, %2-country and %3 variant name" -#~ msgid "%1 (%2) [%3]" -#~ msgstr "%1 (%2) [%3]" - -#~ msgctxt "dictionary name. %1-language and %2-country name" -#~ msgid "%1 (%2)" -#~ msgstr "%1 (%2)" - -#~ msgctxt "dictionary name. %1-language and %2-variant name" -#~ msgid "%1 [%2]" -#~ msgstr "%1 [%2]" - -#~ msgid "File %1 does not exist" -#~ msgstr "फ़ाइल %1 मौज़ूद नहीं है" - -#~ msgid "Cannot open %1 for reading" -#~ msgstr "पढ़ने के लिए %1 खोल नहीं सकता " - -#~ msgid "Cannot create memory segment for file %1" -#~ msgstr "फ़ाइल %1 के लिए मेमोरी सेगमेंट नहीं बना पाया" - -#~ msgid "Could not read data from %1 into shm" -#~ msgstr "%1 से shm में डाटा पढ़ नहीं पाया" - -#~ msgid "Only 'ReadOnly' allowed" -#~ msgstr "सिर्फ 'सिर्फ पढ़ने लायक' स्वीकार्य" - -#~ msgid "Cannot seek past eof" -#~ msgstr "पिछला eof देख नहीं सकता" - -#~ msgid "Library \"%1\" not found" -#~ msgstr "लाइब्रेरी \"%1\".नहीं मिली" - -#~ msgid "No service matching the requirements was found." -#~ msgstr "आवश्यकता से मेल खाती कोई सेवा नहीं मिली." - -#~ msgid "" -#~ "The service provides no library, the Library key is missing in the ." -#~ "desktop file." -#~ msgstr "सेवा में कोई लाइब्रेरी नहीं है, .desktop फ़ाइल में लाइब्रेरी कुंजी नहीं है" - -#~ msgid "The library does not export a factory for creating components." -#~ msgstr "अवयव बनाने के लिए लाइब्रेरी फैक्टरी निर्यात नहीं करता." - -#~ msgid "" -#~ "The factory does not support creating components of the specified type." -#~ msgstr "निर्धारित किस्म के अवयव बनाने के लिए फैक्टरी समर्थन नहीं करता." - -#~ msgid "KLibLoader: Unknown error" -#~ msgstr "केलिबलोडर: अज्ञात त्रुटि" - -#~ msgid "Could not find plugin '%1' for application '%2'" -#~ msgstr "अनुप्रयोग '%2' के लिए प्लगिन '%1' नहीं मिला" - -#~ msgid "The provided service is not valid" -#~ msgstr "प्रदान की गई सेवा मान्य नहीं है" - -#~ msgid "The service '%1' provides no library or the Library key is missing" -#~ msgstr "सेवा '%1' कोई लाइब्रेरी नहीं देता या लाइब्रेरी कुंजी मोजूद नहीं है" - -#~ msgid "The library %1 does not offer a KDE 4 compatible factory." -#~ msgstr "लाइब्रेरी %1 केडीई ४ योग्य फ़ैक्टरी प्रदान नहीं करता." - -#~ msgid "The plugin '%1' uses an incompatible KDE library (%2)." -#~ msgstr "प्लगइन '%1' इस्तेमाल करता है अयोग्य केडीई लाइब्रेरी. (%2)" - -#~ msgid "KDE Test Program" -#~ msgstr "केडीई टेस्ट प्रोग्राम" - -#~ msgid "KBuildSycoca" -#~ msgstr "के-बिल्ड-सायकोका" - -#~ msgid "Rebuilds the system configuration cache." -#~ msgstr "तंत्र कॉन्फ़िगरेशन कैश फिर निर्मित करें" - -#~ msgid "(c) 1999-2002 KDE Developers" -#~ msgstr "(c) 1998-2002 केडीई डेवलपर्स" - -#~ msgid "David Faure" -#~ msgstr "डेविड फ़ॉउर" - -#~ msgid "Do not signal applications to update" -#~ msgstr "अनुप्रयोगों को अद्यतन के लिए संकेत न दें" - -#~ msgid "Disable incremental update, re-read everything" -#~ msgstr "इंक्रीमेंटल अपडेट अक्षम करें, सभी फिर से पढ़ें" - -#~ msgid "Check file timestamps" -#~ msgstr "फ़ाइल टाइमस्टैम्प्स जाँचें" - -#~ msgid "Disable checking files (dangerous)" -#~ msgstr "फ़ाइल जाँच अक्षम करें (खतरनाक)" - -#~ msgid "Create global database" -#~ msgstr "वैश्विक डाटाबेस बनाएँ" - -#~ msgid "Perform menu generation test run only" -#~ msgstr "सिर्फ मेन्यू जनरेशन टेस्ट रन पूरा करें" - -#~ msgid "Track menu id for debug purposes" -#~ msgstr "डिबग प्रक्रिया के लिए मेन्यू आईडी ट्रैक करें" - -#~ msgid "KDE Daemon" -#~ msgstr "केडीई ङेमन" - -#~ msgid "KDE Daemon - triggers Sycoca database updates when needed" -#~ msgstr "केडीई डेमन - जब आवश्यक हो, सिकोका डाटाबेस अद्यतन ट्रिगर करता है." - -#~ msgid "Check Sycoca database only once" -#~ msgstr "सिकोका डाटाबेस एक बार ही जाँचें" - -#~ msgctxt "Encodings menu" -#~ msgid "Default" -#~ msgstr "डिफ़ॉल्ट" - -#~ msgctxt "Encodings menu" -#~ msgid "Autodetect" -#~ msgstr "अपने आप पता लगाएँ" - -#~ msgid "No Entries" -#~ msgstr "कोई प्रविष्टि नहीं" - -#~ msgid "Clear List" -#~ msgstr "सूची साफ करें" - -#~ msgctxt "go back" -#~ msgid "&Back" -#~ msgstr "पीछे (&B)" - -#~ msgctxt "go forward" -#~ msgid "&Forward" -#~ msgstr "आगे (&F)" - -#~ msgctxt "home page" -#~ msgid "&Home" -#~ msgstr "घर (&H)" - -#~ msgctxt "show help" -#~ msgid "&Help" -#~ msgstr "मदद (&H)" - -#~ msgid "Show &Menubar" -#~ msgstr "मेन्यू पट्टी दिखाएँ (&M)" - -#~ msgid "Show Menubar<p>Shows the menubar again after it has been hidden</p>" -#~ msgstr "मेन्यू पट्टी दिखाएँ<p>मेन्यू पट्टी को छुपाए जाने के बाद फिर से दिखाता है</p>" - -#~ msgid "Show St&atusbar" -#~ msgstr "स्थिति पट्टी दिखाएँ (&a)" - -#, fuzzy -#~| msgid "" -#~| "Show Statusbar<p>Shows the statusbar, which is the bar at the bottom of " -#~| "the window used for status information.</p>" -#~ msgid "" -#~ "Show Statusbar<p>Shows the statusbar, which is the bar at the bottom of " -#~ "the window used for status information.</p>" -#~ msgstr "" -#~ "स्थिति पट्टी दिखाएँ<p>स्थिति पट्टी प्रदर्शित करता है जो कि विंडो के तल पर एक पट्टी " -#~ "होती है और जो स्थिति जानकारी दिखाती है.</p>" - -#~ msgid "&New" -#~ msgstr "नया (&N)" - -#~ msgid "Create new document" -#~ msgstr "नया दस्तावेज़ बनाएँ" - -#~ msgid "&Open..." -#~ msgstr "खोलें... (&O)" - -#~ msgid "Open an existing document" -#~ msgstr "मौज़ूदा दस्तावेज़ खोलें" - -#~ msgid "Open &Recent" -#~ msgstr "हाल ही का खोलें (&R)" - -#~ msgid "Open a document which was recently opened" -#~ msgstr "हाल ही में उपयोग में आया दस्तावेज़ खोलें" - -#~ msgid "&Save" -#~ msgstr "सहेजें (&S)" - -#~ msgid "Save document" -#~ msgstr "दस्तावेज़ सहेजें" - -#~ msgid "Save &As..." -#~ msgstr "ऐसे सहेजें (&A)" - -#~ msgid "Save document under a new name" -#~ msgstr "दस्तावेज़ को नए नाम से सहेजें" - -#~ msgid "Re&vert" -#~ msgstr "लौटें (&v)" - -#~ msgid "&Close" -#~ msgstr "बंद करें (&C)" - -#~ msgid "Close document" -#~ msgstr "दस्तावेज़ बन्द करें" - -#~ msgid "&Print..." -#~ msgstr "छापें...(&P)" - -#~ msgid "Print document" -#~ msgstr "दस्तावेज़ छापें" - -#~ msgid "Print Previe&w" -#~ msgstr "छपाई नमूना (&w)" - -#~ msgid "Show a print preview of document" -#~ msgstr "दस्तावेज़ का छपाई नमूना दिखायें" - -#~ msgid "&Mail..." -#~ msgstr "डाक (&M)" - -#~ msgid "Send document by mail" -#~ msgstr "दस्तावेज़ डाक से भेजें" - -#~ msgid "&Quit" -#~ msgstr "बाहर जाएँ (&Q)" - -#~ msgid "Quit application" -#~ msgstr "अनुप्रयोग से बाहर आएं" - -#~ msgid "Undo last action" -#~ msgstr "आखरी परिवर्तन रद्द करें" - -#~ msgid "Re&do" -#~ msgstr "दोहराएँ (&d)" - -#~ msgid "Cu&t" -#~ msgstr "काटें (&t)" - -#~ msgid "Cut selection to clipboard" -#~ msgstr "चयन को काटें तथा क्लिपबोर्ड में रखें" - -#~ msgid "&Copy" -#~ msgstr "नक़ल (&C)" - -#~ msgid "Copy selection to clipboard" -#~ msgstr "चयन को क्लिपबोर्ड में नक़ल करें" - -#~ msgid "&Paste" -#~ msgstr "चिपकाएँ (&P)" - -#~ msgid "Paste clipboard content" -#~ msgstr "क्लिपबोर्ड विषयवस्तु चिपकाएँ" - -#~ msgid "C&lear" -#~ msgstr "साफ करें (&l)" - -#~ msgid "Select &All" -#~ msgstr "सभी चुनें (&A)" - -#~ msgid "Dese&lect" -#~ msgstr "अचयनित (&l)" - -#~ msgid "&Find..." -#~ msgstr "ढूंढें...(&F)" - -#~ msgid "Find &Next" -#~ msgstr "अगला ढूंढें (&N)" - -#~ msgid "Find Pre&vious" -#~ msgstr "पिछला ढूंढें (&v)" - -#~ msgid "&Replace..." -#~ msgstr "बदलें...(&R)" - -#~ msgid "&Actual Size" -#~ msgstr "वास्तविक आकार (&A)" - -#~ msgid "View document at its actual size" -#~ msgstr "दस्तावेज़ को मूल आकार में देखें" - -#~ msgid "&Fit to Page" -#~ msgstr "पृष्ठ के अनुरूप (&F)" - -#~ msgid "Zoom to fit page in window" -#~ msgstr "पृष्ठ विंडो में फिट करें" - -#~ msgid "Fit to Page &Width" -#~ msgstr "पृष्ठ चौड़ाई के अनुरूप (&W)" - -#~ msgid "Zoom to fit page width in window" -#~ msgstr "पृष्ठ चौड़ाई में फिट करें" - -#~ msgid "Fit to Page &Height" -#~ msgstr "पृष्ठ ऊँचाई के अनुरूप (&H)" - -#~ msgid "Zoom to fit page height in window" -#~ msgstr "पृष्ठ ऊँचाई के अनुरूप" - -#~ msgid "Zoom &In" -#~ msgstr "बड़े आकार में दिखाएँ (&I)" - -#~ msgid "Zoom &Out" -#~ msgstr "छोटे आकार में दिखाएँ (&O)" - -#~ msgid "&Zoom..." -#~ msgstr "ज़ूम... (&Z)" - -#~ msgid "Select zoom level" -#~ msgstr "जूम स्तर चुनें" - -#~ msgid "&Redisplay" -#~ msgstr "फिर से दिखाएँ (&R)" - -#~ msgid "Redisplay document" -#~ msgstr "दस्तावेज़ फिर से दिखाएँ" - -#~ msgid "&Up" -#~ msgstr "ऊपर (&U)" - -#~ msgid "Go up" -#~ msgstr "ऊपर जाएं" - -#~ msgid "&Previous Page" -#~ msgstr "पिछला पृष्ठ (&P)" - -#~ msgid "Go to previous page" -#~ msgstr "पिछले पृष्ठ पर जाएँ" - -#~ msgid "&Next Page" -#~ msgstr "अगला पृष्ठ (&N)" - -#~ msgid "Go to next page" -#~ msgstr "अगले पृष्ठ पर जाएँ" - -#~ msgid "&Go To..." -#~ msgstr "यहाँ जाएं... (&G)" - -#~ msgid "&Go to Page..." -#~ msgstr "पृष्ठ पर जाएं... (&G)" - -#~ msgid "&Go to Line..." -#~ msgstr "पंक्ति पर जाएँ... (&G)" - -#~ msgid "&First Page" -#~ msgstr "प्रथम पृष्ठ (&F)" - -#~ msgid "Go to first page" -#~ msgstr "प्रथम पृष्ठ पर जाएँ" - -#~ msgid "&Last Page" -#~ msgstr "अंतिम पृष्ठ (&L)" - -#~ msgid "Go to last page" -#~ msgstr "अन्तिम पृष्ठ पर जाएं" - -#~ msgid "Go back in document" -#~ msgstr "दस्तावेज़ में पीछे जाएँ" - -#~ msgid "&Forward" -#~ msgstr "आगे (&F)" - -#~ msgid "Go forward in document" -#~ msgstr "दस्तावेज़ में आगे जाएं" - -#~ msgid "&Add Bookmark" -#~ msgstr " पसंदीदा जोड़ें (&C)" - -#~ msgid "&Edit Bookmarks..." -#~ msgstr " पसंदीदा संपादित करें ...(&E)" - -#~ msgid "&Spelling..." -#~ msgstr "वर्तनी...(&S)" - -#~ msgid "Check spelling in document" -#~ msgstr "दस्तावेज़ में वर्तनी जांचें" - -#~ msgid "Show or hide menubar" -#~ msgstr "मेन्यू पट्टी दिखाएँ या छुपाएँ" - -#~ msgid "Show &Toolbar" -#~ msgstr "औज़ार पट्टी दिखाएँ (&T)" - -#~ msgid "Show or hide toolbar" -#~ msgstr "औज़ार पट्टी दिखाएँ या छुपाएँ" - -#~ msgid "Show or hide statusbar" -#~ msgstr "स्थिति पट्टी दिखाएँ या छुपाएँ" - -#~ msgid "F&ull Screen Mode" -#~ msgstr "पूर्ण स्क्रीन मोड (&u)" - -#~ msgid "&Save Settings" -#~ msgstr "विन्यास सहेजें (&S)" - -#~ msgid "Configure S&hortcuts..." -#~ msgstr "शॉर्ट कट कॉन्फ़िगर करें...(&h)" - -#~ msgid "&Configure %1..." -#~ msgstr "%1 कॉन्फ़िगर करें...(&C)" - -#~ msgid "Configure Tool&bars..." -#~ msgstr "औज़ार पट्टी कॉन्फ़िगर करें... (&b)" - -#~ msgid "Configure &Notifications..." -#~ msgstr "सूचनाएँ कॉन्फ़िगर करें.... (&N)" - -#~ msgid "%1 &Handbook" -#~ msgstr "%1 हैंडबुक (&H)" - -#~ msgid "What's &This?" -#~ msgstr "यह क्या है? (&T)" - -#~ msgid "Tip of the &Day" -#~ msgstr "आज का नुस्ख़ा (&D)" - -#~ msgid "&Report Bug..." -#~ msgstr "बग रिपोर्ट करें... (&R)" - -#~ msgid "Switch Application &Language..." -#~ msgstr "अनुप्रयोग भाषा स्विच करें... (&L)" - -#~ msgid "&About %1" -#~ msgstr "%1 के बारे में (&A)" - -#~ msgid "About &KDE" -#~ msgstr "केडीई के बारे में (&K)" - -#~ msgctxt "@action:inmenu" -#~ msgid "Exit F&ull Screen Mode" -#~ msgstr "पूर्ण स्क्रीन मोड से बाहर हो" - -#~ msgctxt "@action:intoolbar" -#~ msgid "Exit Full Screen" -#~ msgstr "पूर्ण स्क्रीन मोड से बाहर हो" - -#~ msgctxt "@info:tooltip" -#~ msgid "Exit full screen mode" -#~ msgstr "पूर्ण स्क्रीन मोड से बाहर हो" - -#~ msgctxt "@action:inmenu" -#~ msgid "F&ull Screen Mode" -#~ msgstr "पूर्ण स्क्रीन मोड (&u)" - -#~ msgctxt "@action:intoolbar" -#~ msgid "Full Screen" -#~ msgstr "पूरा स्क्रीन" - -#~ msgctxt "@info:tooltip" -#~ msgid "Display the window in full screen" -#~ msgstr "विंडो को संपूर्ण स्क्रीन में दिखायें" - -#~ msgctxt "Custom color" -#~ msgid "Custom..." -#~ msgstr "मनपसंद..." - -#~ msgctxt "palette name" -#~ msgid "* Recent Colors *" -#~ msgstr "* हाल ही के रंग *" - -#~ msgctxt "palette name" -#~ msgid "* Custom Colors *" -#~ msgstr "* मनपसंद रंग *" - -#~ msgctxt "palette name" -#~ msgid "Forty Colors" -#~ msgstr "चालीस रंग" - -#~ msgctxt "palette name" -#~ msgid "Oxygen Colors" -#~ msgstr "ऑक्सीजन रंग" - -#~ msgctxt "palette name" -#~ msgid "Rainbow Colors" -#~ msgstr "इंद्रधनुषी रंग" - -#~ msgctxt "palette name" -#~ msgid "Royal Colors" -#~ msgstr "राजसी रंग" - -#~ msgctxt "palette name" -#~ msgid "Web Colors" -#~ msgstr "वेब रंग" - -#~ msgid "Named Colors" -#~ msgstr "नामांकित रंग " - -#~ msgid "Select Color" -#~ msgstr "रंग चुनें" - -#~ msgid "Hue:" -#~ msgstr "वर्ण:" - -#~ msgctxt "The angular degree unit (for hue)" -#~ msgid "°" -#~ msgstr "°" - -#~ msgid "Saturation:" -#~ msgstr "संतृप्ति:" - -#~ msgctxt "This is the V of HSV" -#~ msgid "Value:" -#~ msgstr "मूल" - -#~ msgid "Red:" -#~ msgstr "लाल:" - -#~ msgid "Green:" -#~ msgstr "हराः" - -#~ msgid "Blue:" -#~ msgstr "नीलाः" - -#~ msgid "Alpha:" -#~ msgstr "अल्फ़ा:" - -#~ msgid "&Add to Custom Colors" -#~ msgstr "पसंद के रंगों में जोड़ें (&A)" - -#~ msgid "Name:" -#~ msgstr "नाम:" - -#~ msgid "HTML:" -#~ msgstr "एचटीएमएलः" - -#~ msgid "Default color" -#~ msgstr "डिफ़ॉल्ट रंग" - -#~ msgid "-default-" -#~ msgstr "-डिफ़ॉल्ट-" - -#~ msgid "-unnamed-" -#~ msgstr "-बेनाम-" - -#~ msgid "" -#~ "<qt>No information available.<br />The supplied KAboutData object does " -#~ "not exist.</qt>" -#~ msgstr "" -#~ "<qt>कोई जानकारी उपलब्ध नहीं.<br /> प्रेषित किया गया के-अबाउट-डाटा ऑब्जेक्ट अस्तित्व " -#~ "में नहीं है.</qt>" - -#~ msgid "" -#~ "<html><font size=\"5\">%1</font><br /><b>Version %2</b><br /> </html>" -#~ msgstr "" -#~ "<html><font size=\"5\">%1</font><br /><b>संस्करण %2</b><br /> </html>" - -#~ msgctxt "" -#~ "Program name, version and KDE platform version; do not translate " -#~ "'Development Platform'" -#~ msgid "" -#~ "<html><font size=\"5\">%1</font><br /><b>Version %2</b><br />Using KDE " -#~ "Development Platform %3</html>" -#~ msgstr "" -#~ "<html><font size=\"5\">%1</font><br /><b>संस्करण %2</b> <br/>केडीई विकास मंच " -#~ "%3 प्रयोग से</html>" - -#~ msgid "License: %1" -#~ msgstr "लाइसेंस: %1" - -#~ msgid "License Agreement" -#~ msgstr "लाइसेंस करार" - -#~ msgctxt "Action to send an email to a contributor" -#~ msgid "Email contributor" -#~ msgstr "ईमेल सहयोगी" - -#~ msgctxt "Action to send an email to a contributor" -#~ msgid "" -#~ "Email contributor\n" -#~ "%1" -#~ msgstr "" -#~ "ईमेल सहयोगी\n" -#~ "%1" - -#~ msgctxt "@item Contributor name in about dialog." -#~ msgid "%1" -#~ msgstr "%1" - -#~ msgctxt "City, Country" -#~ msgid "%1, %2" -#~ msgstr "%1, %2" - -#~ msgctxt "A generic social network or homepage link of an unlisted type." -#~ msgid "Other" -#~ msgstr "अन्य" - -#~ msgctxt "A type of link." -#~ msgid "Blog" -#~ msgstr "ब्लॉग" - -#~ msgctxt "A type of link." -#~ msgid "Homepage" -#~ msgstr "मुख पृष्ठ" - -#~ msgid "About KDE" -#~ msgstr "केडीई के बारे में" - -#~ msgid "" -#~ "<html><font size=\"5\">KDE - Be Free!</font><br /><b>Platform Version %1</" -#~ "b></html>" -#~ msgstr "" -#~ "<html><font size=\"5\">केडीई - मुक्त हों</font><br /><b>मंच संस्करण %1</b></html>" - -#~ msgctxt "About KDE" -#~ msgid "&About" -#~ msgstr "के बारे में (&A)" - -#~ msgid "&Report Bugs or Wishes" -#~ msgstr "बग या शुभकामना रिपोर्ट भेजें (&R)" - -#~ msgid "&Join KDE" -#~ msgstr "केडीई में शामिल हों (&J)" - -#~ msgid "&Support KDE" -#~ msgstr "केडीई को सहयोग दें (&S)" - -#~ msgctxt "Opposite to Back" -#~ msgid "Next" -#~ msgstr "अगला" - -#~ msgid "Finish" -#~ msgstr "समाप्त" - -#~ msgid "Submit Bug Report" -#~ msgstr "बग रपट जमा करें" - -#~ msgid "" -#~ "Your email address. If incorrect, use the Configure Email button to " -#~ "change it" -#~ msgstr "" -#~ "आपका ईमेल पता. यदि गलत है, तो कॉन्फ़िगर ईमेल बटन का उपयोग इसे सही करने के लिए करें" - -#~ msgctxt "Email sender address" -#~ msgid "From:" -#~ msgstr "सेः" - -#~ msgid "Configure Email..." -#~ msgstr "ईमेल कॉन्फ़िगर करें..." - -#~ msgid "The email address this bug report is sent to." -#~ msgstr "इस बग रिपोर्ट को भेजने के लिए ईमेल पता." - -#~ msgctxt "Email receiver address" -#~ msgid "To:" -#~ msgstr "को:" - -#~ msgid "&Send" -#~ msgstr "भेजें (&S)" - -#~ msgid "Send bug report." -#~ msgstr "बग रपट भेजें" - -#~ msgid "Send this bug report to %1." -#~ msgstr "इस बग रपट को %1को भेजें." - -#~ msgid "" -#~ "The application for which you wish to submit a bug report - if incorrect, " -#~ "please use the Report Bug menu item of the correct application" -#~ msgstr "" -#~ "अनुप्रयोग जिसके लिए आप बग रिपोर्ट भेजना चाहते हैं - यदि गलत है, तो कृपया उचित " -#~ "अनुप्रयोग का रिपोर्ट बग मेन्यू आइटम इस्तेमाल करें" - -#~ msgid "Application: " -#~ msgstr "अनुप्रयोग" - -#~ msgid "" -#~ "The version of this application - please make sure that no newer version " -#~ "is available before sending a bug report" -#~ msgstr "" -#~ "इस अनुप्रयोग का संस्करण. बग रिपोर्ट भेजने से पहले कृपया सुनिश्चित हों कि कोई नया वर्सन " -#~ "उपलब्ध तो नहीं है " - -#~ msgid "Version:" -#~ msgstr "संस्करणः" - -#~ msgid "no version set (programmer error)" -#~ msgstr "कोई संस्करण नियत नहीं (प्रोग्रामर त्रुटि)" - -#~ msgid "OS:" -#~ msgstr "ओएस:" - -#~ msgid "Compiler:" -#~ msgstr "कम्पायलर:" - -#~ msgid "Se&verity" -#~ msgstr "गंभीरता (&v)" - -#~ msgid "Critical" -#~ msgstr "नाजुक" - -#~ msgid "Grave" -#~ msgstr "संगीन" - -#~ msgctxt "normal severity" -#~ msgid "Normal" -#~ msgstr "सामान्य" - -#~ msgid "Wishlist" -#~ msgstr "इच्छा सूची" - -#~ msgid "Translation" -#~ msgstr "अनुवाद " - -#~ msgid "S&ubject: " -#~ msgstr "विषयः (&u)" - -#~ msgid "" -#~ "Enter the text (in English if possible) that you wish to submit for the " -#~ "bug report.\n" -#~ "If you press \"Send\", a mail message will be sent to the maintainer of " -#~ "this program.\n" -#~ msgstr "" -#~ "जो बग रिपोर्ट आप भेजना चाहते हैं, उसे यहाँ भरें (यदि संभव हो तो अंग्रेज़ी में) .\n" -#~ "यदि आप \"भेजें\" दबाएंगे, इस प्रोग्राम के मेंटेनर को एक ईमेल संदेश भेज दिया जाएगा.\n" - -#~ msgid "" -#~ "<qt>To submit a bug report, click on the button below. This will open a " -#~ "web browser window on <a href=\"http://bugs.kde.org\">http://bugs.kde." -#~ "org</a> where you will find a form to fill in. The information displayed " -#~ "above will be transferred to that server.</qt>" -#~ msgstr "" -#~ "<qt>बग रिपोर्ट भेजने के लिए नीचे दिये बटन को क्लिक करें.\n" -#~ "यह एक ब्राउज़र विंडो <a href=\"http://bugs.kde.org\">http://bugs.kde.org</a> " -#~ "पर खोलेगा जहां आपको भरने के लिए एक फ़ॉर्म मिलेगा.\n" -#~ "जो जानकारी ऊपर दिखाई जा रही हे, वह उस सर्वर को स्थांतरित हो जाएगी.</qt>" - -#~ msgid "&Launch Bug Report Wizard" -#~ msgstr "बग रपट विज़ार्ड चालू करें (&L)" - -#~ msgctxt "unknown program name" -#~ msgid "unknown" -#~ msgstr "अज्ञात" - -#~ msgid "" -#~ "You must specify both a subject and a description before the report can " -#~ "be sent." -#~ msgstr "" -#~ "बग रिपोर्ट भेजा जा सके इसके लिए आपको पहले विषय तथा विवरण उल्लेखित करना होगा." - -#~ msgid "" -#~ "Unable to send the bug report.\n" -#~ "Please submit a bug report manually....\n" -#~ "See http://bugs.kde.org/ for instructions." -#~ msgstr "" -#~ "बग रिपोर्ट भेजने में असफल.\n" -#~ " कृपया बग रिपोर्ट हस्तचालित भेजें...\n" -#~ " जानकारी के लिए देखें http://bugs.kde.org/ ." - -#~ msgid "Bug report sent, thank you for your input." -#~ msgstr "बग रिपोर्ट भेज दिया गया, आपके इनपुट के लिए आपको धन्यवाद." - -#~ msgid "" -#~ "Close and discard\n" -#~ "edited message?" -#~ msgstr "" -#~ "बन्द कर रद्द करें\n" -#~ " संपादित संदेश?" - -#~ msgid "Close Message" -#~ msgstr "संदेश बन्द करें" - -#~ msgid "Configure" -#~ msgstr "कॉन्फ़िगर" - -#~ msgid "Job" -#~ msgstr "कार्य" - -#~ msgid "Job Control" -#~ msgstr "कार्य नियंत्रण" - -#~ msgid "Scheduled printing:" -#~ msgstr "अनुसूचित छपाई:" - -#~ msgid "Billing information:" -#~ msgstr "बिलिंग जानकारी" - -#~ msgid "Job priority:" -#~ msgstr "कार्य प्राथमिकता:" - -#~ msgid "Job Options" -#~ msgstr "कार्य विकल्प" - -#~ msgid "Option" -#~ msgstr "विकल्प" - -#~ msgid "Value" -#~ msgstr "मान" - -#~ msgid "Print Immediately" -#~ msgstr "तत्काल छापें" - -#~ msgid "Hold Indefinitely" -#~ msgstr "अनंत काल के लिए पकड़े रखें" - -#~ msgid "Day (06:00 to 17:59)" -#~ msgstr "दिन (06:00 से 17:59)" - -#~ msgid "Night (18:00 to 05:59)" -#~ msgstr "रात (18:00 से 05:59)" - -#~ msgid "Second Shift (16:00 to 23:59)" -#~ msgstr "द्वितीय पारी (16:00 से 23:59)" - -#~ msgid "Third Shift (00:00 to 07:59)" -#~ msgstr "तृतीय पारी (00:00 से 07:59)" - -#~ msgid "Weekend (Saturday to Sunday)" -#~ msgstr "सप्ताहांत (शनिवार से रविवार)" - -#~ msgid "Specific Time" -#~ msgstr "निश्चित समय" - -#~ msgid "Pages" -#~ msgstr "पृष्ठ" - -#~ msgid "Pages Per Sheet" -#~ msgstr "प्रति शीट पृष्ठों की संख्या" - -#~ msgid "1" -#~ msgstr "1" - -#~ msgid "6" -#~ msgstr "6" - -#~ msgid "2" -#~ msgstr "2" - -#~ msgid "9" -#~ msgstr "9" - -#~ msgid "4" -#~ msgstr "4" - -#~ msgid "16" -#~ msgstr "16" - -#~ msgid "Banner Pages" -#~ msgstr "बैनर पृष्ठ" - -#~ msgctxt "Banner page at start" -#~ msgid "Start" -#~ msgstr "प्रारंभ" - -#~ msgctxt "Banner page at end" -#~ msgid "End" -#~ msgstr "अंत" - -#~ msgid "Page Label" -#~ msgstr "पृष्ठ लेबल" - -#~ msgid "Page Border" -#~ msgstr "पृष्ठ किनारा" - -#~ msgid "Mirror Pages" -#~ msgstr "मिरर पृष्ठ" - -#~ msgid "Mirror pages along vertical axis" -#~ msgstr "खड़े अक्ष के साथ मिरर पृष्ठ" - -#~ msgid "Left to Right, Top to Bottom" -#~ msgstr "बाएं से दाएं, ऊपर से नीचे" - -#~ msgid "Left to Right, Bottom to Top" -#~ msgstr "बाएं से दाएं, नीचे से ऊपर" - -#~ msgid "Right to Left, Bottom to Top" -#~ msgstr "दाएं से बाएं, नीचे से ऊपर" - -#~ msgid "Right to Left, Top to Bottom" -#~ msgstr "दाएं से बाएं, ऊपर से नीचे" - -#~ msgid "Bottom to Top, Left to Right" -#~ msgstr "नीचे से ऊपर, बाएं से दाएं" - -#~ msgid "Bottom to Top, Right to Left" -#~ msgstr "नीचे से ऊपर, दाएं से बाएं" - -#~ msgid "Top to Bottom, Left to Right" -#~ msgstr "ऊपर से नीचे, बाएं से दाएं" - -#~ msgid "Top to Bottom, Right to Left" -#~ msgstr "ऊपर से नीचे, दाएं से बाएं" - -#~ msgctxt "No border line" -#~ msgid "None" -#~ msgstr "कुछ नहीं" - -#~ msgid "Single Line" -#~ msgstr "एकल लकीर" - -#~ msgid "Single Thick Line" -#~ msgstr "एकल मोटी लकीर" - -#~ msgid "Double Line" -#~ msgstr "दोहरी लकीर" - -#~ msgid "Double Thick Line" -#~ msgstr "दोहरी गाढ़ी लकीर" - -#~ msgctxt "Banner page" -#~ msgid "None" -#~ msgstr "कुछ नहीं" - -#~ msgctxt "Banner page" -#~ msgid "Standard" -#~ msgstr "मानक" - -#~ msgctxt "Banner page" -#~ msgid "Unclassified" -#~ msgstr "अवर्गीकृत" - -#~ msgctxt "Banner page" -#~ msgid "Confidential" -#~ msgstr "गोपनीय" - -#~ msgctxt "Banner page" -#~ msgid "Classified" -#~ msgstr "वर्गीकृत" - -#~ msgctxt "Banner page" -#~ msgid "Secret" -#~ msgstr "गुप्त" - -#~ msgctxt "Banner page" -#~ msgid "Top Secret" -#~ msgstr "अत्यंत गुप्त" - -#~ msgid "All Pages" -#~ msgstr "सभी पृष्ठ" - -#~ msgid "Odd Pages" -#~ msgstr "विषम पृष्ठ" - -#~ msgid "Even Pages" -#~ msgstr "सम पृष्ठ" - -#~ msgid "Page Set" -#~ msgstr "पृष्ठ सेट" - -#~ msgctxt "@title:window" -#~ msgid "Print" -#~ msgstr "छापें" - -#~ msgid "&Try" -#~ msgstr "कोशिश करें (&T)" - -#~ msgid "modified" -#~ msgstr "परिवर्धित" - -#~ msgctxt "Document/application separator in titlebar" -#~ msgid " – " -#~ msgstr " – " - -#~ msgid "&Details" -#~ msgstr "विवरण (&D) " - -#~ msgid "Get help..." -#~ msgstr "मदद लें..." - -#~ msgid "--- separator ---" -#~ msgstr "--- सेपरेटर ---" - -#~ msgid "Change Text" -#~ msgstr "पाठ बदलें" - -#~ msgid "Icon te&xt:" -#~ msgstr "प्रतीक पाठ (&x):" - -#~ msgid "Configure Toolbars" -#~ msgstr "औज़ार पट्टियाँ कॉन्फ़िगर करें" - -#~ msgid "" -#~ "Do you really want to reset all toolbars of this application to their " -#~ "default? The changes will be applied immediately." -#~ msgstr "" -#~ "क्या आप सचमुच इस अनुप्रयोग के सभी औजारपट्टियों को उनके डीफ़ॉल्ट पर रीसेट करना चाहते " -#~ "हैं? परिवर्तनों को तत्काल लागू किया जाएगा." - -#~ msgid "Reset Toolbars" -#~ msgstr "औजार-पट्टी रीसेट करें" - -#~ msgid "Reset" -#~ msgstr "रीसेट" - -#~ msgid "&Toolbar:" -#~ msgstr "औज़ार पट्टी (&T): " - -#~ msgid "A&vailable actions:" -#~ msgstr "उपलब्ध क्रियाएँ: (&v)" - -#~ msgid "Filter" -#~ msgstr "फ़िल्टर" - -#~ msgid "Curr&ent actions:" -#~ msgstr "मौज़ूदा कार्यः (&e)" - -#~ msgid "Change &Icon..." -#~ msgstr "प्रतीक बदलें... (&I)" - -#~ msgid "Change Te&xt..." -#~ msgstr "पाठ बदलें... (&x)" - -#~ msgctxt "@item:intable Action name in toolbar editor" -#~ msgid "%1" -#~ msgstr "%1" - -#~ msgid "" -#~ "This element will be replaced with all the elements of an embedded " -#~ "component." -#~ msgstr "यह अवयव एक एम्बेडेड अवयव के सभी अवयव के साथ बदल जाएगा." - -#~ msgid "<Merge>" -#~ msgstr "<मिलाएँ>" - -#~ msgid "<Merge %1>" -#~ msgstr "<मिलाएँ %1>" - -#~ msgid "" -#~ "This is a dynamic list of actions. You can move it, but if you remove it " -#~ "you will not be able to re-add it." -#~ msgstr "" -#~ "यह क्रियाओं की गतिशील सूची है. आप इसे खिसका सकते हैं, पर यदि आपने इसे मिटा दिया तो " -#~ "आप इसे फिर से जोड़ नहीं सकते." - -#~ msgid "ActionList: %1" -#~ msgstr "कार्य सूची: %1" - -#~ msgctxt "@label Action tooltip in toolbar editor, below the action list" -#~ msgid "%1" -#~ msgstr "%1" - -#~ msgid "Change Icon" -#~ msgstr "प्रतीक बदलें" - -#~ msgid "Manage Link" -#~ msgstr "कड़ियों का प्रबंधन करें" - -#~ msgid "Link Text:" -#~ msgstr "कड़ी पाठ:" - -#~ msgid "Link URL:" -#~ msgstr "कड़ी यूआरएल:" - -#~ msgctxt "@action:button filter-yes" -#~ msgid "%1" -#~ msgstr "%1" - -#~ msgctxt "@action:button filter-no" -#~ msgid "%1" -#~ msgstr "%1" - -#~ msgctxt "@action:button filter-continue" -#~ msgid "%1" -#~ msgstr "%1" - -#~ msgctxt "@action:button filter-cancel" -#~ msgid "%1" -#~ msgstr "%1" - -#~ msgctxt "@action:button post-filter" -#~ msgid "." -#~ msgstr "." - -#~ msgid "Details" -#~ msgstr "विवरण" - -#~ msgid "Question" -#~ msgstr "प्रश्न" - -#~ msgid "Do not ask again" -#~ msgstr "दोबारा मत पूछें" - -#~ msgid "Warning" -#~ msgstr "चेतावनी" - -#~ msgid "Error" -#~ msgstr "त्रुटि" - -#~ msgid "Sorry" -#~ msgstr "खेद है" - -#~ msgid "Information" -#~ msgstr "जानकारी" - -#~ msgid "Do not show this message again" -#~ msgstr "यह संदेश फिर से न दिखाएँ" - -#~ msgid "Password:" -#~ msgstr "पासवर्ड: " - -#~ msgid "Password" -#~ msgstr "पासवर्ड" - -#~ msgid "Supply a username and password below." -#~ msgstr "उपयोक्ता नाम तथा पासवर्ड नीचे भरें." - -#, fuzzy -#~| msgid "&Keep password" -#~ msgid "Use this password:" -#~ msgstr "पासवर्ड याद रखें (&K)" - -#~ msgid "Username:" -#~ msgstr "उपयोक्ता नाम:" - -#~ msgid "Domain:" -#~ msgstr "डोमेनः" - -#~ msgid "Remember password" -#~ msgstr "पासवर्ड याद रखें" - -#~ msgid "Select Region of Image" -#~ msgstr "छवि का रीजन चुनें" - -#~ msgid "Please click and drag on the image to select the region of interest:" -#~ msgstr "पसंदीदा क्षेत्र को चुनने के लिए छवि पर क्लिक कर खींचें:" - -#~ msgid "Default:" -#~ msgstr "डिफ़ॉल्ट:" - -#~ msgctxt "No shortcut defined" -#~ msgid "None" -#~ msgstr "कुछ नहीं" - -#~ msgid "Custom:" -#~ msgstr "मनपसंदः" - -#~ msgid "Shortcut Schemes" -#~ msgstr "शॉर्टकट योजनाएँ" - -#~ msgid "Current scheme:" -#~ msgstr "मौज़ूदा योजना:" - -#~ msgid "New..." -#~ msgstr "नया..." - -#~ msgid "Delete" -#~ msgstr "मिटाएँ" - -#~ msgid "More Actions" -#~ msgstr "और क्रियाएँ" - -#~ msgid "Save as Scheme Defaults" -#~ msgstr "योजना डिफ़ॉल्ट्स जैसा सहेजें (&D)" - -#~ msgid "Export Scheme..." -#~ msgstr "योजना निर्यात..." - -#~ msgid "Name for New Scheme" -#~ msgstr "नयी योजना के लिए नाम" - -#~ msgid "Name for new scheme:" -#~ msgstr "नयी योजना के लिए नाम:" - -#~ msgid "New Scheme" -#~ msgstr "नयी योजना" - -#~ msgid "A scheme with this name already exists." -#~ msgstr "इस नाम की योजना पहले से ही मौज़ूद है." - -#~ msgid "Export to Location" -#~ msgstr "स्थान पर निर्यात" - -#~ msgid "Configure Shortcuts" -#~ msgstr "शॉर्ट कट कॉन्फ़िगर कीजिए" - -#~ msgid "Print" -#~ msgstr "छापें" - -#~ msgid "Reset to Defaults" -#~ msgstr "डिफ़ॉल्ट्स पर लाएँ" - -#~ msgid "" -#~ "Search interactively for shortcut names (e.g. Copy) or combination of " -#~ "keys (e.g. Ctrl+C) by typing them here." -#~ msgstr "" -#~ "यहां पर टाइप कर शॉर्टकट नामों (जैसे कि नक़ल) या कॉम्बीनेशन कुंजियों (जैसे कि. कंट्रोल+C) " -#~ "के लिए इंटरेक्टिवली ढूंढें " - -#~ msgid "" -#~ "Here you can see a list of key bindings, i.e. associations between " -#~ "actions (e.g. 'Copy') shown in the left column and keys or combination of " -#~ "keys (e.g. Ctrl+V) shown in the right column." -#~ msgstr "" -#~ "यहाँ आप की बाइंडिंग देख सकते हैं, यानी क्रियाओं के बीच संबद्धता (जैसे 'नक़ल') बाएँ स्तम्भ " -#~ "में दिखाया गया है तथा कुंजी या कुंजियों का संयोजन (जैसे कंट्रोल+V) दाएँ स्तम्भ में दिखाया " -#~ "गया है." - -#~ msgid "Action" -#~ msgstr "क्रिया" - -#~ msgid "Shortcut" -#~ msgstr "शॉर्टकट" - -#~ msgid "Alternate" -#~ msgstr "वैकल्पिक" - -#~ msgid "Global" -#~ msgstr "वैश्विक" - -#~ msgid "Global Alternate" -#~ msgstr "वैश्विक विकल्प" - -#~ msgid "Mouse Button Gesture" -#~ msgstr "माउस बटन मुख-मुद्राएँ" - -#~ msgid "Mouse Shape Gesture" -#~ msgstr "माउस आकार मुख-मुद्रा" - -#~ msgid "Unknown" -#~ msgstr "अज्ञात" - -#~ msgid "Key Conflict" -#~ msgstr "कुंजी कॉनफ्लिक्ट" - -#~ msgid "" -#~ "The '%1' shape gesture has already been allocated to the \"%2\" action.\n" -#~ "Do you want to reassign it from that action to the current one?" -#~ msgstr "" -#~ "आकार मुख-मुद्रा संयोजन '%1' पहले से ही \"%2\" मानक क्रिया के लिए सम्बद्ध है.\n" -#~ "क्या आप इसे मौज़ूदा क्रिया से फिर से सम्बद्ध करना चाहते हैं?" - -#~ msgid "Reassign" -#~ msgstr "फिर से आबंटित करें" - -#~ msgid "" -#~ "The '%1' rocker gesture has already been allocated to the \"%2\" action.\n" -#~ "Do you want to reassign it from that action to the current one?" -#~ msgstr "" -#~ "रॉकर मुख-मुद्रा संयोजन '%1' पहले से ही \"%2\" मानक क्रिया के लिए सम्बद्ध है.\n" -#~ "क्या आप इसे मौज़ूदा क्रिया से फिर से सम्बद्ध करना चाहते हैं?" - -#~ msgctxt "header for an applications shortcut list" -#~ msgid "Shortcuts for %1" -#~ msgstr "%1 के लिए शॉर्टकट्स" - -#~ msgid "Main:" -#~ msgstr "मुख्य:" - -#~ msgid "Alternate:" -#~ msgstr "वैकल्पिक:" - -#~ msgid "Global:" -#~ msgstr "वैश्विक:" - -#~ msgid "Action Name" -#~ msgstr "क्रिया नाम" - -#~ msgid "Shortcuts" -#~ msgstr "शॉर्टकट्स" - -#~ msgid "Description" -#~ msgstr "वर्णन" - -#~ msgctxt "@item:intable Action name in shortcuts configuration" -#~ msgid "%1" -#~ msgstr "%1" - -#~ msgid "Switch Application Language" -#~ msgstr "अनुप्रयोग भाषा स्विच करें" - -#~ msgid "" -#~ "Please choose the language which should be used for this application:" -#~ msgstr "कृपया इस अनुप्रयोग में इस्तेमाल की जाने वाली भाषा को चुनें:" - -#~ msgid "Add Fallback Language" -#~ msgstr "फ़ालबैक भाषा जोड़ें" - -#~ msgid "" -#~ "Adds one more language which will be used if other translations do not " -#~ "contain a proper translation." -#~ msgstr "" -#~ "एक या अधिक भाषाओं को जोड़ता है जिन्हें प्रयोग में लाया जाएगा यदि अनुवादों में सही " -#~ "अनुवाद नही मिलता." - -#~ msgid "" -#~ "The language for this application has been changed. The change will take " -#~ "effect the next time the application is started." -#~ msgstr "" -#~ "इस अनुप्रयोग के लिए भाषा बदला गया है. परिवर्तनों को इस अनुप्रयोग के अगली बार चालू " -#~ "होने पर लागू किया जाएगा." - -#~ msgid "Application Language Changed" -#~ msgstr "अनुप्रयोग भाषा परिवर्तित" - -#~ msgid "Primary language:" -#~ msgstr "प्राथमिक भाषा:" - -#~ msgid "Fallback language:" -#~ msgstr "फ़ालबैक भाषा" - -#~ msgid "Remove" -#~ msgstr "हटाएँ" - -#~ msgid "" -#~ "This is the main application language which will be used first, before " -#~ "any other languages." -#~ msgstr "" -#~ "यह मुख्य अनुप्रयोग भाषा है जिसे कि किसी भी अन्य भाषा से पहले प्रयोग में लिया जाएगा" - -#~ msgid "" -#~ "This is the language which will be used if any previous languages do not " -#~ "contain a proper translation." -#~ msgstr "" -#~ "यदि किसी पिछली भाषा में सही अनुवाद नहीं मिलता है तो इस भाषा को प्रयोग में लिया " -#~ "जाएगा." - -#~ msgid "Tip of the Day" -#~ msgstr "आज का नुस्ख़ा" - -#~ msgid "Did you know...?\n" -#~ msgstr "क्या आप जानते हैं...?\n" - -#~ msgid "&Show tips on startup" -#~ msgstr "प्रारंभ में नुस्ख़ा दिखाएँ (&S)" - -#~ msgid "&Previous" -#~ msgstr "पिछला (&P)" - -#~ msgctxt "Opposite to Previous" -#~ msgid "&Next" -#~ msgstr "अगला (&N)" - -#~ msgid "Find Next" -#~ msgstr "अगला ढूंढें" - -#~ msgid "<qt>Find next occurrence of '<b>%1</b>'?</qt>" -#~ msgstr "<qt> '<b>%1</b>' की अगली उपस्थिति ढूंढें?</qt>" - -#~ msgid "1 match found." -#~ msgid_plural "%1 matches found." -#~ msgstr[0] "1 जोड़ा मिला" -#~ msgstr[1] "%1 जोड़ मिले." - -#~ msgid "<qt>No matches found for '<b>%1</b>'.</qt>" -#~ msgstr "<qt> '<b>%1</b>' के लिए कोई जोड़ नहीं मिला.</qt>" - -#~ msgid "No matches found for '<b>%1</b>'." -#~ msgstr " '<b>%1</b>' के लिए कोई जोड़ नहीं मिला." - -#~ msgid "Beginning of document reached." -#~ msgstr "दस्तावेज़ का प्रारंभ आ पहुँचा." - -#~ msgid "End of document reached." -#~ msgstr "दस्तावेज़ का अंत आ पंहुचा." - -#~ msgid "Continue from the end?" -#~ msgstr "अंत से जारी रखें?" - -#~ msgid "Continue from the beginning?" -#~ msgstr "प्रारंभ से जारी रखें?" - -#~ msgid "Find Text" -#~ msgstr "पाठ ढूंढें" - -#~ msgctxt "@title:group" -#~ msgid "Find" -#~ msgstr "ढूंढें" - -#~ msgid "&Text to find:" -#~ msgstr "ढूंढने के लिए पाठ (&T)" - -#~ msgid "Regular e&xpression" -#~ msgstr "रेगुलर एक्सप्रेशन (&x)" - -#~ msgid "&Edit..." -#~ msgstr "संपादन... (&E)" - -#~ msgid "Replace With" -#~ msgstr "के साथ बदलें" - -#~ msgid "Replace&ment text:" -#~ msgstr "बदला गया पाठ (&m)" - -#~ msgid "Use p&laceholders" -#~ msgstr "प्लेसहोल्डर्स इस्तेमाल करें (&l)" - -#~ msgid "Insert Place&holder" -#~ msgstr "प्लेसहोल्डर्स शामिल करें (&h)" - -#~ msgid "Options" -#~ msgstr "विकल्प" - -#~ msgid "C&ase sensitive" -#~ msgstr "केस सेंसिटिव (&a)" - -#~ msgid "&Whole words only" -#~ msgstr "सिर्फ संपूर्ण अक्षर (&W)" - -#~ msgid "From c&ursor" -#~ msgstr "संकेतक से (&u)" - -#~ msgid "Find &backwards" -#~ msgstr "पीछे से ढूंढें (&b)" - -#~ msgid "&Selected text" -#~ msgstr "चुना गया पाठ (&S)" - -#~ msgid "&Prompt on replace" -#~ msgstr "बदलने पर पूछें (&P)" - -#~ msgid "Start replace" -#~ msgstr "बदलना प्रारंभ करें" - -#~ msgid "" -#~ "<qt>If you press the <b>Replace</b> button, the text you entered above is " -#~ "searched for within the document and any occurrence is replaced with the " -#~ "replacement text.</qt>" -#~ msgstr "" -#~ "<qt>यदि आप<b>बदलें</b>बटन दबाते हैं, तो जो पाठ आपने भरे हैं, दस्तावेज़ के भीतर ढूंढा " -#~ "जाकर उनकी सभी उपस्थिति को बदलने वाले पाठ से बदल देगा.</qt>" - -#~ msgid "&Find" -#~ msgstr "ढूंढें (&F)" - -#~ msgid "Start searching" -#~ msgstr "ढूंढना चालू करें" - -#~ msgid "" -#~ "<qt>If you press the <b>Find</b> button, the text you entered above is " -#~ "searched for within the document.</qt>" -#~ msgstr "" -#~ "<qt>यदि आप<b>बदलें</b>बटन दबाते हैं, तो जो पाठ आपने भरे हैं, उसके लिए दस्तावेज़ के भीतर " -#~ "ढूंढा जाएगा.</qt>" - -#~ msgid "" -#~ "Enter a pattern to search for, or select a previous pattern from the list." -#~ msgstr "ढूंढने के लिए कोई पैटर्न भरें या फिर सूची में से कोई पिछला पैटर्न चुनें" - -#~ msgid "If enabled, search for a regular expression." -#~ msgstr "यदि सक्षम किया जाता है, रेगुलर एक्सप्रेशन के लिए ढूंढें." - -#~ msgid "Click here to edit your regular expression using a graphical editor." -#~ msgstr "" -#~ "चित्रमय संपादक का प्रयोग करते हुए अपने रेगुलर एक्सप्रेशन को संपादित करने हेतु यहाँ क्लिक " -#~ "करें." - -#~ msgid "Enter a replacement string, or select a previous one from the list." -#~ msgstr "बदलने के लिए स्ट्रिंग भरें या सूची में से पिछला चुनें." - -#~ msgid "Click for a menu of available captures." -#~ msgstr "उपलब्ध कैप्चर्स के मेन्यू के लिए क्लिक करें." - -#~ msgid "Require word boundaries in both ends of a match to succeed." -#~ msgstr "सफल होने के लिए मैच के दोनों सिरों पर शब्द सीमाएँ (बाउण्डरी) आवश्यक है." - -#~ msgid "" -#~ "Start searching at the current cursor location rather than at the top." -#~ msgstr "शीर्ष के बजाए वर्तमान संकेतक स्थान से ढूंढना प्रारंभ करें." - -#~ msgid "Only search within the current selection." -#~ msgstr "सिर्फ मौजूदा चयन के भीतर ढूंढें." - -#~ msgid "" -#~ "Perform a case sensitive search: entering the pattern 'Joe' will not " -#~ "match 'joe' or 'JOE', only 'Joe'." -#~ msgstr "" -#~ "केस सेंसिटिव ढूंढें: पैटर्न 'Joe' भरने पर 'joe' या 'JOE' को नहीं ढूंढेगा, सिर्फ 'Joe' को " -#~ "ढूंढेगा." - -#~ msgid "Search backwards." -#~ msgstr "पीछे से ढूंढें." - -#~ msgid "Ask before replacing each match found." -#~ msgstr "प्राप्त जोड़े में से प्रत्येक को बदलने से पहले पूछें" - -#~ msgid "Any Character" -#~ msgstr "कोई भी अक्षर" - -#~ msgid "Start of Line" -#~ msgstr "पंक्ति का प्रारंभ" - -#~ msgid "End of Line" -#~ msgstr "पंक्ति का अंत" - -#~ msgid "Set of Characters" -#~ msgstr "अक्षरों के समूह" - -#~ msgid "Repeats, Zero or More Times" -#~ msgstr "दोहराएँ, शून्य या अधिक बार" - -#~ msgid "Repeats, One or More Times" -#~ msgstr "दोहराएँ, एक या अधिक बार" - -#~ msgid "Optional" -#~ msgstr "वैकल्पिक" - -#~ msgid "Escape" -#~ msgstr "एस्केप" - -#~ msgid "TAB" -#~ msgstr "टैब" - -#~ msgid "Newline" -#~ msgstr "नई-पंक्ति" - -#~ msgid "Carriage Return" -#~ msgstr "कैरिज वापस" - -#~ msgid "White Space" -#~ msgstr "श्वेत स्थान" - -#~ msgid "Digit" -#~ msgstr "डिजिट" - -#~ msgid "Complete Match" -#~ msgstr "पूर्ण जोड़" - -#~ msgid "Captured Text (%1)" -#~ msgstr "कैप्चर्ड पाठ (%1)" - -#~ msgid "You must enter some text to search for." -#~ msgstr "ढूंढने के लिए कोई पाठ भरें." - -#~ msgid "Invalid regular expression." -#~ msgstr "अवैध रेगुलर एक्सप्रेशन." - -#~ msgid "Replace" -#~ msgstr "बदलें" - -#~ msgctxt "@action:button Replace all occurrences" -#~ msgid "&All" -#~ msgstr "सभी (&A)" - -#~ msgid "&Skip" -#~ msgstr "छोड़ें (&S)" - -#~ msgid "Replace '%1' with '%2'?" -#~ msgstr " '%1' को '%2' से बदलें?" - -#~ msgid "No text was replaced." -#~ msgstr "कोई पाठ बदला नहीं गया." - -#~ msgid "1 replacement done." -#~ msgid_plural "%1 replacements done." -#~ msgstr[0] "1 बदलाव किया" -#~ msgstr[1] "%1 बदलाव किए" - -#~ msgid "Do you want to restart search from the end?" -#~ msgstr "क्या आप अंत से फिर से खोज प्रारंभ करना चाहते हैं?" - -#~ msgid "Do you want to restart search at the beginning?" -#~ msgstr "क्या आप प्रारंभ से फिर से खोज प्रारंभ करना चाहते हैं?" - -#~ msgctxt "@action:button Restart find & replace" -#~ msgid "Restart" -#~ msgstr "फिर से चालू करें" - -#~ msgctxt "@action:button Stop find & replace" -#~ msgid "Stop" -#~ msgstr "रूकें" - -#~ msgid "" -#~ "Your replacement string is referencing a capture greater than '\\%1', " -#~ msgstr "बदलने वाला आपका वाक्यांश '\\%1' से बड़े कैप्चर को संदर्भित करता है, " - -#~ msgid "but your pattern only defines 1 capture." -#~ msgid_plural "but your pattern only defines %1 captures." -#~ msgstr[0] "परंतु आपका पैटर्न सिर्फ १ कैप्चर को पारिभाषित करता है." -#~ msgstr[1] "परंतु आपका पैटर्न %1 कैप्चर को पारिभाषित करता है." - -#~ msgid "but your pattern defines no captures." -#~ msgstr "परंतु आपका पैटर्न कोई कैप्चर पारिभाषित नहीं करता है." - -#~ msgid "" -#~ "\n" -#~ "Please correct." -#~ msgstr "" -#~ "\n" -#~ "कृपया ठीक करें" - -#~ msgctxt "@item Font name" -#~ msgid "Sans Serif" -#~ msgstr "संस-सेरिफ" - -#~ msgctxt "@item Font name" -#~ msgid "Serif" -#~ msgstr "सेरिफ" - -#~ msgctxt "@item Font name" -#~ msgid "Monospace" -#~ msgstr "मोनोस्पेस" - -#~ msgctxt "@item Font name" -#~ msgid "%1" -#~ msgstr "%1" - -#~ msgctxt "@item Font name [foundry]" -#~ msgid "%1 [%2]" -#~ msgstr "%1 [%2]" - -#~ msgctxt "@info:whatsthis" -#~ msgid "Here you can choose the font to be used." -#~ msgstr "यहाँ आप उपयोग में आने वाले फ़ॉन्ट को चुन सकते हैं." - -#~ msgid "Requested Font" -#~ msgstr "निवेदित फ़ॉन्ट " - -#~ msgctxt "@option:check" -#~ msgid "Font" -#~ msgstr "फ़ॉन्ट" - -#~ msgctxt "@info:whatsthis" -#~ msgid "Enable this checkbox to change the font family settings." -#~ msgstr "इस चेक बक्से को फ़ॉन्ट परिवार विन्यास में बदलाव के लिए सक्षम करें." - -#~ msgctxt "@info:tooltip" -#~ msgid "Change font family?" -#~ msgstr "फ़ॉन्ट परिवार बदलें?" - -#~ msgctxt "@label" -#~ msgid "Font:" -#~ msgstr "फ़ॉन्टः" - -#~ msgctxt "@option:check" -#~ msgid "Font style" -#~ msgstr "फ़ॉन्ट शैली" - -#~ msgctxt "@info:whatsthis" -#~ msgid "Enable this checkbox to change the font style settings." -#~ msgstr "इस चेक बक्से को फ़ॉन्ट शैली विन्यास में बदलाव के लिए सक्षम करें." - -#~ msgctxt "@info:tooltip" -#~ msgid "Change font style?" -#~ msgstr "फ़ॉन्ट शैली बदलें?" - -#~ msgid "Font style:" -#~ msgstr "फ़ॉन्ट शैली" - -#~ msgctxt "@option:check" -#~ msgid "Size" -#~ msgstr "आकार" - -#~ msgctxt "@info:whatsthis" -#~ msgid "Enable this checkbox to change the font size settings." -#~ msgstr "इस चेक बक्से को फ़ॉन्ट आकार विन्यास में बदलाव के लिए सक्षम करें." - -#~ msgctxt "@info:tooltip" -#~ msgid "Change font size?" -#~ msgstr "फ़ॉन्ट आकार बदलें?" - -#~ msgctxt "@label:listbox Font size" -#~ msgid "Size:" -#~ msgstr "आकारः" - -#~ msgctxt "@info:whatsthis" -#~ msgid "Here you can choose the font family to be used." -#~ msgstr "यहाँ आप उपयोग के लिए फ़ॉन्ट परिवार चुन सकते हैं." - -#~ msgctxt "@info:whatsthis" -#~ msgid "Here you can choose the font style to be used." -#~ msgstr "यहाँ आप उपयोग के लिए फ़ॉन्ट शैली चुन सकते हैं." - -#~ msgctxt "@item font" -#~ msgid "Italic" -#~ msgstr "ईटैलिक" - -#~ msgctxt "@item font" -#~ msgid "Oblique" -#~ msgstr "तिर्यक" - -#~ msgctxt "@item font" -#~ msgid "Bold" -#~ msgstr "गाढ़ा" - -#~ msgctxt "@item font" -#~ msgid "Bold Italic" -#~ msgstr "गाढ़ा तिरछा" - -#~ msgctxt "@item font size" -#~ msgid "Relative" -#~ msgstr "सापेक्ष" - -#~ msgid "Font size<br /><i>fixed</i> or <i>relative</i><br />to environment" -#~ msgstr "फ़ॉन्ट आकार<br /><i>स्थिर</i> या <i>सापेक्षिक</i><br />वातावरण से" - -#~ msgid "" -#~ "Here you can switch between fixed font size and font size to be " -#~ "calculated dynamically and adjusted to changing environment (e.g. widget " -#~ "dimensions, paper size)." -#~ msgstr "" -#~ "यहाँ आप स्थिर फ़ॉन्ट आकार तथा बदलते वातावरण (जैसे विजेट आकार, पृष्ठ आकार इत्यादि) के " -#~ "अनुसार गतिशीलता से गणन किए गए फ़ॉन्ट आकार में अदला-बदली कर सकते हैं. " - -#~ msgid "Here you can choose the font size to be used." -#~ msgstr "यहाँ आप उपयोग के लिए फ़ॉन्ट आकार चुन सकते हैं." - -#~ msgid "The Quick Brown Fox Jumps Over The Lazy Dog" -#~ msgstr "सारे जहाँ से अच्छा हिंदोस्ताँ हमारा" - -#~ msgid "" -#~ "This sample text illustrates the current settings. You may edit it to " -#~ "test special characters." -#~ msgstr "" -#~ "यह पाठ नमूना आपके मौज़ूदा विन्यास (सेटिंग) को स्पस्ट करता है. विशिष्ट अक्षरों को " -#~ "परीक्षित करने के लिए इसे आप संपादित कर सकते हैं." - -#~ msgid "Actual Font" -#~ msgstr "वास्तविक फ़ॉन्ट" - -#~ msgctxt "@item Font style" -#~ msgid "%1" -#~ msgstr "%1" - -#~ msgctxt "short" -#~ msgid "The Quick Brown Fox Jumps Over The Lazy Dog" -#~ msgstr "इंडलिनक्स केडीई हिन्दी टोली" - -#~ msgctxt "Numeric IDs of scripts for font previews" -#~ msgid "1" -#~ msgstr "1" - -#~ msgid "Select Font" -#~ msgstr "फ़ॉन्ट चुनें" - -#~ msgid "Choose..." -#~ msgstr "चुनें..." - -#~ msgid "Click to select a font" -#~ msgstr "फ़ॉन्ट चुनने के लिए क्लिक करें" - -#~ msgid "Preview of the selected font" -#~ msgstr "चुने गए फ़ॉन्ट का पूर्वावलोकन करें" - -#~ msgid "" -#~ "This is a preview of the selected font. You can change it by clicking the " -#~ "\"Choose...\" button." -#~ msgstr "" -#~ "यह चुने गए फ़ॉन्ट का पूर्वावलोकन है. आप इसे \"चुनें...\" बटन के द्वारा बदल सकते हैं." - -#~ msgid "Preview of the \"%1\" font" -#~ msgstr "फ़ॉन्ट \"%1\" का पूर्वावलोकन" - -#~ msgid "" -#~ "This is a preview of the \"%1\" font. You can change it by clicking the " -#~ "\"Choose...\" button." -#~ msgstr "" -#~ "यह फ़ॉन्ट \"%1\" का पूर्वावलोकन है. आप इसे \"चुनें...\" बटन के द्वारा बदल सकते हैं." - -#~ msgid "Search" -#~ msgstr "ढूंढें" - -#~ msgid "Stop" -#~ msgstr "रूकें" - -#~ msgid " Stalled " -#~ msgstr "रुका हुआ" - -#~ msgid " %1/s " -#~ msgstr " %1/s " - -#~ msgctxt "%1 is the label, we add a ':' to it" -#~ msgid "%1:" -#~ msgstr "%1:" - -#~ msgid "%2 of %3 complete" -#~ msgid_plural "%2 of %3 complete" -#~ msgstr[0] "%3 पूर्ण, इसमें सेः %2 " -#~ msgstr[1] "%3 पूर्ण, इसमें सेः %2 " - -#~ msgid "%2 / %1 folder" -#~ msgid_plural "%2 / %1 folders" -#~ msgstr[0] "%2 / %1 फ़ोल्डर" -#~ msgstr[1] "%2 / %1 फ़ोल्डर्स" - -#~ msgid "%2 / %1 file" -#~ msgid_plural "%2 / %1 files" -#~ msgstr[0] "%2 / %1 फ़ाइल" -#~ msgstr[1] "%2 / %1 फ़ाइलें" - -#~ msgid "%1% of %2" -#~ msgstr "%2 में से %1 %" - -#~ msgid "%2% of 1 file" -#~ msgid_plural "%2% of %1 files" -#~ msgstr[0] "%2 % में से 1 फ़ाइल" -#~ msgstr[1] "%2 % में से %1 फ़ाइलें" - -#~ msgid "%1%" -#~ msgstr "%1%" - -#~ msgid "Stalled" -#~ msgstr "रुका हुआ" - -#~ msgid "%2/s (%3 remaining)" -#~ msgid_plural "%2/s (%3 remaining)" -#~ msgstr[0] "%2/s ( %3 बचा है )" -#~ msgstr[1] "%2/s ( %3 बचा है )" - -#~ msgctxt "speed in bytes per second" -#~ msgid "%1/s" -#~ msgstr " %1/s " - -#~ msgid "%1/s (done)" -#~ msgstr "%1/s (सम्पन्न)" - -#~ msgid "&Resume" -#~ msgstr "पुनरारंभ (&R)" - -#~ msgid "&Pause" -#~ msgstr "ठहरें (&P)" - -#~ msgctxt "The source url of a job" -#~ msgid "Source:" -#~ msgstr "स्रोत:" - -#~ msgctxt "The destination url of a job" -#~ msgid "Destination:" -#~ msgstr "गंतव्य:" - -#~ msgid "&Keep this window open after transfer is complete" -#~ msgstr "हस्तांतरण पूरा होने के बाद इस विंडो को खुला रखें. (&K)" - -#~ msgid "Open &File" -#~ msgstr "फ़ाइल खोलें (&F)" - -#~ msgid "Open &Destination" -#~ msgstr "गंतव्य खोलें (&D)" - -#~ msgid "Progress Dialog" -#~ msgstr "प्रगति संवाद " - -#~ msgid "%1 folder" -#~ msgid_plural "%1 folders" -#~ msgstr[0] "%1 फ़ोल्डर" -#~ msgstr[1] "%1 फ़ोल्डर्स" - -#~ msgid "%1 file" -#~ msgid_plural "%1 files" -#~ msgstr[0] "%1 फ़ाइल" -#~ msgstr[1] "%1 फ़ाइलें" - -#~ msgid "The style '%1' was not found" -#~ msgstr "शैली '%1' नहीं मिली" - -#~ msgid "Do not run in the background." -#~ msgstr "पृष्ठ भूमि में नहीं चलाएँ." - -#~ msgid "Internally added if launched from Finder" -#~ msgstr "यदि फ़ाइंडर के द्वारा चालू किया जाता है तो आंतरिक रूप से जोड़ा गया" - -#~ msgid "Unknown Application" -#~ msgstr "अज्ञात अनुप्रयोग" - -#~ msgid "&Minimize" -#~ msgstr "न्यूनतम (&M)" - -#~ msgid "&Restore" -#~ msgstr "बहाल करें (&R)" - -#~ msgid "<qt>Are you sure you want to quit <b>%1</b>?</qt>" -#~ msgstr "<qt>क्या आप सुनिश्चित हैं कि आप <b>%1</b> से बाहर जाना चाहते हैं?</qt>" - -#~ msgid "Confirm Quit From System Tray" -#~ msgstr "तंत्र तश्तरी से बाहर जाने की पुष्टि करें" - -#~ msgid "Minimize" -#~ msgstr "न्यूनतम " - -#~ msgctxt "@title:window" -#~ msgid "Dr. Klash' Accelerator Diagnosis" -#~ msgstr "डा. क्लॉश का त्वरक निदान" - -#~ msgctxt "@option:check" -#~ msgid "Disable automatic checking" -#~ msgstr "स्वचलित जांच अक्षम करें" - -#~ msgctxt "@action:button" -#~ msgid "Close" -#~ msgstr "बंद करें" - -#~ msgid "<h2>Accelerators changed</h2>" -#~ msgstr "<h2>त्वरक बदला</h2>" - -#~ msgid "<h2>Accelerators removed</h2>" -#~ msgstr "<h2>उत्प्रेरक मिटाए गए</h2>" - -#~ msgid "<h2>Accelerators added (just for your info)</h2>" -#~ msgstr "<h2>त्वरक जोड़ा (सिर्फ आपकी जानकारी के लिए)</h2>" - -#~ msgctxt "left mouse button" -#~ msgid "left button" -#~ msgstr "बायाँ बटनः" - -#~ msgctxt "middle mouse button" -#~ msgid "middle button" -#~ msgstr "मध्य बटनः" - -#~ msgctxt "right mouse button" -#~ msgid "right button" -#~ msgstr "दायाँ बटनः" - -#~ msgctxt "a nonexistent value of mouse button" -#~ msgid "invalid button" -#~ msgstr "अवैध बटन" - -#~ msgctxt "" -#~ "a kind of mouse gesture: hold down one mouse button, then press another " -#~ "button" -#~ msgid "Hold %1, then push %2" -#~ msgstr "होल्ड %1, फिर पुश करें %2" - -#~ msgid "Conflict with Global Shortcut" -#~ msgstr "ग्लोबल शॉर्टकट के परस्पर विरोध में है" - -#~ msgid "" -#~ "The '%1' key combination has already been allocated to the global action " -#~ "\"%2\" in %3.\n" -#~ "Do you want to reassign it from that action to the current one?" -#~ msgstr "" -#~ "कुंजी '%1' संयोजन पहले से ही \"%2\" वैश्विक क्रिया के लिए %3 में सम्बद्ध है.\n" -#~ "क्या आप इसे मौज़ूदा क्रिया से फिर से सम्बद्ध करना चाहते हैं?" - -#~ msgid "Conflict With Registered Global Shortcut" -#~ msgstr "पंजीकृत ग्लोबल शॉर्टकट से विरोध है" - -#~ msgctxt "@action" -#~ msgid "Open" -#~ msgstr "खोलें" - -#~ msgctxt "@action" -#~ msgid "New" -#~ msgstr "नया" - -#~ msgctxt "@action" -#~ msgid "Close" -#~ msgstr "बंद करें" - -#~ msgctxt "@action" -#~ msgid "Save" -#~ msgstr "सहेजें" - -#~ msgctxt "@action" -#~ msgid "Print" -#~ msgstr "छापें" - -#~ msgctxt "@action" -#~ msgid "Quit" -#~ msgstr "बाहर जाएँ" - -#~ msgctxt "@action" -#~ msgid "Undo" -#~ msgstr "पहले जैसा" - -#~ msgctxt "@action" -#~ msgid "Redo" -#~ msgstr "दोहराएँ" - -#~ msgctxt "@action" -#~ msgid "Cut" -#~ msgstr "काटें" - -#~ msgctxt "@action" -#~ msgid "Copy" -#~ msgstr "नक़ल" - -#~ msgctxt "@action" -#~ msgid "Paste" -#~ msgstr "चिपकाएँ" - -#~ msgctxt "@action" -#~ msgid "Paste Selection" -#~ msgstr "चयन चिपकाएँ" - -#~ msgctxt "@action" -#~ msgid "Select All" -#~ msgstr "सभी का चयन करें" - -#~ msgctxt "@action" -#~ msgid "Deselect" -#~ msgstr "अचयनित" - -#~ msgctxt "@action" -#~ msgid "Delete Word Backwards" -#~ msgstr "शब्द पीछे से मिटाएँ" - -#~ msgctxt "@action" -#~ msgid "Delete Word Forward" -#~ msgstr "शब्द सामने से मिटाएँ" - -#~ msgctxt "@action" -#~ msgid "Find" -#~ msgstr "ढूंढें" - -#~ msgctxt "@action" -#~ msgid "Find Next" -#~ msgstr "अगला ढूंढें" - -#~ msgctxt "@action" -#~ msgid "Find Prev" -#~ msgstr "पिछला ढूंढें" - -#~ msgctxt "@action" -#~ msgid "Replace" -#~ msgstr "बदलें" - -#~ msgctxt "@action Go to main page" -#~ msgid "Home" -#~ msgstr "मुख पृष्ठ" - -#~ msgctxt "@action Beginning of document" -#~ msgid "Begin" -#~ msgstr "आरंभ" - -#~ msgctxt "@action End of document" -#~ msgid "End" -#~ msgstr "अंत" - -#~ msgctxt "@action" -#~ msgid "Prior" -#~ msgstr "पिछला" - -#~ msgctxt "@action Opposite to Prior" -#~ msgid "Next" -#~ msgstr "अगला" - -#~ msgctxt "@action" -#~ msgid "Up" -#~ msgstr "ऊपर" - -#~ msgctxt "@action" -#~ msgid "Back" -#~ msgstr "पीछे" - -#~ msgctxt "@action" -#~ msgid "Forward" -#~ msgstr "आगे" - -#~ msgctxt "@action" -#~ msgid "Reload" -#~ msgstr "री-लोड" - -#~ msgctxt "@action" -#~ msgid "Beginning of Line" -#~ msgstr "पंक्ति की शुरूआत" - -#~ msgctxt "@action" -#~ msgid "End of Line" -#~ msgstr "पंक्ति का अंत" - -#~ msgctxt "@action" -#~ msgid "Go to Line" -#~ msgstr "पंक्ति पर जाएँ" - -#~ msgctxt "@action" -#~ msgid "Backward Word" -#~ msgstr "पीछे का शब्द" - -#~ msgctxt "@action" -#~ msgid "Forward Word" -#~ msgstr "आगे का शब्द" - -#~ msgctxt "@action" -#~ msgid "Add Bookmark" -#~ msgstr " पसंदीदा जोड़ें" - -#~ msgctxt "@action" -#~ msgid "Zoom In" -#~ msgstr "ज़ूम इन" - -#~ msgctxt "@action" -#~ msgid "Zoom Out" -#~ msgstr "ज़ूम आउट" - -#~ msgctxt "@action" -#~ msgid "Full Screen Mode" -#~ msgstr "पूर्ण स्क्रीन मोड" - -#~ msgctxt "@action" -#~ msgid "Show Menu Bar" -#~ msgstr "मेन्यूपट्टी दिखाएँ" - -#~ msgctxt "@action" -#~ msgid "Activate Next Tab" -#~ msgstr "अगला टैब सक्रिय करें" - -#~ msgctxt "@action" -#~ msgid "Activate Previous Tab" -#~ msgstr "पिछला टैब सक्रिय करें" - -#~ msgctxt "@action" -#~ msgid "Help" -#~ msgstr "मदद" - -#~ msgctxt "@action" -#~ msgid "What's This" -#~ msgstr "यह क्या है" - -#~ msgctxt "@action" -#~ msgid "Text Completion" -#~ msgstr "पाठ पूर्णता" - -#~ msgctxt "@action" -#~ msgid "Previous Completion Match" -#~ msgstr "पिछली पूर्णता का जोड़ा" - -#~ msgctxt "@action" -#~ msgid "Next Completion Match" -#~ msgstr "अगली पूर्णता का जोड़ा" - -#~ msgctxt "@action" -#~ msgid "Substring Completion" -#~ msgstr "सबस्ट्रिंग कम्पलीशन" - -#~ msgctxt "@action" -#~ msgid "Previous Item in List" -#~ msgstr "सूची में पिछली वस्तु" - -#~ msgctxt "@action" -#~ msgid "Next Item in List" -#~ msgstr "सूची में अगली वस्तु" - -#~ msgctxt "@action" -#~ msgid "Open Recent" -#~ msgstr "हालिया खोलें" - -#~ msgctxt "@action" -#~ msgid "Save As" -#~ msgstr "ऐसे सहेजें" - -#~ msgctxt "@action" -#~ msgid "Revert" -#~ msgstr "लौटें" - -#~ msgctxt "@action" -#~ msgid "Print Preview" -#~ msgstr "छपाई नमूना" - -#~ msgctxt "@action" -#~ msgid "Mail" -#~ msgstr "डाक" - -#~ msgctxt "@action" -#~ msgid "Clear" -#~ msgstr "साफ करें" - -#~ msgctxt "@action" -#~ msgid "Actual Size" -#~ msgstr "वास्तविक आकार" - -#~ msgctxt "@action" -#~ msgid "Fit To Page" -#~ msgstr "पृष्ठ के अनुरूप" - -#~ msgctxt "@action" -#~ msgid "Fit To Width" -#~ msgstr "पृष्ट चोडाई के अनुरूप" - -#~ msgctxt "@action" -#~ msgid "Fit To Height" -#~ msgstr "ऊँचाई के अनुरूप" - -#~ msgctxt "@action" -#~ msgid "Zoom" -#~ msgstr "ज़ूम इन" - -#~ msgctxt "@action" -#~ msgid "Goto" -#~ msgstr "पर जाएँ" - -#~ msgctxt "@action" -#~ msgid "Goto Page" -#~ msgstr "पृष्ठ पर जाएं" - -#~ msgctxt "@action" -#~ msgid "Document Back" -#~ msgstr "दस्तावेज़ पिछे" - -#~ msgctxt "@action" -#~ msgid "Document Forward" -#~ msgstr "दस्तावेज़ आगे" - -#~ msgctxt "@action" -#~ msgid "Edit Bookmarks" -#~ msgstr "पसंदीदा का संपादन करें" - -#~ msgctxt "@action" -#~ msgid "Spelling" -#~ msgstr "वर्तनी" - -#~ msgctxt "@action" -#~ msgid "Show Toolbar" -#~ msgstr "औज़ार पट्टी दिखाएँ" - -#~ msgctxt "@action" -#~ msgid "Show Statusbar" -#~ msgstr "स्थिति पट्टी दिखाएँ" - -#~ msgctxt "@action" -#~ msgid "Save Options" -#~ msgstr "विकल्प सहेजें" - -#~ msgctxt "@action" -#~ msgid "Key Bindings" -#~ msgstr "कुंजी बंधन" - -#~ msgctxt "@action" -#~ msgid "Preferences" -#~ msgstr "संदर्भ" - -#~ msgctxt "@action" -#~ msgid "Configure Toolbars" -#~ msgstr "औज़ार पट्टियाँ कॉन्फ़िगर करें" - -#~ msgctxt "@action" -#~ msgid "Configure Notifications" -#~ msgstr "सूचनाएँ कॉन्फ़िगर करें" - -#~ msgctxt "@action" -#~ msgid "Tip Of Day" -#~ msgstr "आज का नुस्ख़ा" - -#~ msgctxt "@action" -#~ msgid "Report Bug" -#~ msgstr "बग रिपोर्ट करें" - -#~ msgctxt "@action" -#~ msgid "Switch Application Language" -#~ msgstr "अनुप्रयोग भाषा स्विच करें" - -#~ msgctxt "@action" -#~ msgid "About Application" -#~ msgstr "अनुप्रयोग के बारे में" - -#~ msgctxt "@action" -#~ msgid "About KDE" -#~ msgstr "केडीई के बारे में" - -#~ msgid "Spell Checking Configuration" -#~ msgstr "वर्तनी जांच कॉन्फ़िगरेशन" - -#~ msgid "Enable &background spellchecking" -#~ msgstr "पृष्ठभूमि में वर्तनी जाँच सक्षम करें (&b)" - -#~ msgid "&Automatic spell checking enabled by default" -#~ msgstr "स्वतः वर्तनी जांच सक्षम (&A)" - -#~ msgid "Skip all &uppercase words" -#~ msgstr "सभी अपरकेस शब्दों को छोड़ें (&u)" - -#~ msgid "S&kip run-together words" -#~ msgstr "एक साथ लिखे शब्दों को छोड़ें (&k)" - -#~ msgid "Default language:" -#~ msgstr "डिफ़ॉल्ट भाषाः" - -#~ msgid "Ignored Words" -#~ msgstr "नज़रअंदाज़ शब्द" - -#~ msgctxt "@title:window" -#~ msgid "Check Spelling" -#~ msgstr "वर्तनी जांचें" - -#~ msgctxt "@action:button" -#~ msgid "&Finished" -#~ msgstr "पूर्ण (&F)" - -#~ msgctxt "progress label" -#~ msgid "Spell checking in progress..." -#~ msgstr "वर्तनी जांच जारी है..." - -#~ msgid "Spell check stopped." -#~ msgstr "वर्तनी जांच बन्द है." - -#~ msgid "Spell check canceled." -#~ msgstr "वर्तनी जाँच रद्द." - -#~ msgid "Spell check complete." -#~ msgstr "वर्तनी जांच सम्पन्न." - -#~ msgid "Autocorrect" -#~ msgstr "स्वचालित-सुधार" - -#~ msgid "" -#~ "You reached the end of the list\n" -#~ "of matching items.\n" -#~ msgstr "" -#~ "आप उस सूची के अंत में आ पहुँचे हैं\n" -#~ " जिसमें मैचिंग वस्तुएँ हैं.\n" - -#~ msgid "" -#~ "The completion is ambiguous, more than one\n" -#~ "match is available.\n" -#~ msgstr "" -#~ "कम्पलीशन अस्पस्ट है, एक से अधिक\n" -#~ "जोड़ उपलब्ध हैं.\n" - -#~ msgid "There is no matching item available.\n" -#~ msgstr "वहाँ कोई मेल खाती वस्तुएँ उपलब्ध नहीं हैं.\n" - -#~ msgid "Backspace" -#~ msgstr "बैक-स्पेस" - -#~ msgid "SysReq" -#~ msgstr "सिस-रेक्" - -#~ msgid "CapsLock" -#~ msgstr "केप्स-लॉक" - -#~ msgid "NumLock" -#~ msgstr "न्यूम-लॉक" - -#~ msgid "ScrollLock" -#~ msgstr "स्क्रॉल-लॉक" - -#~ msgid "PageUp" -#~ msgstr "पेज-अप" - -#~ msgid "PageDown" -#~ msgstr "पेज-डाउन" - -#~ msgid "Again" -#~ msgstr "पुन: " - -#~ msgid "Props" -#~ msgstr "प्रॉप्स" - -#~ msgid "Undo" -#~ msgstr "पहले जैसा" - -#~ msgid "Front" -#~ msgstr "अग्र भाग" - -#~ msgid "Copy" -#~ msgstr "नक़ल" - -#~ msgid "Open" -#~ msgstr "खोलें" - -#~ msgid "Paste" -#~ msgstr "चिपकाएँ" - -#~ msgid "Find" -#~ msgstr "ढूंढें" - -#~ msgid "Cut" -#~ msgstr "काटें" - -#~ msgid "&OK" -#~ msgstr "ठीक (&O)" - -#~ msgid "&Cancel" -#~ msgstr "रद्द करें (&C)" - -#~ msgid "&Yes" -#~ msgstr "हाँ (&Y)" - -#~ msgid "Yes" -#~ msgstr "हाँ" - -#~ msgid "&No" -#~ msgstr "नहीं (&N)" - -#~ msgid "No" -#~ msgstr "नहीं" - -#~ msgid "&Discard" -#~ msgstr "फेंकें (&D)" - -#~ msgid "Discard changes" -#~ msgstr "परिवर्तन फेंक दें" - -#~ msgid "" -#~ "Pressing this button will discard all recent changes made in this dialog." -#~ msgstr "इस बटन को दबाने पर इस संवाद में किए गए सभी हालिया परिवर्तन रद्द हो जाएंगे" - -#~ msgid "Save data" -#~ msgstr "डाटा सहेजें" - -#~ msgid "&Do Not Save" -#~ msgstr "सहेजें नहीं (&D)" - -#~ msgid "Do not save data" -#~ msgstr "डाटा सहेजें नहीं" - -#~ msgid "Save file with another name" -#~ msgstr "फ़ाइल अन्य नाम के साथ सहेजें" - -#~ msgid "&Apply" -#~ msgstr "लागू करें (&A)" - -#~ msgid "Apply changes" -#~ msgstr "परिवर्तन लागू करें" - -#~ msgid "" -#~ "When you click <b>Apply</b>, the settings will be handed over to the " -#~ "program, but the dialog will not be closed.\n" -#~ "Use this to try different settings." -#~ msgstr "" -#~ "जब <b>लागू करें</b> पर क्लिक करते हैं, विन्यास प्रोग्राम को हस्तांतरित हो जाता है, पर " -#~ "संवाद बन्द नहीं होगा.\n" -#~ "इसका उपयोग भिन्न विन्यास को आजमाने के लिए कर सकते हैं." - -#~ msgid "Administrator &Mode..." -#~ msgstr "प्रशासक मोड... (&M)" - -#~ msgid "Enter Administrator Mode" -#~ msgstr "प्रशासक मोड में प्रविष्ट" - -#~ msgid "Clear input" -#~ msgstr "इनपुट साफ करें" - -#~ msgid "Clear the input in the edit field" -#~ msgstr "एडिट फील्ड के इनपुट को साफ करें" - -#~ msgid "Show help" -#~ msgstr "मदद दिखाएँ" - -#~ msgid "Close the current window or document" -#~ msgstr "मौज़ूदा विंडो या दस्तावेज़ बंद करें" - -#~ msgid "&Close Window" -#~ msgstr "विंडो बंद (&C)" - -#~ msgid "Close the current window." -#~ msgstr "मौज़ूदा विंडो बंद करें" - -#~ msgid "&Close Document" -#~ msgstr "दस्तावेज़ बन्द करें (&C)" - -#~ msgid "Close the current document." -#~ msgstr "मौज़ूदा दस्तावेज़ बंद करें" - -#~ msgid "&Defaults" -#~ msgstr "डिफ़ॉल्ट्स (&D)" - -#~ msgid "Reset all items to their default values" -#~ msgstr "सभी आइटम को उसके डिफ़ॉल्ट मान में सेट करें" - -#~ msgid "Go back one step" -#~ msgstr "एक कदम पीछे जाएं" - -#~ msgid "Go forward one step" -#~ msgstr "एक कदम आगे जाएं" - -#~ msgid "Opens the print dialog to print the current document" -#~ msgstr "मौज़ूदा दस्तावेज़ को मुद्रित करने के लिए छपाई संवाद खोलें" - -#~ msgid "C&ontinue" -#~ msgstr "जारी रखें (&o)" - -#~ msgid "Continue operation" -#~ msgstr "ऑपरेशन जारी रखें" - -#~ msgid "&Delete" -#~ msgstr "मिटाएँ (&D)" - -#~ msgid "Delete item(s)" -#~ msgstr "वस्तुएँ मिटाएँ" - -#~ msgid "Open file" -#~ msgstr "फ़ाइल खोलें" - -#~ msgid "&Reset" -#~ msgstr "रीसेट (&R)" - -#~ msgid "Reset configuration" -#~ msgstr "कॉन्फ़िगरेशन रीसेट करें" - -#~ msgctxt "Verb" -#~ msgid "&Insert" -#~ msgstr "प्रविष्ट (&I)" - -#~ msgid "Confi&gure..." -#~ msgstr "कॉन्फ़िगर... (&g)" - -#~ msgid "Add" -#~ msgstr "जोड़ें" - -#~ msgid "Test" -#~ msgstr "जांच" - -#~ msgid "Properties" -#~ msgstr "गुण" - -#~ msgid "&Overwrite" -#~ msgstr "मिटाकर लिखें (&O)" - -#~ msgid "Redo" -#~ msgstr "दोहराएँ" - -#~ msgid "&Available:" -#~ msgstr "उपलब्ध: (&A)" - -#~ msgid "&Selected:" -#~ msgstr "चुना गया: (&S)" - -#~ msgctxt "KCharSelect section name" -#~ msgid "European Alphabets" -#~ msgstr "यूरोपीय अक्षर" - -#~ msgctxt "KCharSelect section name" -#~ msgid "African Scripts" -#~ msgstr "अफ्रीकी स्क्रिप्ट्स" - -#~ msgctxt "KCharSelect section name" -#~ msgid "Middle Eastern Scripts" -#~ msgstr "मध्य पूर्वी स्क्रिप्ट" - -#~ msgctxt "KCharSelect section name" -#~ msgid "South Asian Scripts" -#~ msgstr "दक्षिण एशियाई स्क्रिप्ट" - -#~ msgctxt "KCharSelect section name" -#~ msgid "Philippine Scripts" -#~ msgstr "फिलीपीन स्क्रिप्ट्स" - -#~ msgctxt "KCharSelect section name" -#~ msgid "South East Asian Scripts" -#~ msgstr "दक्षिण-पूर्व एशियाई स्क्रिप्ट" - -#~ msgctxt "KCharSelect section name" -#~ msgid "East Asian Scripts" -#~ msgstr "पूर्व एशियाई स्क्रिप्ट" - -#~ msgctxt "KCharSelect section name" -#~ msgid "Central Asian Scripts" -#~ msgstr "मध्य एशियाई स्क्रिप्ट" - -#~ msgctxt "KCharSelect section name" -#~ msgid "Other Scripts" -#~ msgstr "अन्य स्क्रिप्ट्स" - -#~ msgctxt "KCharSelect section name" -#~ msgid "Symbols" -#~ msgstr "सिंबाल्स" - -#~ msgctxt "KCharSelect section name" -#~ msgid "Mathematical Symbols" -#~ msgstr "गणितीय चिह्न" - -#~ msgctxt "KCharSelect section name" -#~ msgid "Phonetic Symbols" -#~ msgstr "ध्वन्यात्मक चिह्न" - -#~ msgctxt "KCharSelect section name" -#~ msgid "Combining Diacritical Marks" -#~ msgstr "डायाक्रिटिकल निशान जोड़ा जा रहा है" - -#~ msgctxt "KCharSelect section name" -#~ msgid "Other" -#~ msgstr "अन्य" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Basic Latin" -#~ msgstr "मूल लातिन" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Latin-1 Supplement" -#~ msgstr "लातिन-1 संपूरक" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Latin Extended-A" -#~ msgstr "लातिन विस्तारित-अ" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Latin Extended-B" -#~ msgstr "लातिन विस्तारित-ब" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "IPA Extensions" -#~ msgstr "आइपीए विस्तारण" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Spacing Modifier Letters" -#~ msgstr "जगह परिवर्धक अक्षर" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Combining Diacritical Marks" -#~ msgstr "डायाक्रिटिकल निशान जोड़ा जा रहा है" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Greek and Coptic" -#~ msgstr "युनानी एवं कोप्टिक" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Cyrillic" -#~ msgstr "साइरिलिक" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Cyrillic Supplement" -#~ msgstr "साइरिलिक परिशिष्ट" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Armenian" -#~ msgstr "आर्मेनियाई" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Hebrew" -#~ msgstr "हिब्रू" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Arabic" -#~ msgstr "अरबी" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Syriac" -#~ msgstr "सीरियाक" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Arabic Supplement" -#~ msgstr "अरबी संपूरक" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Thaana" -#~ msgstr "थाना" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "NKo" -#~ msgstr "एनकेओ" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Samaritan" -#~ msgstr "सेमारितन" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Mandaic" -#~ msgstr "Mandaic" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Devanagari" -#~ msgstr "देवनागरी" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Bengali" -#~ msgstr "बंगाली" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Gurmukhi" -#~ msgstr "गुरूमुखी" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Gujarati" -#~ msgstr "गुजराती" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Oriya" -#~ msgstr "उड़िया" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Tamil" -#~ msgstr "तमिल" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Telugu" -#~ msgstr "तेलुगु" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Kannada" -#~ msgstr "कन्नड" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Malayalam" -#~ msgstr "मलयालम" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Sinhala" -#~ msgstr "सिंहला" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Thai" -#~ msgstr "थाई" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Lao" -#~ msgstr "लाओ" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Tibetan" -#~ msgstr "तिब्बती" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Myanmar" -#~ msgstr "म्यनमार" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Georgian" -#~ msgstr "ज्यॉर्जियाई" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Hangul Jamo" -#~ msgstr "हांगुल जामो" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Ethiopic" -#~ msgstr "इथियोपी" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Ethiopic Supplement" -#~ msgstr "इथियोपिक संपूरक" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Cherokee" -#~ msgstr "शेरॉकी" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Unified Canadian Aboriginal Syllabics" -#~ msgstr "यूनिफ़ाइड कनाडाई अबार्जिनल सिलेबिक्स" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Ogham" -#~ msgstr "ओघम" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Runic" -#~ msgstr "रूनिक" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Tagalog" -#~ msgstr "टागालोग" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Hanunoo" -#~ msgstr "हनुनू" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Buhid" -#~ msgstr "बुहीद" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Tagbanwa" -#~ msgstr "तागबांवा" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Khmer" -#~ msgstr "ख्मेर" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Mongolian" -#~ msgstr "मंगोलियन" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Unified Canadian Aboriginal Syllabics Extended" -#~ msgstr "यूनिफ़ाइड कनाडाई अबार्जिनल सिलेबिक्स विस्तृत" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Limbu" -#~ msgstr "लिंबु" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Tai Le" -#~ msgstr "ताइ ली" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "New Tai Lue" -#~ msgstr "नया ताई ल्यू" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Khmer Symbols" -#~ msgstr "ख्मेर चिह्न" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Buginese" -#~ msgstr "बगिनी" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Tai Tham" -#~ msgstr "ताई थाम" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Balinese" -#~ msgstr "बेलिनी" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Sundanese" -#~ msgstr "सूदानी" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Batak" -#~ msgstr "Batak" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Lepcha" -#~ msgstr "लेप्चा" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Ol Chiki" -#~ msgstr "ओल चिकी" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Vedic Extensions" -#~ msgstr "वैदिक विस्तारण" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Phonetic Extensions" -#~ msgstr "ध्वन्यात्मक विस्तारण" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Phonetic Extensions Supplement" -#~ msgstr "फ़ोनेटिक विस्तारण संपूरक" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Combining Diacritical Marks Supplement" -#~ msgstr "डायाक्रिटिकल मार्क्स संपूरक जोड़ा जा रहा है" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Latin Extended Additional" -#~ msgstr "लातिन विस्तारित अतिरिक्त" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Greek Extended" -#~ msgstr "युनानी विस्तारण" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "General Punctuation" -#~ msgstr "सामान्य विरामचिन्ह" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Superscripts and Subscripts" -#~ msgstr "सुपरस्क्रिप्ट्स तथा सबस्क्रिप्ट्स" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Currency Symbols" -#~ msgstr "मुद्रा चिह्न" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Combining Diacritical Marks for Symbols" -#~ msgstr "चिह्नों हेतु डायाक्रिटिकल मार्क्स जोड़ा जा रहा है" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Letterlike Symbols" -#~ msgstr "अक्षर जैसे चिह्न" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Number Forms" -#~ msgstr "संख्या रूप" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Arrows" -#~ msgstr "तीर" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Mathematical Operators" -#~ msgstr "गणितीय ऑपरेटर्स" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Miscellaneous Technical" -#~ msgstr "विविध तकनीकी" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Control Pictures" -#~ msgstr "नियंत्रक छवियाँ" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Optical Character Recognition" -#~ msgstr "ऑप्टिकल कैरेक्टर रिकग्नीशन" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Enclosed Alphanumerics" -#~ msgstr "संलग्न अल्फ़ान्यूमेरिक्स" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Box Drawing" -#~ msgstr "बॉक्स ड्राइंग" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Block Elements" -#~ msgstr "ब्लॉक तत्व" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Geometric Shapes" -#~ msgstr "ज्यामितीय आकार" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Miscellaneous Symbols" -#~ msgstr "विविध चिह्न" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Dingbats" -#~ msgstr "डिंगबेट्स" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Miscellaneous Mathematical Symbols-A" -#~ msgstr "विविध गणितीय चिह्न-ए" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Supplemental Arrows-A" -#~ msgstr "संपूरक तीर-ए" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Braille Patterns" -#~ msgstr "ब्रेल पैटर्न्स" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Supplemental Arrows-B" -#~ msgstr "संपूरक तीर-बी" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Miscellaneous Mathematical Symbols-B" -#~ msgstr "विविध गणितीय चिन्ह-बी" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Supplemental Mathematical Operators" -#~ msgstr "संपूरक गणितीय ऑपरेटर्स" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Miscellaneous Symbols and Arrows" -#~ msgstr "विविध चिह्न तथा तीर" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Glagolitic" -#~ msgstr "ग्लेगोलितिक" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Latin Extended-C" -#~ msgstr "लातिन विस्तारित-सी" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Coptic" -#~ msgstr "कोप्टिक" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Georgian Supplement" -#~ msgstr "ज्यार्जियाई परिशिष्ट" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Tifinagh" -#~ msgstr "टिफिनाग" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Ethiopic Extended" -#~ msgstr "इथियापिक विस्तारित" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Cyrillic Extended-A" -#~ msgstr "साइरिलिक विस्तारित-अ" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Supplemental Punctuation" -#~ msgstr "परिशिष्ट विरामचिन्ह" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "CJK Radicals Supplement" -#~ msgstr "सीजेके रेडिकल्स सप्लीमेंट" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Kangxi Radicals" -#~ msgstr "कांग्सी रेडिकल्स" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Ideographic Description Characters" -#~ msgstr "आइडियोग्राफिक वर्णन अक्षर" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "CJK Symbols and Punctuation" -#~ msgstr "सीजेके चिह्न तथा विरामचिह्न" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Hiragana" -#~ msgstr "हिरागाना" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Katakana" -#~ msgstr "काताकाना" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Bopomofo" -#~ msgstr "बोपोमोफो" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Hangul Compatibility Jamo" -#~ msgstr "हांगुल संगतता जामो" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Kanbun" -#~ msgstr "कानबुन" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Bopomofo Extended" -#~ msgstr "बोपोमोफो विस्तारण" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "CJK Strokes" -#~ msgstr "सीजेके स्ट्रोक्स" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Katakana Phonetic Extensions" -#~ msgstr "काताकाना फ़ोनेटिक विस्तारण" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Enclosed CJK Letters and Months" -#~ msgstr "सीजेके अक्षर तथा माह संलग्न" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "CJK Compatibility" -#~ msgstr "सीजेके संगतता" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "CJK Unified Ideographs Extension A" -#~ msgstr "सीजेके यूनिफ़ाइड आइडियोग्राफ़्स विस्तारक ए" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Yijing Hexagram Symbols" -#~ msgstr "यीजिंग हेक्साग्राम चिह्न" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "CJK Unified Ideographs" -#~ msgstr "सीजेके यूनिफ़ाइड आइडियोग्राफ्स" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Yi Syllables" -#~ msgstr "यी अक्षर" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Yi Radicals" -#~ msgstr "यी रेडिकल्स" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Lisu" -#~ msgstr "लिसू" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Vai" -#~ msgstr "वाइ" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Cyrillic Extended-B" -#~ msgstr "साइरिलिक विस्तारित-ब" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Bamum" -#~ msgstr "बमुम" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Modifier Tone Letters" -#~ msgstr "परिवर्धक टोन कुंजियाँ" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Latin Extended-D" -#~ msgstr "लातिन विस्तारित-डी" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Syloti Nagri" -#~ msgstr "सायलोती नागरी" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Common Indic Number Forms" -#~ msgstr "प्रचलित भारतीय संख्या रूप" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Phags-pa" -#~ msgstr "फाग्स-पा" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Saurashtra" -#~ msgstr "सोराष्ठ्र" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Devanagari Extended" -#~ msgstr "देवनागरी विस्तारित" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Kayah Li" -#~ msgstr "ख्या ली" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Rejang" -#~ msgstr "रेजाँग" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Hangul Jamo Extended-A" -#~ msgstr "हांगुल जोमो विस्तारित-अ" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Javanese" -#~ msgstr "जावानी" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Cham" -#~ msgstr "छाम" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Myanmar Extended-A" -#~ msgstr "म्यांमार विस्तारित-अ" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Tai Viet" -#~ msgstr "ताइ वेत" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Ethiopic Extended-A" -#~ msgstr "इथियापिक विस्तारित-A" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Meetei Mayek" -#~ msgstr "मीतेइ मयेक" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Hangul Syllables" -#~ msgstr "हांगुल सिलेबल्स" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Hangul Jamo Extended-B" -#~ msgstr "हांगुल जामो विस्तारित-ब" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "High Surrogates" -#~ msgstr "उच्च प्रतिनिधि" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "High Private Use Surrogates" -#~ msgstr "उच्च निजी उपयोग प्रतिनिधि" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Low Surrogates" -#~ msgstr "निम्न प्रतिनिधि" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Private Use Area" -#~ msgstr "निजी उपयोग का स्थान" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "CJK Compatibility Ideographs" -#~ msgstr "सीजेके संगतता आइडियोग्राफ्स" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Alphabetic Presentation Forms" -#~ msgstr "वर्णमाला प्रस्तुति फ़ॉर्म" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Arabic Presentation Forms-A" -#~ msgstr "अरबी प्रेज़ेन्टेशन फॉर्म्स-ए" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Variation Selectors" -#~ msgstr "वेरिएशन सलेक्टर्स" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Vertical Forms" -#~ msgstr "खड़ा फ़ॉर्म" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Combining Half Marks" -#~ msgstr "आधा चिन्हों को संयुक्त करना" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "CJK Compatibility Forms" -#~ msgstr "सीजेके संगतता फॉर्म्स" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Small Form Variants" -#~ msgstr "छोटा फॉर्म वेरिएन्ट्स" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Arabic Presentation Forms-B" -#~ msgstr "अरबी प्रेज़ेन्टेशन फॉर्म्स-बी" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Halfwidth and Fullwidth Forms" -#~ msgstr "अर्ध-चौड़ाई तथा पूर्ण-चौड़ाई रूप" - -#~ msgctxt "KCharselect unicode block name" -#~ msgid "Specials" -#~ msgstr "विशेष" - -#~ msgid "Enter a search term or character here" -#~ msgstr "ढूंढे जाने वाले वाक्यांश यहां भरें" - -#~ msgctxt "Goes to previous character" -#~ msgid "Previous in History" -#~ msgstr "इतिहास में पिछला" - -#~ msgid "Previous Character in History" -#~ msgstr "इतिहास में पिछला अक्षर" - -#~ msgctxt "Goes to next character" -#~ msgid "Next in History" -#~ msgstr "सूची में अगला" - -#~ msgid "Next Character in History" -#~ msgstr "इतिहास में अगला अक्षर" - -#~ msgid "Select a category" -#~ msgstr "एक वर्ग चुनें" - -#~ msgid "Select a block to be displayed" -#~ msgstr "दिखाने के लिए ब्लॉक चुनें" - -#~ msgid "Set font" -#~ msgstr "फ़ॉन्ट सेट करें" - -#~ msgid "Set font size" -#~ msgstr "फ़ॉन्ट आकार सेट करें" - -#~ msgid "Character:" -#~ msgstr "अक्षर:" - -#~ msgid "Name: " -#~ msgstr "नामः" - -#~ msgid "Annotations and Cross References" -#~ msgstr "एनोटेशन्स तथा क्रास रेफ़रेंसेज़" - -#~ msgid "Alias names:" -#~ msgstr "अलियास नामः" - -#~ msgid "Notes:" -#~ msgstr "टिप्पणियाँ:" - -#~ msgid "See also:" -#~ msgstr "यह भी देखें:" - -#~ msgid "Equivalents:" -#~ msgstr "समतुल्य:" - -#~ msgid "Approximate equivalents:" -#~ msgstr "सन्निकट समतुल्यता:" - -#~ msgid "CJK Ideograph Information" -#~ msgstr "सीजेके आइडियोग्राफ जानकारी" - -#~ msgid "Definition in English: " -#~ msgstr "अंग्रेजी में परिभाषा:" - -#~ msgid "Mandarin Pronunciation: " -#~ msgstr "केंटोनियाई उच्चारण:" - -#~ msgid "Cantonese Pronunciation: " -#~ msgstr "कैंटोनी उच्चारण:" - -#~ msgid "Japanese On Pronunciation: " -#~ msgstr "जापानी ऑन उच्चारण:" - -#~ msgid "Japanese Kun Pronunciation: " -#~ msgstr "जापानी कुन उच्चारण:" - -#~ msgid "Tang Pronunciation: " -#~ msgstr "टैंग उच्चारण:" - -#~ msgid "Korean Pronunciation: " -#~ msgstr "कोरियाई उच्चारण:" - -#~ msgid "General Character Properties" -#~ msgstr "सामान्य अक्षर गुण" - -#~ msgid "Block: " -#~ msgstr "ब्लॉक:" - -#~ msgid "Unicode category: " -#~ msgstr "यूनिकोड वर्गः" - -#~ msgid "Various Useful Representations" -#~ msgstr "विविध उपयोगी प्रतिनिधित्व" - -#~ msgid "UTF-8:" -#~ msgstr "यूटीएफ़-8:" - -#~ msgid "UTF-16: " -#~ msgstr "यूटीएफ़-16" - -#~ msgid "C octal escaped UTF-8: " -#~ msgstr "सी ऑक्टल एस्केप्ड यूटीएफ-8:" - -#~ msgid "XML decimal entity:" -#~ msgstr "एक्सएमएल दशमलव एंटिटी:" - -#~ msgid "Unicode code point:" -#~ msgstr "यूनिकोड कूटबिन्दु" - -#~ msgctxt "Character" -#~ msgid "In decimal:" -#~ msgstr "दशमलव में" - -#~ msgid "<Non Private Use High Surrogate>" -#~ msgstr "<गैक निजी उपयोग उच्च प्रतिनिधि >" - -#~ msgid "<Private Use High Surrogate>" -#~ msgstr "<निजी उपयोग उच्च प्रतिनिधि>" - -#~ msgid "<Low Surrogate>" -#~ msgstr "<कम प्रतिनिधि>" - -#~ msgid "<Private Use>" -#~ msgstr "<निजी उपयोग>" - -#~ msgid "<not assigned>" -#~ msgstr "<आबंटित नहीं>" - -#~ msgid "Non-printable" -#~ msgstr "छपाई योग्य नहीं" - -#~ msgid "Other, Control" -#~ msgstr "अन्य, नियंत्रण" - -#~ msgid "Other, Format" -#~ msgstr "अन्य, फ़ॉर्मेट" - -#~ msgid "Other, Not Assigned" -#~ msgstr "अन्य, आवंटित नहीं" - -#~ msgid "Other, Private Use" -#~ msgstr "अन्य, निज़ी उपयोग" - -#~ msgid "Other, Surrogate" -#~ msgstr "अन्य, प्रतिनिधि" - -#~ msgid "Letter, Lowercase" -#~ msgstr "अक्षर, छोटा केस" - -#~ msgid "Letter, Modifier" -#~ msgstr "अक्षर, परिवर्धक" - -#~ msgid "Letter, Other" -#~ msgstr "अक्षर, अन्य" - -#~ msgid "Letter, Titlecase" -#~ msgstr "अक्षर, शीर्षक केस" - -#~ msgid "Letter, Uppercase" -#~ msgstr "अक्षर, बडा केस" - -#~ msgid "Mark, Spacing Combining" -#~ msgstr "निशान, स्पेसिंग कम्बाइनिंग" - -#~ msgid "Mark, Enclosing" -#~ msgstr "निशान, एनक्लोज़िंग" - -#~ msgid "Mark, Non-Spacing" -#~ msgstr "निशान, नॉन-स्पेसिंग" - -#~ msgid "Number, Decimal Digit" -#~ msgstr "संख्या, दशमलव अंक" - -#~ msgid "Number, Letter" -#~ msgstr "संख्या, अक्षर" - -#~ msgid "Number, Other" -#~ msgstr "संख्या, अन्य" - -#~ msgid "Punctuation, Connector" -#~ msgstr "विरामचिह्न, कनेक्टर" - -#~ msgid "Punctuation, Dash" -#~ msgstr "विरामचिह्न, टूटी-रेखा" - -#~ msgid "Punctuation, Close" -#~ msgstr "विरामचिह्न, बन्द करें" - -#~ msgid "Punctuation, Final Quote" -#~ msgstr "विरामचिह्न, अंतिम संदेश" - -#~ msgid "Punctuation, Initial Quote" -#~ msgstr "विरामचिह्न, मूल संदेश" - -#~ msgid "Punctuation, Other" -#~ msgstr "विरामचिह्न, अन्य" - -#~ msgid "Punctuation, Open" -#~ msgstr "विरामचिह्न, खोलें" - -#~ msgid "Symbol, Currency" -#~ msgstr "निशान, मुद्रा" - -#~ msgid "Symbol, Modifier" -#~ msgstr "निशान, परिवर्धक" - -#~ msgid "Symbol, Math" -#~ msgstr "निशान, गणित" - -#~ msgid "Symbol, Other" -#~ msgstr "निशान, अन्य" - -#~ msgid "Separator, Line" -#~ msgstr "पृथक्कारक, पंक्ति" - -#~ msgid "Separator, Paragraph" -#~ msgstr "पृथक्कारक, अनुच्छेद" - -#~ msgid "Separator, Space" -#~ msgstr "पृथक्कारक, स्थान" - -#~ msgid "You are not allowed to save the configuration" -#~ msgstr "आपको कॉन्फ़िगरेशन सहेजने की अनुमति नहीं है" - -#~ msgctxt "@option next year" -#~ msgid "Next Year" -#~ msgstr "अगला वर्ष" - -#~ msgctxt "@option next month" -#~ msgid "Next Month" -#~ msgstr "अगला माह" - -#~ msgctxt "@option next week" -#~ msgid "Next Week" -#~ msgstr "अगले सप्ताह" - -#~ msgctxt "@option tomorrow" -#~ msgid "Tomorrow" -#~ msgstr "कल" - -#~ msgctxt "@option today" -#~ msgid "Today" -#~ msgstr "आज" - -#~ msgctxt "@option yesterday" -#~ msgid "Yesterday" -#~ msgstr "कल" - -#~ msgctxt "@option last week" -#~ msgid "Last Week" -#~ msgstr "पिछले सप्ताह" - -#~ msgctxt "@option last month" -#~ msgid "Last Month" -#~ msgstr "पिछले माह" - -#~ msgctxt "@option last year" -#~ msgid "Last Year" -#~ msgstr "पिछले वर्ष" - -#~ msgctxt "@option do not specify a date" -#~ msgid "No Date" -#~ msgstr "कोई तारीख़ नहीं" - -#~ msgctxt "@info" -#~ msgid "The date you entered is invalid" -#~ msgstr "जो तारीख़ आपने भरा है वह अवैध है" - -#~ msgctxt "@info" -#~ msgid "Date cannot be earlier than %1" -#~ msgstr "तारीख %1 से पहले का नहीं हो सकता" - -#~ msgctxt "@info" -#~ msgid "Date cannot be later than %1" -#~ msgstr "तारीख %1 से बाद का नहीं हो सकता" - -#~ msgid "Week %1" -#~ msgstr "सप्ताह %1" - -#~ msgid "Next year" -#~ msgstr "अगला वर्ष" - -#~ msgid "Previous year" -#~ msgstr "पिछला वर्ष " - -#~ msgid "Next month" -#~ msgstr "अगला माह" - -#~ msgid "Previous month" -#~ msgstr "पिछला माह" - -#~ msgid "Select a week" -#~ msgstr "सप्ताह चुनें" - -#~ msgid "Select a month" -#~ msgstr "माह चुनें" - -#~ msgid "Select a year" -#~ msgstr "वर्ष चुनें" - -#~ msgid "Select the current day" -#~ msgstr "मौज़ूदा दिन चयन करें" - -#~ msgctxt "UTC time zone" -#~ msgid "UTC" -#~ msgstr "UTC" - -#~ msgctxt "No specific time zone" -#~ msgid "Floating" -#~ msgstr "फ्लोटिंग" - -#~ msgid "&Add" -#~ msgstr "जोड़ें (&A)" - -#~ msgid "&Remove" -#~ msgstr "मिटाएँ (&R)" - -#~ msgid "Move &Up" -#~ msgstr "ऊपर जाएं (&U)" - -#~ msgid "Move &Down" -#~ msgstr "नीचे जाएं (&D)" - -#~ msgid "&Help" -#~ msgstr "मदद (&H)" - -#~ msgid "Clear &History" -#~ msgstr "इतिहास साफ करें (&H)" - -#~ msgid "No further items in the history." -#~ msgstr "इतिहास में कोई अन्य वस्तु नहीं." - -#~ msgctxt "%1 is the number of shortcuts with which there is a conflict" -#~ msgid "Conflict with Registered Global Shortcut" -#~ msgid_plural "Conflict with Registered Global Shortcuts" -#~ msgstr[0] "ग्लोबल शॉर्टकट के परस्पर विरोध में है" -#~ msgstr[1] "ग्लोबल शॉर्टकटस के परस्पर विरोध में है" - -#~ msgctxt "%1 is the number of conflicts" -#~ msgid "Shortcut Conflict" -#~ msgid_plural "Shortcut Conflicts" -#~ msgstr[0] "शॉर्टकट कॉन्फ्लिक्ट" -#~ msgstr[1] "शॉर्टकट कॉन्फ्लिक्ट" - -#~ msgid "Shortcut '%1' for action '%2'\n" -#~ msgstr "क्रिया '%2' के लिए शॉर्टकट्स '%1'\n" - -#~ msgid "Shortcut conflict" -#~ msgstr "शॉर्टकट कॉन्फ्लिक्ट" - -#~ msgid "" -#~ "<qt>The '%1' key combination is already used by the <b>%2</b> action." -#~ "<br>Please select a different one.</qt>" -#~ msgstr "" -#~ "<qt>कुंजी कॉम्बीनेशन '%1' पहले से ही क्रिया <b>%2</b> द्वारा इस्तेमाल में है.<br>कृपया " -#~ "कोई नया चुनें.</qt>" - -#~ msgid "Reserved Shortcut" -#~ msgstr "आरक्षित शॉर्टकट" - -#~ msgid "Conflict with Standard Application Shortcut" -#~ msgstr "प्रामाणिक अनुप्रयोग शॉर्टकट के परस्पर विरोध में है" - -#~ msgid "" -#~ "The '%1' key combination is also used for the standard action \"%2\" that " -#~ "some applications use.\n" -#~ "Do you really want to use it as a global shortcut as well?" -#~ msgstr "" -#~ "कुंजी '%1' संयोजन पहले से ही \"%2\" मानक क्रिया के लिए सम्बद्ध है जो कुछ अनुप्रयोगों में " -#~ "इस्तेमाल किया जाता है.\n" -#~ "क्या आप इसे वैश्विक शॉर्टकट के रूप में भी सम्बद्ध करना चाहते हैं?" - -#~ msgctxt "What the user inputs now will be taken as the new shortcut" -#~ msgid "Input" -#~ msgstr "इनपुट" - -#~ msgid "The key you just pressed is not supported by Qt." -#~ msgstr "जो कुँजी आपने दबाई वह Qt द्वारा समर्थित नहीं है" - -#~ msgid "Unsupported Key" -#~ msgstr "असमर्थित कुँजी" - -#~ msgid "without name" -#~ msgstr "नाम के बगैर" - -#~ msgctxt "Italic placeholder text in line edits: 0 no, 1 yes" -#~ msgid "1" -#~ msgstr "1" - -#~ msgctxt "@action:button Clear current text in the line edit" -#~ msgid "Clear text" -#~ msgstr "पाठ साफ करें" - -#~ msgctxt "@title:menu" -#~ msgid "Text Completion" -#~ msgstr "पाठ पूर्णता" - -#~ msgctxt "@item:inmenu Text Completion" -#~ msgid "None" -#~ msgstr "कुछ नहीं" - -#~ msgctxt "@item:inmenu Text Completion" -#~ msgid "Manual" -#~ msgstr "हस्तचालित" - -#~ msgctxt "@item:inmenu Text Completion" -#~ msgid "Automatic" -#~ msgstr "स्वचलित" - -#~ msgctxt "@item:inmenu Text Completion" -#~ msgid "Dropdown List" -#~ msgstr "ड्रापडाउन सूची" - -#~ msgctxt "@item:inmenu Text Completion" -#~ msgid "Short Automatic" -#~ msgstr "स्वचलित छांटें" - -#~ msgctxt "@item:inmenu Text Completion" -#~ msgid "Dropdown List && Automatic" -#~ msgstr "ड्रापडाउन सूची स्वचलित (&&)" - -#~ msgctxt "@item:inmenu Text Completion" -#~ msgid "Default" -#~ msgstr "डिफ़ॉल्ट" - -#~ msgid "Image Operations" -#~ msgstr "छवि ऑपरेशन्स" - -#~ msgid "&Rotate Clockwise" -#~ msgstr "घड़ी की दिशा में घुमाएँ (&R)" - -#~ msgid "Rotate &Counterclockwise" -#~ msgstr "घड़ी की विपरीत दिशा में घुमाएँ (&C)" - -#~ msgctxt "@action" -#~ msgid "Text &Color..." -#~ msgstr "पाठ रंग... (&C)" - -#~ msgctxt "@label stroke color" -#~ msgid "Color" -#~ msgstr "रंग" - -#~ msgctxt "@action" -#~ msgid "Text &Highlight..." -#~ msgstr "पाठ उभारें... (&H)" - -#~ msgctxt "@action" -#~ msgid "&Font" -#~ msgstr "फ़ॉन्ट (&F)" - -#~ msgctxt "@action" -#~ msgid "Font &Size" -#~ msgstr "फ़ॉन्ट आकार (&S)" - -#~ msgctxt "@action boldify selected text" -#~ msgid "&Bold" -#~ msgstr "गाढ़ा (&B)" - -#~ msgctxt "@action italicize selected text" -#~ msgid "&Italic" -#~ msgstr "तिरछा (&I)" - -#~ msgctxt "@action underline selected text" -#~ msgid "&Underline" -#~ msgstr "रेखांकित (&U)" - -#~ msgctxt "@action" -#~ msgid "&Strike Out" -#~ msgstr "लिखकर काटें (&S)" - -#~ msgctxt "@action" -#~ msgid "Align &Left" -#~ msgstr "क्रमबद्ध बायाँ (&L)" - -#~ msgctxt "@label left justify" -#~ msgid "Left" -#~ msgstr "बायाँ" - -#~ msgctxt "@action" -#~ msgid "Align &Center" -#~ msgstr "क्रमबद्ध बीच में (&C)" - -#~ msgctxt "@label center justify" -#~ msgid "Center" -#~ msgstr "बीचों बीच" - -#~ msgctxt "@action" -#~ msgid "Align &Right" -#~ msgstr "क्रमबद्ध दायाँ (&R)" - -#~ msgctxt "@label right justify" -#~ msgid "Right" -#~ msgstr "दायाँ" - -#~ msgctxt "@action" -#~ msgid "&Justify" -#~ msgstr "समान रुप से दाएँ-बाएँ (&J)" - -#~ msgctxt "@label justify fill" -#~ msgid "Justify" -#~ msgstr "समान रुप से दाएँ-बाएँ" - -#~ msgctxt "@action" -#~ msgid "Left-to-Right" -#~ msgstr "बाएँ से दाएँ" - -#~ msgctxt "@label left-to-right" -#~ msgid "Left-to-Right" -#~ msgstr "बाएँ से दाएँ" - -#~ msgctxt "@action" -#~ msgid "Right-to-Left" -#~ msgstr "दाहिने से बांयें" - -#~ msgctxt "@label right-to-left" -#~ msgid "Right-to-Left" -#~ msgstr "दाहिने से बांयें" - -#~ msgctxt "@title:menu" -#~ msgid "List Style" -#~ msgstr "सूची शैली" - -#~ msgctxt "@item:inmenu no list style" -#~ msgid "None" -#~ msgstr "कुछ नहीं" - -#~ msgctxt "@item:inmenu disc list style" -#~ msgid "Disc" -#~ msgstr "डिस्क" - -#~ msgctxt "@item:inmenu circle list style" -#~ msgid "Circle" -#~ msgstr "वृत्त" - -#~ msgctxt "@item:inmenu square list style" -#~ msgid "Square" -#~ msgstr "वर्ग" - -#~ msgctxt "@item:inmenu numbered lists" -#~ msgid "123" -#~ msgstr "123" - -#~ msgctxt "@item:inmenu lowercase abc lists" -#~ msgid "abc" -#~ msgstr "abc" - -#~ msgctxt "@item:inmenu uppercase abc lists" -#~ msgid "ABC" -#~ msgstr "ABC" - -#~ msgctxt "@action" -#~ msgid "Increase Indent" -#~ msgstr "हाशिया बढ़ाएँ" - -#~ msgctxt "@action" -#~ msgid "Decrease Indent" -#~ msgstr "हाशिया घटाएँ" - -#~ msgctxt "@action" -#~ msgid "Insert Rule Line" -#~ msgstr "नियम लाइन प्रविष्ट करें" - -#~ msgctxt "@action" -#~ msgid "Link" -#~ msgstr "कड़ी" - -#~ msgctxt "@action" -#~ msgid "Format Painter" -#~ msgstr "फ़ॉर्मेट पेंटर" - -#~ msgctxt "@action" -#~ msgid "To Plain Text" -#~ msgstr "सादा पाठ में" - -#~ msgctxt "@action" -#~ msgid "Subscript" -#~ msgstr "लघुपाठ" - -#~ msgctxt "@action" -#~ msgid "Superscript" -#~ msgstr "उपरीपाठ" - -#~ msgid "&Copy Full Text" -#~ msgstr "पूरे पाठ की नक़ल बनाएं (&C)" - -#~ msgid "Nothing to spell check." -#~ msgstr "वर्तनी जाँच के लिए कुछ नहीं." - -#~ msgid "Speak Text" -#~ msgstr "पाठ बोलें" - -#~ msgid "No suggestions for %1" -#~ msgstr "%1 के लिए कोई सुझाव नहीं" - -#~ msgid "Ignore" -#~ msgstr "नज़रअंदाज़ करें" - -#~ msgid "Add to Dictionary" -#~ msgstr "शब्दकोष में जोड़ें" - -#~ msgctxt "@info" -#~ msgid "The time you entered is invalid" -#~ msgstr "जो समय आपने भरा है वह अवैध है" - -#~ msgctxt "@info" -#~ msgid "Time cannot be earlier than %1" -#~ msgstr "समय %1 से पहले का नहीं हो सकता" - -#~ msgctxt "@info" -#~ msgid "Time cannot be later than %1" -#~ msgstr "समय %1 से बाद का नहीं हो सकता" - -#~ msgctxt "Define an area in the time zone, like a town area" -#~ msgid "Area" -#~ msgstr "क्षेत्र" - -#~ msgctxt "Time zone" -#~ msgid "Region" -#~ msgstr "समय क्षेत्र" - -#~ msgid "Comment" -#~ msgstr "टिप्पणी" - -#~ msgctxt "@title:menu" -#~ msgid "Show Text" -#~ msgstr "पाठ दिखाएँ" - -#~ msgctxt "@title:menu" -#~ msgid "Toolbar Settings" -#~ msgstr "औज़ार पट्टी सेटिंग" - -#, fuzzy -#~| msgid "Orientation" -#~ msgctxt "Toolbar orientation" -#~ msgid "Orientation" -#~ msgstr "दिशा" - -#~ msgctxt "toolbar position string" -#~ msgid "Top" -#~ msgstr "ऊपर" - -#~ msgctxt "toolbar position string" -#~ msgid "Left" -#~ msgstr "बायाँ" - -#~ msgctxt "toolbar position string" -#~ msgid "Right" -#~ msgstr "दायाँ" - -#~ msgctxt "toolbar position string" -#~ msgid "Bottom" -#~ msgstr "नीचे" - -#~ msgid "Text Position" -#~ msgstr "पाठ स्थिति" - -#~ msgid "Icons Only" -#~ msgstr "सिर्फ प्रतीक" - -#~ msgid "Text Only" -#~ msgstr "सिर्फ पाठ" - -#~ msgid "Text Alongside Icons" -#~ msgstr "प्रतीकों के बाज़ू में पाठ" - -#~ msgid "Text Under Icons" -#~ msgstr "प्रतीकों के नीचे पाठ" - -#~ msgid "Icon Size" -#~ msgstr "प्रतीक आकार" - -#~ msgctxt "@item:inmenu Icon size" -#~ msgid "Default" -#~ msgstr "डिफ़ॉल्ट" - -#~ msgid "Small (%1x%2)" -#~ msgstr "छोटा (%1x%2)" - -#~ msgid "Medium (%1x%2)" -#~ msgstr "मध्यम (%1x%2)" - -#~ msgid "Large (%1x%2)" -#~ msgstr "बड़ा (%1x%2)" - -#~ msgid "Huge (%1x%2)" -#~ msgstr "बड़ा (%1x%2)" - -#~ msgid "Lock Toolbar Positions" -#~ msgstr "औज़ार-पट्टियाँ तालाबंद स्थितियां" - -#~ msgctxt "@action:intoolbar Text label of toolbar button" -#~ msgid "%1" -#~ msgstr "%1" - -#~ msgctxt "@info:tooltip Tooltip of toolbar button" -#~ msgid "%1" -#~ msgstr "%1" - -#~ msgid "Desktop %1" -#~ msgstr "डेस्कटॉप %1" - -#~ msgid "Add to Toolbar" -#~ msgstr "औज़ार-पट्टी में जोड़ें" - -#~ msgid "Configure Shortcut..." -#~ msgstr "शॉर्ट कट कॉन्फ़िगर करें..." - -#~ msgid "Toolbars Shown" -#~ msgstr "औज़ार पट्टियाँ दिखाई" - -#~ msgid "No text" -#~ msgstr "कोई पाठ नहीं" - -#~ msgid "&File" -#~ msgstr "फ़ाइल (&F)" - -#~ msgid "&Game" -#~ msgstr "खेल (&G)" - -#~ msgid "&Edit" -#~ msgstr "संपादन (&E)" - -#~ msgctxt "@title:menu Game move" -#~ msgid "&Move" -#~ msgstr "खिसकाएँ (&M) " - -#~ msgid "&View" -#~ msgstr "देखें (&V)" - -#~ msgid "&Go" -#~ msgstr "जाएँ (&G)" - -#~ msgid "&Bookmarks" -#~ msgstr " पसंदीदा (&B)" - -#~ msgid "&Tools" -#~ msgstr "औज़ार (&T)" - -#~ msgid "&Settings" -#~ msgstr "विन्यास (&S)" - -#~ msgid "Main Toolbar" -#~ msgstr "मुख्य औज़ार पट्टी" - -#~ msgid "Builds Qt widget plugins from an ini style description file." -#~ msgstr "एक ini शैली के वर्णन फ़ाइल से क्यूटी विजेट प्लगइन बनाता है." - -#~ msgid "Input file" -#~ msgstr "इनपुट फ़ाइल" - -#~ msgid "Output file" -#~ msgstr "आउटपुट फ़ाइल" - -#~ msgid "Name of the plugin class to generate" -#~ msgstr "बनाने के लिए प्लगइन क्लास का नाम" - -#~ msgid "Default widget group name to display in designer" -#~ msgstr "डिजाईनर में प्रदर्शित करे के लिए डिफ़ॉल्ट विजेट समूह का नाम" - -#~ msgid "makekdewidgets" -#~ msgstr "मेक-केडीई-विज़ेट्स" - -#~ msgid "(C) 2004-2005 Ian Reinhart Geiser" -#~ msgstr "(C) 2004-2005 इयान रेनहार्ट गीजर" - -#~ msgid "Ian Reinhart Geiser" -#~ msgstr "इयान रेनहार्ट गीसर" - -#~ msgid "Daniel Molkentin" -#~ msgstr "डेनियल मॉल्केनटिन" - -#~ msgid "Call Stack" -#~ msgstr "कॉल स्टेक" - -#~ msgid "Call" -#~ msgstr "कॉल" - -#~ msgid "Line" -#~ msgstr "पंक्ति" - -#~ msgid "Console" -#~ msgstr "बंद करें" - -#~ msgid "Enter" -#~ msgstr "प्रविष्ट करें" - -#~ msgid "" -#~ "Unable to find the Kate editor component;\n" -#~ "please check your KDE installation." -#~ msgstr "" -#~ "केएटीई संपादक अवयव नहीं मिला;\n" -#~ "कृपया अपना केडीई संस्थापना जाँचें." - -#~ msgid "Breakpoint" -#~ msgstr "ब्रेकपाइंट" - -#~ msgid "JavaScript Debugger" -#~ msgstr "जावास्क्रिप्ट डिबगर" - -#~ msgid "&Break at Next Statement" -#~ msgstr "अगले वक्तव्य पर ब्रेक करें (&B)" - -#~ msgid "Break at Next" -#~ msgstr "अगली दफा ब्रेक करें " - -#~ msgid "Continue" -#~ msgstr "जारी रखें" - -#~ msgid "Step Over" -#~ msgstr "स्टेप ओवर" - -#~ msgid "Step Into" -#~ msgstr "स्टेप इनटू" - -#~ msgid "Step Out" -#~ msgstr "स्टेप आउट" - -#~ msgid "Report Exceptions" -#~ msgstr "अपवाद रपट करें" - -#~ msgid "&Debug" -#~ msgstr "डिबग (&D)" - -#~ msgid "Close source" -#~ msgstr "स्रोत बन्द करें" - -#~ msgid "Ready" -#~ msgstr "तैयार" - -#~ msgid "Parse error at %1 line %2" -#~ msgstr "पारसे त्रुटि %1 पंक्ति %2 पर" - -#~ msgid "" -#~ "An error occurred while attempting to run a script on this page.\n" -#~ "\n" -#~ "%1 line %2:\n" -#~ "%3" -#~ msgstr "" -#~ "इस पृष्ठ पर एक स्क्रिप्ट चलाने के दौरान त्रुटि हुई.\n" -#~ "\n" -#~ "%1 पंक्ति %2:\n" -#~ "%3 पर" - -#~ msgid "Evaluation threw an exception %1" -#~ msgstr "इवेल्यूएशन ने एक एक्सेप्शन %1 दिया" - -#~ msgid "JavaScript Error" -#~ msgstr "जावास्क्रिप्ट त्रुटि" - -#~ msgid "&Do not show this message again" -#~ msgstr "इस संदेश को दोबारा नहीं दिखाएँ (&D)" - -#~ msgid "Local Variables" -#~ msgstr "स्थानीय वेरिएबल्स" - -#~ msgid "Reference" -#~ msgstr "संदर्भ" - -#~ msgid "Loaded Scripts" -#~ msgstr "लोड किए स्क्रिप्ट" - -#~ msgid "JavaScript" -#~ msgstr "जावास्क्रिप्ट " - -#~ msgid "&Stop Script" -#~ msgstr "स्क्रिप्ट रोकें" - -#~ msgid "Confirmation: JavaScript Popup" -#~ msgstr "पुष्टिकरणः जावास्क्रिप्ट पॉपअप" - -#~ msgid "Allow" -#~ msgstr "स्वीकारें" - -#~ msgid "Do Not Allow" -#~ msgstr "अनुमति न दें" - -#~ msgid "" -#~ "This site is requesting to open up a new browser window via JavaScript.\n" -#~ "Do you want to allow this?" -#~ msgstr "" -#~ "यह साइट जावास्क्रिप्ट के द्वारा नया ब्राउज़र विंडो खोलने का निवेदन कर रहा है.\n" -#~ " क्या आप इसकी अनुमति देंगे?" - -#~ msgid "" -#~ "<qt>This site is requesting to open<p>%1</p>in a new browser window via " -#~ "JavaScript.<br />Do you want to allow this?</qt>" -#~ msgstr "" -#~ " <qt>यह साइट जावास्क्रिप्ट के द्वारा<p>%1</p>नया ब्राउज़र विंडो खोलने का निवेदन कर " -#~ "रहा है.<br />क्या आप इसकी अनुमति देंगे?</qt>" - -#~ msgid "Close window?" -#~ msgstr "विंडो बंद करें?" - -#~ msgid "Confirmation Required" -#~ msgstr "पुष्टि आवश्यक" - -#~ msgid "" -#~ "Do you want a bookmark pointing to the location \"%1\" to be added to " -#~ "your collection?" -#~ msgstr "पसंद को इंगित करते स्थान \"%1\" को क्या आप अपने संग्रह में जोड़ना चाहते हैं?" - -#~ msgid "" -#~ "Do you want a bookmark pointing to the location \"%1\" titled \"%2\" to " -#~ "be added to your collection?" -#~ msgstr "" -#~ "पसंद को इंगित करते स्थान \"%1\" शीर्षक \"%2\" को क्या आप अपने संग्रह में जोड़ना चाहते " -#~ "हैं?" - -#~ msgid "JavaScript Attempted Bookmark Insert" -#~ msgstr "जावास्क्रिप्ट ने पसंदीदा शामिल करने की कोशिश की" - -#~ msgid "Insert" -#~ msgstr "प्रविष्ट" - -#~ msgid "Disallow" -#~ msgstr "अस्वीकार" - -#~ msgid "" -#~ "The following files will not be uploaded because they could not be " -#~ "found.\n" -#~ "Do you want to continue?" -#~ msgstr "" -#~ "निम्न फ़ाइलों को अपलोड नहीं किया जा सकता चूंकि वे नहीं मिलीं.\n" -#~ "क्या आप जारी रखना चाहते हैं?" - -#~ msgid "Submit Confirmation" -#~ msgstr "पुष्टिकरण जमा करें" - -#~ msgid "&Submit Anyway" -#~ msgstr "जैसे भी हो जमा करें (&S)" - -#~ msgid "" -#~ "You are about to transfer the following files from your local computer to " -#~ "the Internet.\n" -#~ "Do you really want to continue?" -#~ msgstr "" -#~ "आप निम्न फ़ाइलें अपने स्थानीय कम्प्यूटर से इंटरनेट पर हस्तांरित करने वाले हैं.\n" -#~ "क्या आप सचमुच जारी रखना चाहते हैं?" - -#~ msgid "Send Confirmation" -#~ msgstr "पुष्टिकरण भेजें" - -#~ msgid "&Send File" -#~ msgid_plural "&Send Files" -#~ msgstr[0] "फ़ाइल भेजें (&S)" -#~ msgstr[1] "फ़ाइलें भेजें (&S)" - -#~ msgid "Submit" -#~ msgstr "जमा करें" - -#~ msgid "Key Generator" -#~ msgstr "कुंजी निर्माता" - -#~ msgid "" -#~ "No plugin found for '%1'.\n" -#~ "Do you want to download one from %2?" -#~ msgstr "" -#~ " '%1' के लिए कोई प्लगइन नहीं मिला.\n" -#~ "क्या आप इसे %2 से डाउनलोड करना चाहते हैं?" - -#~ msgid "Missing Plugin" -#~ msgstr "प्लगइन नहीं मिला" - -#~ msgid "Download" -#~ msgstr "डाउनलोड" - -#~ msgid "Do Not Download" -#~ msgstr "डाउनलोड नहीं करें" - -#~ msgid "This is a searchable index. Enter search keywords: " -#~ msgstr "यह ढूंढी जा सकने योग्य तालिका है. ढूंढने के लिए कीवर्ड भरें: " - -#~ msgid "Document Information" -#~ msgstr "दस्तावेज़ जानकारी" - -#~ msgctxt "@title:group Document information" -#~ msgid "General" -#~ msgstr "सामान्य" - -#~ msgid "URL:" -#~ msgstr "यूआरएल:" - -#~ msgid "Title:" -#~ msgstr "शीर्षक:" - -#~ msgid "Last modified:" -#~ msgstr "पिछली मर्तबा परिवर्धितः" - -#~ msgid "Document encoding:" -#~ msgstr "दस्तावेज़ एनकोडिंग:" - -#~ msgid "Rendering mode:" -#~ msgstr "रेंडरिग पद्धति:" - -#~ msgid "HTTP Headers" -#~ msgstr "एचटीटीपी शीर्षक " - -#~ msgid "Property" -#~ msgstr "गुण" - -#~ msgid "Initializing Applet \"%1\"..." -#~ msgstr "ऐपलेट \"%1\" इनीशियलाइज़ किया जा रहा है..." - -#~ msgid "Starting Applet \"%1\"..." -#~ msgstr "ऐपलेट \"%1\" चालू किया जा रहा है..." - -#~ msgid "Applet \"%1\" started" -#~ msgstr "ऐपलेट \"%1\" चालू हो गया" - -#~ msgid "Applet \"%1\" stopped" -#~ msgstr "ऐपलेट \"%1\" बंद हो गया" - -#~ msgid "Loading Applet" -#~ msgstr "ऐपलेट लोड किया जा रहा है" - -#~ msgid "Error: java executable not found" -#~ msgstr "त्रुटिः जावा एक्जीक्यूटेबल नहीं मिला" - -#~ msgid "Signed by (validation: %1)" -#~ msgstr "के द्वारा हस्ताक्षरित है (वेलिडेशन: %1)" - -#~ msgid "Certificate (validation: %1)" -#~ msgstr "प्रमाणपत्र (वेलिडेशन: %1)" - -#~ msgid "Security Alert" -#~ msgstr "सुरक्षा चेतावनी" - -#~ msgid "Do you grant Java applet with certificate(s):" -#~ msgstr "क्या आप जावा ऐप्लेट को प्रमाणपत्र देना चाहेंगे:" - -#~ msgid "the following permission" -#~ msgstr "निम्न अनुमति" - -#~ msgid "&Reject All" -#~ msgstr "सभी नकारें (&R)" - -#~ msgid "&Grant All" -#~ msgstr "सभी को दें (&G)" - -#~ msgid "Applet Parameters" -#~ msgstr "ऐपलेट पैरामीटर्स" - -#~ msgid "Parameter" -#~ msgstr "पैरामीटर" - -#~ msgid "Class" -#~ msgstr "वर्ग" - -#~ msgid "Base URL" -#~ msgstr "बेस यूआरएल" - -#~ msgid "Archives" -#~ msgstr "अभिलेखागार" - -#~ msgid "KDE Java Applet Plugin" -#~ msgstr "केडीई जावा ऐपलेट प्लगइन" - -#~ msgid "HTML Toolbar" -#~ msgstr "एचटीएमएल औज़ार-पट्टी" - -#~ msgid "&Copy Text" -#~ msgstr "पाठ की नक़ल बनाएं (&C)" - -#~ msgid "Open '%1'" -#~ msgstr " '%1' खोलें" - -#~ msgid "&Copy Email Address" -#~ msgstr "ई-मेल पता नक़ल करें (&C)" - -#~ msgid "&Save Link As..." -#~ msgstr "लिंक ऐसे सहेजें (&S)" - -#~ msgid "&Copy Link Address" -#~ msgstr "कड़ी का पता नक़ल करें (&C)" - -#~ msgctxt "@title:menu HTML frame/iframe" -#~ msgid "Frame" -#~ msgstr "ढांचा" - -#~ msgid "Open in New &Window" -#~ msgstr "नए विंडो में खोलें (&W)" - -#~ msgid "Open in &This Window" -#~ msgstr "इस विंडो में खोलें (&T)" - -#~ msgid "Open in &New Tab" -#~ msgstr "नए टैब में खोलें (&N)" - -#~ msgid "Reload Frame" -#~ msgstr "फ्रेम रीलोड करें" - -#~ msgid "Print Frame..." -#~ msgstr "फ्रेम छापें...." - -#~ msgid "Save &Frame As..." -#~ msgstr "फ्रेम ऐसे सहेजें...(&F)" - -#~ msgid "View Frame Source" -#~ msgstr "फ्रेम स्रोत देखें" - -#~ msgid "View Frame Information" -#~ msgstr "फ्रेम जानकारी देखें" - -#~ msgid "Block IFrame..." -#~ msgstr "आईफ्रेम रोकें..." - -#~ msgid "Save Image As..." -#~ msgstr "छवि के रूप में संचित करें..." - -#~ msgid "Send Image..." -#~ msgstr "छवि भेजें..." - -#~ msgid "Copy Image" -#~ msgstr "छवि नक़ल करें" - -#~ msgid "Copy Image Location" -#~ msgstr "लिंक स्थान कापी करें" - -#~ msgid "View Image (%1)" -#~ msgstr "छवि ( %1) देखें" - -#~ msgid "Block Image..." -#~ msgstr "छवि रोकें..." - -#~ msgid "Block Images From %1" -#~ msgstr "%1 से छवियाँ रोकें" - -#~ msgid "Stop Animations" -#~ msgstr "एनीमेशन बंद रखें" - -#~ msgid "Search for '%1' with %2" -#~ msgstr "'%1' को ढूंढें इसके साथ %2" - -#~ msgid "Search for '%1' with" -#~ msgstr "'%1' को ढूंढें इसके साथ" - -#~ msgid "Save Link As" -#~ msgstr "लिंक ऐसे सहेजें" - -#~ msgid "Save Image As" -#~ msgstr "छवि ऐसे सहेजें" - -#~ msgid "Add URL to Filter" -#~ msgstr "फ़िल्टर में यूआरएल जोड़ें" - -#~ msgid "Enter the URL:" -#~ msgstr "यूआरएल भरें:" - -#~ msgid "" -#~ "A file named \"%1\" already exists. Are you sure you want to overwrite it?" -#~ msgstr "" -#~ "फ़ाइल नाम \"%1\" पहले से ही अस्तित्व में है. क्या आप इसके ऊपर ही मिटाकर लिखना चाहेंगे?" - -#~ msgid "Overwrite File?" -#~ msgstr "फ़ाइल को मिटाकर लिखें?" - -#~ msgid "Overwrite" -#~ msgstr "मिटाकर लिखें" - -#~ msgid "The Download Manager (%1) could not be found in your $PATH " -#~ msgstr "डाउनलोड प्रबंधक (%1) आपके पथ ($PATH ) पर ढूंढा नहीं जा सका" - -#~ msgid "" -#~ "Try to reinstall it \n" -#~ "\n" -#~ "The integration with Konqueror will be disabled." -#~ msgstr "" -#~ "इसे फिर से स्थापित करने की कोशिश करें \n" -#~ "\n" -#~ " के-कॉन्करर के साथ एकीकरण अक्षम रहेगा." - -#~ msgid "Default Font Size (100%)" -#~ msgstr "डिफ़ॉल्ट फ़ॉन्ट आकार (100%)" - -#~ msgid "KHTML" -#~ msgstr "के-एचटीएमएल" - -#~ msgid "Embeddable HTML component" -#~ msgstr "एम्बेडेड एचटीएमएल अवयव" - -#~ msgid "Lars Knoll" -#~ msgstr "लार्स क्नोल" - -#~ msgid "Antti Koivisto" -#~ msgstr "एन्टी कोईविस्तो" - -#~ msgid "Dirk Mueller" -#~ msgstr "डिर्क मुलर" - -#~ msgid "Peter Kelly" -#~ msgstr "पीटर केली" - -#~ msgid "Torben Weis" -#~ msgstr "टॉरबेन वेइस" - -#~ msgid "Martin Jones" -#~ msgstr "मार्टिन जोन्स" - -#~ msgid "Simon Hausmann" -#~ msgstr "साइमन हाउसमेन" - -#~ msgid "Tobias Anton" -#~ msgstr "टोबियास एन्टोन" - -#~ msgid "View Do&cument Source" -#~ msgstr "दस्तावेज़ का स्रोत देखें (&c)" - -#~ msgid "View Document Information" -#~ msgstr "दस्तावेज़ जानकारी देखें" - -#~ msgid "Save &Background Image As..." -#~ msgstr "पृष्ठ भूमि छवि को ऐसे सहेजें... (&B)" - -#~ msgid "SSL" -#~ msgstr "एसएसएल" - -#~ msgid "Print Rendering Tree to STDOUT" -#~ msgstr "STDOUT के लिए प्रिंट रेंडरिंग ट्री" - -#~ msgid "Print DOM Tree to STDOUT" -#~ msgstr "डॉम ट्री को STDOUT में छापें" - -#~ msgid "Stop Animated Images" -#~ msgstr "एनिमेटेड छवि रोकें" - -#~ msgid "Set &Encoding" -#~ msgstr "एनकोडिंग नियत करें (&E)" - -#~ msgid "Use S&tylesheet" -#~ msgstr "स्टाइल शीट इस्तेमाल करें (&t)" - -#~ msgid "Enlarge Font" -#~ msgstr "फ़ॉन्ट बड़ा करें" - -#~ msgid "" -#~ "<qt>Enlarge Font<br /><br />Make the font in this window bigger. Click " -#~ "and hold down the mouse button for a menu with all available font sizes.</" -#~ "qt>" -#~ msgstr "" -#~ "<qt>फ़ॉन्ट आकार बढ़ाएं<br /><br /> इस विंडो के फ़ॉन्ट को बड़ा करता है. सभी उपलब्ध " -#~ "फ़ॉन्ट आकारों को मेन्यू में देखने के लिए माउस बटन को क्लिक कर दबाए रखें.</qt>" - -#~ msgid "Shrink Font" -#~ msgstr "फ़ॉन्ट छोटा करें" - -#~ msgid "" -#~ "<qt>Shrink Font<br /><br />Make the font in this window smaller. Click " -#~ "and hold down the mouse button for a menu with all available font sizes.</" -#~ "qt>" -#~ msgstr "" -#~ "<qt>फ़ॉन्ट आकार घटाएं<br /><br />इस विंडो के फ़ॉन्ट को छोटा करता है. सभी उपलब्ध " -#~ "फ़ॉन्ट आकारों को मेन्यू में देखने के लिए माउस बटन को क्लिक कर दबाए रखें.</qt>" - -#~ msgid "" -#~ "<qt>Find text<br /><br />Shows a dialog that allows you to find text on " -#~ "the displayed page.</qt>" -#~ msgstr "" -#~ "<qt>पाठ ढूंढें<br /><br /> एक संवाद दिखाता है जो आपको प्रदर्शित पृष्ठ पर पाठ ढूंढने की " -#~ "अनुमति देता है.</qt>" - -#~ msgid "" -#~ "<qt>Find next<br /><br />Find the next occurrence of the text that you " -#~ "have found using the <b>Find Text</b> function.</qt>" -#~ msgstr "" -#~ "<qt>अगला ढूंढें<br /><br />उस पाठ की अगली उपस्थिति ढूंढता है, जिसे आपने <b>पाठ ढूंढें</" -#~ "b> क्रिया द्वारा ढूंढा है, </qt>" - -#~ msgid "" -#~ "<qt>Find previous<br /><br />Find the previous occurrence of the text " -#~ "that you have found using the <b>Find Text</b> function.</qt>" -#~ msgstr "" -#~ "<qt>पिछला ढूंढें<br /><br />उस पाठ की अगली उपस्थिति ढूंढता है, जिसे आपने <b>पाठ ढूंढें</" -#~ "b> क्रिया द्वारा ढूंढा है, </qt>" - -#~ msgid "Find Text as You Type" -#~ msgstr "जैसे आप टाइप करें पाठ ढूंढें" - -#~ msgid "Find Links as You Type" -#~ msgstr "जैसे आप टाइप करें कड़ी ढूंढें" - -#~ msgid "" -#~ "<qt>Print Frame<br /><br />Some pages have several frames. To print only " -#~ "a single frame, click on it and then use this function.</qt>" -#~ msgstr "" -#~ "<qt>फ्रेम छपाई<br /><br />कुछ पृष्ठों पर बहुत सारे फ़रमा होते हैं. सिर्फ एक फ़रमा को " -#~ "मुद्रित करने के लिए इस पर क्लिक करें तथा इस क्रिया (फंक्शन) का इस्तेमाल करें.</qt>" - -#~ msgid "Toggle Caret Mode" -#~ msgstr "कैरट मोड टॉगल करें" - -#~ msgid "The fake user-agent '%1' is in use." -#~ msgstr "नक़ली उपयोक्ता-एजेंट '%1' इस्तेमाल में है." - -#~ msgid "This web page contains coding errors." -#~ msgstr "इस वेब पर कोडिंग त्रुटियाँ हैं." - -#~ msgid "&Hide Errors" -#~ msgstr "त्रुटियाँ छुपाएँ (&H)" - -#~ msgid "&Disable Error Reporting" -#~ msgstr "त्रुटि रिपोर्टिंग अक्षम करें (&D)" - -#~ msgid "<qt><b>Error</b>: %1: %2</qt>" -#~ msgstr "<qt><b>त्रुटि</b>: %1: %2</qt>" - -#~ msgid "<qt><b>Error</b>: node %1: %2</qt>" -#~ msgstr "<qt><b>त्रुटि</b>: नोड %1: %2</qt>" - -#~ msgid "Display Images on Page" -#~ msgstr "पृष्ठ पर छवि दिखाएँ" - -#~ msgid "Error: %1 - %2" -#~ msgstr "त्रुटि: %1- %2" - -#~ msgid "The requested operation could not be completed" -#~ msgstr "वांछित आपरेशन पूरा नहीं हो सका" - -#~ msgid "Technical Reason: " -#~ msgstr "तकनीकी कारणः" - -#~ msgid "Details of the Request:" -#~ msgstr "निवेदन का विवरणः" - -#~ msgid "URL: %1" -#~ msgstr "यूआरएल: %1" - -#~ msgid "Protocol: %1" -#~ msgstr "प्रोटोकॉल: %1" - -#~ msgid "Date and Time: %1" -#~ msgstr "तारीख़ और समय: %1" - -#~ msgid "Additional Information: %1" -#~ msgstr "अतिरिक्त जानकारीः %1" - -#~ msgid "Description:" -#~ msgstr "वर्णनः" - -#~ msgid "Possible Causes:" -#~ msgstr "संभावित कारण:" - -#~ msgid "Possible Solutions:" -#~ msgstr "संभावित समाधानः" - -#~ msgid "Page loaded." -#~ msgstr "पृष्ठ लोड हो गया." - -#~ msgid "%1 Image of %2 loaded." -#~ msgid_plural "%1 Images of %2 loaded." -#~ msgstr[0] "%2 में से %1 छवि लोड हो गई." -#~ msgstr[1] "%2 में से %1 छवियाँ लोड हो गईं." - -#~ msgid "Automatic Detection" -#~ msgstr "अपने आप पता लगाएँ" - -#~ msgid " (In new window)" -#~ msgstr " (नए विंडो में)" - -#~ msgid "Symbolic Link" -#~ msgstr "सिंबॉलिक लिंक " - -#~ msgid "%1 (Link)" -#~ msgstr "%1 (लिंक )" - -#~ msgid "%2 (%1 byte)" -#~ msgid_plural "%2 (%1 bytes)" -#~ msgstr[0] "%2 (%1 बाइट)" -#~ msgstr[1] "%2 (%1 बाइट्स)" - -#~ msgid "%2 (%1 K)" -#~ msgstr "%2 (%1 K)" - -#~ msgid " (In other frame)" -#~ msgstr " (अन्य फ़रमा में)" - -#~ msgid "Email to: " -#~ msgstr "को ईमेल करें: " - -#~ msgid " - Subject: " -#~ msgstr " - विषय: " - -#~ msgid " - CC: " -#~ msgstr " - प्रतिलिपि:" - -#~ msgid " - BCC: " -#~ msgstr " - बेनामी प्रतिलिपि: " - -#~ msgid "Save As" -#~ msgstr "ऐसे सहेजें" - -#~ msgid "" -#~ "<qt>This untrusted page links to<br /><b>%1</b>.<br />Do you want to " -#~ "follow the link?</qt>" -#~ msgstr "" -#~ "<qt>यह अनस्ट्रक्चर्ड पृष्ठ<br /><b>%1</b> को लिंक करता है.<br />क्या आप लिंक को " -#~ "फॉलो करना चाहते हैं?</qt>" - -#~ msgid "Follow" -#~ msgstr "अनुसरण करें" - -#~ msgid "Frame Information" -#~ msgstr "फ्रेम जानकारी" - -#~ msgid " <a href=\"%1\">[Properties]</a>" -#~ msgstr " <a href=\"%1\">[गुण]</a>" - -#~ msgctxt "HTML rendering mode (see http://en.wikipedia.org/wiki/Quirks_mode)" -#~ msgid "Quirks" -#~ msgstr "Quirks" - -#~ msgctxt "HTML rendering mode (see http://en.wikipedia.org/wiki/Quirks_mode)" -#~ msgid "Almost standards" -#~ msgstr "लगभग मानकों" - -#~ msgctxt "HTML rendering mode (see http://en.wikipedia.org/wiki/Quirks_mode)" -#~ msgid "Strict" -#~ msgstr "कठोर" - -#~ msgid "Save Background Image As" -#~ msgstr "पृष्ठ भूमि छवि को ऐसे सहेजें..." - -#~ msgid "The peer SSL certificate chain appears to be corrupt." -#~ msgstr "पीअर एसएसएल प्रमाणपत्र चैन खराब प्रतीत होता है." - -#~ msgid "Save Frame As" -#~ msgstr "फ्रेम ऐसे सहेजें" - -#~ msgid "&Find in Frame..." -#~ msgstr "फ्रेम में ढूंढें...(&F)" - -#~ msgid "" -#~ "Warning: This is a secure form but it is attempting to send your data " -#~ "back unencrypted.\n" -#~ "A third party may be able to intercept and view this information.\n" -#~ "Are you sure you wish to continue?" -#~ msgstr "" -#~ "चेतावनी: यह एक सुरक्षित फ़ॉर्म है परंतु यह आपका डाटा अनएनक्रिप्टेड वापस भेजने की कोशिश " -#~ "में है.\n" -#~ "कोई तीसरी पार्टी बीच में से इस जानकारी को देख सकती है\n" -#~ "क्या आप वाक़ई जारी रखना चाहते हैं?" - -#~ msgid "Network Transmission" -#~ msgstr "नेटवर्क ट्रांसमिशन" - -#~ msgid "&Send Unencrypted" -#~ msgstr "अनएनक्रिप्टेड भेजें (&S)" - -#~ msgid "" -#~ "Warning: Your data is about to be transmitted across the network " -#~ "unencrypted.\n" -#~ "Are you sure you wish to continue?" -#~ msgstr "" -#~ "चेतावनी: आपका डाटा नेटवर्क के पार अनएनक्रिप्टेड भेजा जाने वाला है.\n" -#~ "क्या आप वाक़ई जारी रखना चाहते हैं?" - -#~ msgid "" -#~ "This site is attempting to submit form data via email.\n" -#~ "Do you want to continue?" -#~ msgstr "" -#~ "यह साइट, ईमेल के द्वारा फ़ॉर्म डाटा पेश करने की कोशिश में है.\n" -#~ "क्या आप इसे जारी रखना चाहते हैं?" - -#~ msgid "&Send Email" -#~ msgstr "ईमेल भेजें (&S)" - -#~ msgid "" -#~ "<qt>The form will be submitted to <br /><b>%1</b><br />on your local " -#~ "filesystem.<br />Do you want to submit the form?</qt>" -#~ msgstr "" -#~ "<qt>फ़ॉर्म को आपके स्थानीय फ़ाइल सिस्टम पर <br /><b>%1</b><br />पर जमा किया " -#~ "जाएगा.<br />क्या आप फ़ॉर्म को जमा करना चाहते हैं?</qt>" - -#~ msgid "(%1/s)" -#~ msgstr "(%1/s)" - -#~ msgid "Security Warning" -#~ msgstr "सुरक्षा चेतावनी" - -#~ msgid "<qt>Access by untrusted page to<br /><b>%1</b><br /> denied.</qt>" -#~ msgstr "<qt>भरोसा रहित पृष्ठ से <br /><b>%1</b><br /> पर पहुँच नकारा गया.</qt>" - -#~ msgid "The wallet '%1' is open and being used for form data and passwords." -#~ msgstr "बटुआ '%1' खुला है तथा फ़ॉर्म डाटा एवं पासवर्ड के लिए उपयोग में आ रहा है." - -#~ msgid "&Close Wallet" -#~ msgstr "वैलट बंद करें (&C)" - -#~ msgid "&Allow storing passwords for this site" -#~ msgstr "इस साइट के लिए पासवर्ड सहेने की अनुमति दें" - -#~ msgid "Remove password for form %1" -#~ msgstr "फॉर्म %1 का पासवर्ड हटाएँ" - -#~ msgid "JavaScript &Debugger" -#~ msgstr "जावास्क्रिप्ट डिबगर (&D)" - -#~ msgid "This page was prevented from opening a new window via JavaScript." -#~ msgstr "जावास्क्रिप्ट के जरिए इस पृष्ठ पर नया विंडो खोलने से रोका गया" - -#~ msgid "Popup Window Blocked" -#~ msgstr "पाप अप विंडो रोका गया" - -#~ msgid "&Show Blocked Popup Window" -#~ msgid_plural "&Show %1 Blocked Popup Windows" -#~ msgstr[0] "रोके गए पॉपअप विंडो को दिखाएँ (&S)" -#~ msgstr[1] "रोके गए %1 पॉपअप विंडो को दिखाएँ (&S)" - -#~ msgid "Show Blocked Window Passive Popup &Notification" -#~ msgstr "रोके गए विंडो पैसिव पॉपअप सूचना दिखाएँ (&N)" - -#~ msgid "&Configure JavaScript New Window Policies..." -#~ msgstr "जावा स्क्रिप्ट नया विंडो पॉलिसी कॉन्फ़िगर करें... (&C)" - -#~ msgid "HTML Settings" -#~ msgstr "एचटीएमएल विन्यास " - -#~ msgid "Printer friendly mode (black text, no background)" -#~ msgstr "प्रिंटर मित्रवत विधि (काला पाठ, कोई पृष्ठ भूमि नहीं)" - -#~ msgid "Print images" -#~ msgstr "छवि छापें" - -#~ msgid "Print header" -#~ msgstr "हेडर छापें...." - -#~ msgid "Filter error" -#~ msgstr "फ़िल्टर त्रुटि" - -#~ msgid "Inactive" -#~ msgstr "सापेक्ष" - -#~ msgid "%1 (%2 - %3x%4 Pixels)" -#~ msgstr "%1 (%2 - %3x%4 पिक्सल्स)" - -#~ msgid "%1 - %2x%3 Pixels" -#~ msgstr "%1 - %2x%3 पिक्सल्स" - -#~ msgid "%1 (%2x%3 Pixels)" -#~ msgstr "%1 (%2x%3 पिक्सल्स)" - -#~ msgid "Image - %1x%2 Pixels" -#~ msgstr "छवि - %1x%2 पिक्सल्स" - -#~ msgid "Done." -#~ msgstr "सम्पन्न." - -#~ msgid "Access Keys activated" -#~ msgstr "पहुँच कुंजी सक्रिय किया गया" - -#~ msgid "JavaScript Errors" -#~ msgstr "जावास्क्रिप्ट त्रुटियाँ" - -#~ msgid "KMultiPart" -#~ msgstr "केमल्टीपार्ट" - -#~ msgid "Embeddable component for multipart/mixed" -#~ msgstr "मल्टीपार्ट/मिक्स्ड के लिए एम्बेडेबल कम्पोनेंट" - -#~ msgid "Copyright 2001-2011, David Faure <email>faure@kde.org</email>" -#~ msgstr "कॉपीराइट 2001-2011, डेविड फॉउर <email>faure@kde.org</email>" - -#~ msgid "No handler found for %1." -#~ msgstr " %1 के लिए कोई हैंडलर नहीं मिला." - -#~ msgid "Play" -#~ msgstr "चलाएँ" - -#~ msgid "Pause" -#~ msgstr "ठहरें" - -#~ msgid "New Web Shortcut" -#~ msgstr "नया वेब शॉर्टकट" - -#~ msgid "%1 is already assigned to %2" -#~ msgstr "%1 पहले से %2 को सौंपा है" - -#~ msgid "Search &provider name:" -#~ msgstr "प्रदाता नाम खोजें (&p):" - -#~ msgid "New search provider" -#~ msgstr "नया खोज प्रदाता" - -#~ msgid "UR&I shortcuts:" -#~ msgstr "URI शॉर्टकट्स (&I)" - -#~ msgid "Create Web Shortcut" -#~ msgstr "वेब शार्टकट बनाएँ" - -#~ msgid "Directory containing tests, basedir and output directories." -#~ msgstr "डिरेक्ट्री में जांच, बेसडिरेक्ट्रीज तथा आउटपुट डिरेक्ट्रीज हैं." - -#~ msgid "Do not suppress debug output" -#~ msgstr "डिबग आउटपुट सप्रेस नहीं करें" - -#~ msgid "Regenerate baseline (instead of checking)" -#~ msgstr "बेसलाइन फिर से जेनरेट करें (जाँच के बजाए)" - -#~ msgid "Do not show the window while running tests" -#~ msgstr "जब जांच चल रहा हो तो विंडो नहीं दिखाएँ" - -#~ msgid "Only run a single test. Multiple options allowed." -#~ msgstr "सिर्फ एकल जाँच चलाएँ. बहु विकल्प स्वीकार्य नहीं हैं." - -#~ msgid "Only run .js tests" -#~ msgstr "सिर्फ .js जांच चलाएँ" - -#~ msgid "Only run .html tests" -#~ msgstr "सिर्फ .html जाँच चलाएँ" - -#~ msgid "Do not use Xvfb" -#~ msgstr "एक्सवीएफबी का इस्तेमाल नहीं करें" - -#~ msgid "" -#~ "Directory containing tests, basedir and output directories. Only regarded " -#~ "if -b is not specified." -#~ msgstr "" -#~ "डिरेक्ट्री जिसमें जाँच, बेसडिरेक्ट्री व आउटपुट डिरेक्ट्रीज हैं. तभी विचार किया जाए जब -b " -#~ "निर्दिष्ट नहीं हो." - -#~ msgid "" -#~ "Relative path to testcase, or directory of testcases to be run " -#~ "(equivalent to -t)." -#~ msgstr "" -#~ "टेस्टकेस के लिए रिलेटिव पथ, या चलाने के लिए टेस्टकेस की डिरेक्ट्री ( -t के समतुल्य)." - -#~ msgid "TestRegression" -#~ msgstr "टेस्ट-रीग्रेसन" - -#~ msgid "Regression tester for khtml" -#~ msgstr "केएचटीएमएल के लिए रीग्रेशन जांचक" - -#~ msgid "KHTML Regression Testing Utility" -#~ msgstr "केएचटीएमएल रीग्रेसन जांच यूटिलिटी" - -#~ msgid "0" -#~ msgstr "0" - -#~ msgid "Regression testing output" -#~ msgstr "रीग्रेसन जांच आउटपुट" - -#~ msgid "Pause/Continue regression testing process" -#~ msgstr "रीग्रेसन जांच प्रक्रिया रोकें/जारी रखें" - -#~ msgid "" -#~ "You may select a file where the log content is stored, before the " -#~ "regression testing is started." -#~ msgstr "जांच चालू होने से पहले आप कोई फ़ाइल चुन सकते हैं जहाँ लॉग सामग्री भंडारित है." - -#~ msgid "Output to File..." -#~ msgstr "आउटपुट फ़ाइल पर..." - -#~ msgid "Regression Testing Status" -#~ msgstr "रीग्रेसन जाँच स्थिति" - -#~ msgid "View HTML Output" -#~ msgstr "एचटीएमएल आउटपुट देखें" - -#~ msgid "Settings" -#~ msgstr "विन्यास" - -#~ msgid "Tests" -#~ msgstr "परीक्षण" - -#~ msgid "Only Run JS Tests" -#~ msgstr "सिर्फ जेएस जांच चलाएँ" - -#~ msgid "Only Run HTML Tests" -#~ msgstr "सिर्फ एचटीएमएल जांच बनाएँ" - -#~ msgid "Do Not Suppress Debug Output" -#~ msgstr "डिबग आउटपुट सप्रेस नहीं करें" - -#~ msgid "Run Tests..." -#~ msgstr "जाँच चलाएँ..." - -#~ msgid "Run Single Test..." -#~ msgstr "एकल जाँच चलाएँ..." - -#~ msgid "Specify tests Directory..." -#~ msgstr "जांच डिरेक्ट्री निर्धारित करें..." - -#~ msgid "Specify khtml Directory..." -#~ msgstr "केएचटीएमएल डिरेक्ट्री निर्धारित करें..." - -#~ msgid "Specify Output Directory..." -#~ msgstr "आउटपुट डिरेक्ट्री निर्धारित करें..." - -#~ msgid "TestRegressionGui" -#~ msgstr "टेस्ट-रीग्रेसन-जीयूआई" - -#~ msgid "GUI for the khtml regression tester" -#~ msgstr "केएचटीएमएल रीग्रेसन जांच के लिए जीयूआई" - -#~ msgid "Available Tests: 0" -#~ msgstr "उपलब्ध जाँच: 0" - -#~ msgid "Please choose a valid 'khtmltests/regression/' directory." -#~ msgstr "कृपया एक वैध 'khtmltests/regression/' डिरेक्ट्री चुनें." - -#~ msgid "Please choose a valid 'khtml/' build directory." -#~ msgstr "कृपया एक वैध 'khtml/' बिल्ड डिरेक्ट्री चुनें." - -#~ msgid "Available Tests: %1 (ignored: %2)" -#~ msgstr "उपलब्ध जांच: %1 (उपेक्षा किया: %2)" - -#~ msgid "Cannot find testregression executable." -#~ msgstr "टेस्टरीग्रेसन एक्जीक्यूटेबल ढूंढ नहीं सका." - -#~ msgid "Run test..." -#~ msgstr "जाँच चलाएँ..." - -#~ msgid "Add to ignores..." -#~ msgstr "इग्नोर्स में जोड़ें..." - -#~ msgid "Remove from ignores..." -#~ msgstr "इग्नोर्स से हटाएँ..." - -#~ msgid "URL to open" -#~ msgstr "यूआरएल जिसे खोलना है" - -#~ msgid "Testkhtml" -#~ msgstr "टेस्टकेएचटीएमएल" - -#~ msgid "a basic web browser using the KHTML library" -#~ msgstr "केएचटीएमएल लाइब्रेरी का प्रयोग करता हुआ एक मूल किस्म का वेब ब्राउज़र" - -#~ msgid "Find &links only" -#~ msgstr "केवल लिंक्स ढूंढें" - -#~ msgid "Not found" -#~ msgstr "नहीं मिला" - -#~ msgid "No more matches for this search direction." -#~ msgstr "इस खोज दिशा में और कोई मेल नहीं" - -#~ msgid "F&ind:" -#~ msgstr "ढूंढें (&i)" - -#~ msgid "&Next" -#~ msgstr "अगला (&N)" - -#~ msgid "Opt&ions" -#~ msgstr "विकल्प (&i)" - -#~ msgid "Do you want to store this password?" -#~ msgstr "क्या आप इस शब्दकूट को सहेजना चाहते हैं?" - -#~ msgid "Do you want to store this password for %1?" -#~ msgstr "क्या आप %1 का पासवर्ड सहेजना चाहते हैं" - -#~ msgid "&Store" -#~ msgstr "भंडारित करें (&S)" - -#~ msgid "Ne&ver store for this site" -#~ msgstr "इस साइट के लिए कभी सहेजें नहीं (&v)" - -#~ msgid "Do ¬ store this time" -#~ msgstr "यह समय नही सहेजें" - -#~ msgid "Basic Page Style" -#~ msgstr "मूल पृष्ठ शैली" - -#~ msgid "the document is not in the correct file format" -#~ msgstr "दस्तावेज़ सही फ़ाइल फॉर्मेट में नहीं है" - -#~ msgid "fatal parsing error: %1 in line %2, column %3" -#~ msgstr "गंभीर पारसिंग त्रुटि: %1 पंक्ति %2, स्तम्भ%3 पर" - -#~ msgid "XML parsing error" -#~ msgstr "एक्सएमएल पारसिंग त्रुटि" - -#~ msgid "Could not find '%1' executable." -#~ msgstr "एक्जीक्यूटेबल '%1' नहीं मिला." - -#~ msgid "" -#~ "Could not open library '%1'.\n" -#~ "%2" -#~ msgstr "" -#~ "लाइब्रेरी '%1'. खोल नहीं सका\n" -#~ "%2" - -#~ msgid "" -#~ "Could not find 'kdemain' in '%1'.\n" -#~ "%2" -#~ msgstr "" -#~ " 'केडीई-मेन' '%1' पर नहीं मिला.\n" -#~ "%2" - -#~ msgid "KDEInit could not launch '%1'" -#~ msgstr "केडीई-इनिट '%1' को चालू नहीं कर सका." - -#~ msgid "Could not find service '%1'." -#~ msgstr "सर्विस '%1' नहीं मिला." - -#~ msgid "Service '%1' is malformatted." -#~ msgstr "सर्विस '%1' मालफॉर्मेटेड है." - -#~ msgid "Launching %1" -#~ msgstr "चालू किया जा रहा है %1" - -#~ msgid "Unknown protocol '%1'.\n" -#~ msgstr "अज्ञात प्रोटोकॉल '%1'.\n" - -#~ msgid "Error loading '%1'.\n" -#~ msgstr " %1 को लोड करने में त्रुटि.\n" - -#~ msgid "" -#~ "klauncher: This program is not supposed to be started manually.\n" -#~ "klauncher: It is started automatically by kdeinit4.\n" -#~ msgstr "" -#~ "के-लाँचर: यह प्रोग्राम हस्तचालित प्रारंभ करने के लिए नही है.\n" -#~ "के-लाँचर: यह केडीई-इनिट4 द्वारा स्वचलित प्रारंभ होता है.\n" - -#~ msgid "Evaluation error" -#~ msgstr "इवेल्यूएशन त्रुटि" - -#~ msgid "Range error" -#~ msgstr "रेंज त्रुटि" - -#~ msgid "Reference error" -#~ msgstr "संदर्भ त्रुटि" - -#~ msgid "Syntax error" -#~ msgstr "सिंटेक्स त्रुटि" - -#~ msgid "Type error" -#~ msgstr "टाइप त्रुटि" - -#~ msgid "URI error" -#~ msgstr "यूआरआई त्रुटि" - -#~ msgid "JS Calculator" -#~ msgstr "जेएस गणक" - -#~ msgctxt "addition" -#~ msgid "+" -#~ msgstr "+" - -#~ msgid "AC" -#~ msgstr "AC" - -#~ msgctxt "subtraction" -#~ msgid "-" -#~ msgstr "-" - -#~ msgctxt "evaluation" -#~ msgid "=" -#~ msgstr "=" - -#~ msgid "CL" -#~ msgstr "सीएल" - -#~ msgid "5" -#~ msgstr "5" - -#~ msgid "3" -#~ msgstr "3" - -#~ msgid "7" -#~ msgstr "7" - -#~ msgid "8" -#~ msgstr "8" - -#~ msgid "MainWindow" -#~ msgstr "मुख्यविंडो:" - -#~ msgid "<h1>KJSEmbed Documentation Viewer</h1>" -#~ msgstr "<h1>केजेएसएम्बेड दस्तावेज़ प्रदर्शक</h1>" - -#~ msgid "Execute" -#~ msgstr "चलाएँ" - -#~ msgid "File" -#~ msgstr "फ़ाइल" - -#~ msgid "Open Script" -#~ msgstr "स्क्रिप्ट खोलें" - -#~ msgid "Open a script..." -#~ msgstr "स्क्रिप्ट खोलें..." - -#~ msgid "Ctrl+O" -#~ msgstr "कंट्रोल+O" - -#~ msgid "Close Script" -#~ msgstr "स्क्रिप्ट बंद करें" - -#~ msgid "Close script..." -#~ msgstr "स्क्रिप्ट बंद करें..." - -#~ msgid "Quit" -#~ msgstr "बाहर जाएँ" - -#~ msgid "Quit application..." -#~ msgstr "अनुप्रयोग से बाहर आएं..." - -#~ msgid "Run" -#~ msgstr "चलाएँ" - -#~ msgid "Run script..." -#~ msgstr "स्क्रिप्ट चलाएँ..." - -#~ msgid "Run To..." -#~ msgstr "पर चलाएँ..." - -#~ msgid "Run to breakpoint..." -#~ msgstr "ब्रेकपाइंट तक चलाएँ..." - -#~ msgid "Step" -#~ msgstr "स्टेप" - -#~ msgid "Step to next line..." -#~ msgstr "अगली पंक्ति जाएँ..." - -#~ msgid "Step execution..." -#~ msgstr "चरण एक्जीक्यूशन..." - -#~ msgid "KJSCmd" -#~ msgstr "केजेएस-सीएमडी" - -#~ msgid "Utility for running KJSEmbed scripts \n" -#~ msgstr "केजेएसएम्बेड स्क्रिप्ट चलाने के लिए स्क्रिप्ट \n" - -#~ msgid "(C) 2005-2006 The KJSEmbed Authors" -#~ msgstr "(c) 2005-2006 केजेएसएम्बेड के लेखकगण" - -#~ msgid "Execute script without gui support" -#~ msgstr "जीयूआई समर्थन के बगैर स्क्रिप्ट चलाएँ" - -#~ msgid "start interactive kjs interpreter" -#~ msgstr "इंटरेक्टिव केजेएस इंटरप्रेटर प्रारंभ करें" - -#~ msgid "start without KDE KApplication support." -#~ msgstr "केडीई के-एप्लीकेशन समर्थन के बगैर प्रारंभ करें." - -#~ msgid "Script to execute" -#~ msgstr "चलाने के लिए स्क्रिप्ट" - -#~ msgid "Error encountered while processing include '%1' line %2: %3" -#~ msgstr "इनक्लूड '%1' पंक्ति %2 को प्रोसेस करने के दौरान त्रुटि: %3" - -#~ msgid "include only takes 1 argument, not %1." -#~ msgstr "इनक्लूड में सिर्फ 1 आर्गुमेंट होगा न कि %1." - -#~ msgid "File %1 not found." -#~ msgstr "फ़ाइल \"%1\" नहीं मिला." - -#~ msgid "library only takes 1 argument, not %1." -#~ msgstr "लाइब्रेरी में सिर्फ 1 आर्गुमेंट होगा न कि %1." - -#~ msgid "Alert" -#~ msgstr "सतर्क" - -#~ msgid "Confirm" -#~ msgstr "पुष्टि करें" - -#~ msgid "Bad event handler: Object %1 Identifier %2 Method %3 Type: %4." -#~ msgstr "खराब इवेंट हैंडलर: ऑब्जैक्ट %1 आइडेंटिफ़ॉयर %2 विधि %3 क़िस्म: %4." - -#~ msgid "Exception calling '%1' function from %2:%3:%4" -#~ msgstr "एक्सेप्शन '%1' फंक्शन को यहां से काल कर रहा है %2:%3:%4" - -#~ msgid "Could not open file '%1'" -#~ msgstr "फ़ाइल '%1' खोल नहीं सकते" - -#~ msgid "Could not create temporary file." -#~ msgstr "अस्थायी फ़ाइल बना नहीं पाया." - -#~ msgid "%1 is not a function and cannot be called." -#~ msgstr "%1 फंक्शन नहीं है और काल नहीं किया जा सकता." - -#~ msgid "%1 is not an Object type" -#~ msgstr "%1 ऑब्जेक्ट टाइप नहीं है" - -#~ msgid "Action takes 2 args." -#~ msgstr "क्रिया 2 आर्गुमेंट स्वीकारता है." - -#~ msgid "ActionGroup takes 2 args." -#~ msgstr "क्रिया-समूह 2 आर्गुमेंट स्वीकारता है." - -#~ msgid "Must supply a valid parent." -#~ msgstr "वैध पेरेन्ट प्रदान करना आवश्यक है." - -#~ msgid "There was an error reading the file '%1'" -#~ msgstr "फ़ाइल '%1' को पढ़ने में त्रुटि हुई." - -#~ msgid "Could not read file '%1'" -#~ msgstr "फ़ाइल '%1' को पढ़ नहीं सका" - -#~ msgid "Must supply a filename." -#~ msgstr "आपको एक फ़ाइलनाम देना होगा." - -#~ msgid "'%1' is not a valid QLayout." -#~ msgstr "'%1' वैध क्यू-लेआउट नहीं है." - -#~ msgid "Must supply a layout name." -#~ msgstr "आपको एक खाका नाम देना होगा." - -#~ msgid "Wrong object type." -#~ msgstr "गलत ऑब्जेक्ट क़िस्म." - -#~ msgid "First argument must be a QObject." -#~ msgstr "पहला आर्गुमेंट क्यूऑब्जैक्ट होना चाहिए." - -#~ msgid "Incorrect number of arguments." -#~ msgstr "आर्गुमेंट के लिए गलत संख्या." - -#~ msgid "but there is only %1 available" -#~ msgid_plural "but there are only %1 available" -#~ msgstr[0] "पर केवल %1 ही उपलब्ध है" -#~ msgstr[1] "पर केवल %1 उपलब्ध हैं" - -#~ msgctxt "" -#~ "%1 is 'the slot asked for foo arguments', %2 is 'but there are only bar " -#~ "available'" -#~ msgid "%1, %2." -#~ msgstr "%1, %2." - -#~ msgid "Failure to cast to %1 value from Type %2 (%3)" -#~ msgstr "%1 मूल्य %2 में से कास्ट करने में असफल (%3)" - -#~ msgid "No such method '%1'." -#~ msgstr "ऐसी कोई विधि '%1' नहीं है." - -#~ msgid "Call to method '%1' failed, unable to get argument %2: %3" -#~ msgstr "काल विधि '%1' असफल आर्गुमेंट %2 प्राप्त करने में असफल: %3" - -#~ msgid "Call to '%1' failed." -#~ msgstr "'%1' को काल असफल." - -#~ msgid "Could not construct value" -#~ msgstr "मूल्य बना नहीं सका" - -#~ msgid "Not enough arguments." -#~ msgstr "पर्याप्त आर्गुमेंट नहीं हैं." - -#~ msgid "Failed to create Action." -#~ msgstr "क्रिया बनाने में असफल." - -#~ msgid "Failed to create ActionGroup." -#~ msgstr "क्रिया-समूह बनाने में असफल." - -#~ msgid "No classname specified" -#~ msgstr "कोई क्लासनाम उल्लेखित नहीं है" - -#~ msgid "Failed to create Layout." -#~ msgstr "खाका बनाने में असफल." - -#~ msgid "No classname specified." -#~ msgstr "कोई क्लासनाम उल्लेखित नहीं है." - -#~ msgid "Failed to create Widget." -#~ msgstr "विजेट बनाने में असफल." - -#~ msgid "Could not open file '%1': %2" -#~ msgstr "फ़ाइल '%1' खोल नहीं सका: %2" - -#~ msgid "Failed to load file '%1'" -#~ msgstr "फ़ाइल '%1' लोड करने में असफल" - -#~ msgid "'%1' is not a valid QWidget." -#~ msgstr "'%1' वैध क्यूविजेट नहीं है." - -#~ msgid "Must supply a widget name." -#~ msgstr "एक विजेट नाम देना होगा." - -#~ msgid "Bad slot handler: Object %1 Identifier %2 Method %3 Signature: %4." -#~ msgstr "खराब स्लॉट हैंडलर: ऑब्जैक्ट %1 आइडेंटिफ़ॉयर %2 विधि %3 हस्ताक्षर: %4." - -#~ msgid "Exception calling '%1' slot from %2:%3:%4" -#~ msgstr "एक्सेप्शन '%1' स्लॉट को यहां से काल कर रहा है %2:%3:%4" - -#~ msgid "loading %1" -#~ msgstr "लोड हो रहा %1" - -#~ msgctxt "describes the feed of the latest posted entries" -#~ msgid "Latest" -#~ msgstr "नवीनतम" - -#~ msgid "Highest Rated" -#~ msgstr "उच्चतम अंक" - -#~ msgid "Most Downloads" -#~ msgstr "अधिकतम डाउनलोड्स" - -#~ msgid "" -#~ "<qt>Enter passphrase for key <b>0x%1</b>, belonging to<br /><i>%2<" -#~ "%3></i><br />:</qt>" -#~ msgstr "" -#~ "<qt>कुंजी <b>0x%1</b> के लिए पासफ्रेस भरें, से सम्बद्ध<br /><i>%2<%3></i><br /" -#~ ">:</qt>" - -#~ msgid "Select Signing Key" -#~ msgstr "हस्ताक्षर कुंजी चुनें" - -#~ msgid "Key used for signing:" -#~ msgstr "हस्ताक्षर करने के लिए उपयोग कुंजी:" - -#~ msgid "Get Hot New Stuff" -#~ msgstr "नई ताज़ा चीज़ें प्राप्त करें" - -#~ msgctxt "Program name followed by 'Add On Installer'" -#~ msgid "%1 Add-On Installer" -#~ msgstr "%1 एड-ऑन इंस्टालर" - -#~ msgid "Add Rating" -#~ msgstr "दरजा जोड़ें" - -#~ msgid "Add Comment" -#~ msgstr "टिप्णी जोड़ें" - -#~ msgid "View Comments" -#~ msgstr "टिप्पणियाँ देखें" - -#~ msgid "Timeout. Check Internet connection." -#~ msgstr "टाइमआउट. इंटरनेट कनेक्शन जांचें!" - -#~ msgid "Entries failed to load" -#~ msgstr "प्रविष्टियाँ लोड होने में असफल" - -#~ msgid "Server: %1" -#~ msgstr "सर्वरः %1" - -#~ msgid "<br />Provider: %1" -#~ msgstr "<br />प्रदाता: %1" - -#~ msgid "<br />Version: %1" -#~ msgstr "<br />संस्करण: %1" - -#~ msgid "Provider information" -#~ msgstr "प्रदाता जानकारी" - -#~ msgid "Could not install %1" -#~ msgstr "%1 को संस्थापित नहीं किया जा सका" - -#~ msgid "Get Hot New Stuff!" -#~ msgstr "नया ताजा माल प्राप्त करें!" - -#~ msgid "There was an error loading data providers." -#~ msgstr "डाटा प्रोवाइडरों को लोड करने में त्रुटि हुई." - -#~ msgid "A protocol fault has occurred. The request has failed." -#~ msgstr "प्रोटोकाल अशुद्धि हुई. निवेदन असफल हुआ." - -#~ msgid "Desktop Exchange Service" -#~ msgstr "डेस्कटॉप एक्सचेंज सेवा" - -#~ msgid "A network error has occurred. The request has failed." -#~ msgstr "नेटवर्क त्रुटि हुई. निवेदन असफल हुआ" - -#~ msgid "&Source:" -#~ msgstr "स्रोत: (&S)" - -#~ msgid "?" -#~ msgstr "?" - -#~ msgid "&Order by:" -#~ msgstr "ऐसे जमाएँ: (&O)" - -#~ msgid "Enter search phrase here" -#~ msgstr "ढूंढा जाने वाला वाक्यांश यहां पर भरें" - -#~ msgid "Collaborate" -#~ msgstr "साझेदारी" - -#~ msgid "Rating: " -#~ msgstr "रेटिंग:" - -#~ msgid "Downloads: " -#~ msgstr "डाउनलोड:" - -#~ msgid "Install" -#~ msgstr "संस्थापित करें" - -#~ msgid "Uninstall" -#~ msgstr "अनइंस्टाल" - -#~ msgid "<p>No Downloads</p>" -#~ msgstr "<p>कोई डाउनलोड नहीं</p> " - -#~ msgid "<p>Downloads: %1</p>\n" -#~ msgstr "<p>डाउनलोड: %1</p>\n" - -#~ msgid "Update" -#~ msgstr "अद्यतन" - -#~ msgid "Rating: %1" -#~ msgstr "रेटिंग: %1" - -#~ msgid "No Preview" -#~ msgstr "पूर्वावलोकन नहीं" - -#~ msgid "Loading Preview" -#~ msgstr "पूर्वावलोकन लोड किया जा रहा है" - -#~ msgid "Comments" -#~ msgstr "टिप्पणियाँ" - -#~ msgid "Changelog" -#~ msgstr "चेंजलॉग" - -#~ msgid "Switch version" -#~ msgstr "संस्करण स्विच करें" - -#~ msgid "Contact author" -#~ msgstr "लेखक से सम्पर्क करें" - -#~ msgid "Collaboration" -#~ msgstr "साझेदारी" - -#~ msgid "Translate" -#~ msgstr "अनुवाद" - -#~ msgid "Subscribe" -#~ msgstr "सदस्यता लें" - -#~ msgid "Report bad entry" -#~ msgstr "खराब प्रविष्टि की रपट दें" - -#~ msgid "Send Mail" -#~ msgstr "डाक भेजें" - -#~ msgid "Contact on Jabber" -#~ msgstr "जैबर पर सम्पर्क" - -#~ msgid "Provider: %1" -#~ msgstr "प्रदाता: %1" - -#~ msgid "Version: %1" -#~ msgstr "संस्करण %1" - -#~ msgid "The removal request was successfully registered." -#~ msgstr "मिटाने का निवेदन सफलता पूर्वक पंजीकृत किया गया." - -#~ msgid "Removal of entry" -#~ msgstr "प्रविष्टि मिटाना" - -#~ msgid "The removal request failed." -#~ msgstr "मिटाने का निवेदन असफल." - -#~ msgid "The subscription was successfully completed." -#~ msgstr "सब्सक्रिप्शन सफलता पूर्वक सम्पन्न" - -#~ msgid "Subscription to entry" -#~ msgstr "प्रविष्टि का सब्सक्रिप्शन" - -#~ msgid "The subscription request failed." -#~ msgstr "सब्सक्रिप्शन निवेदन असफल" - -#~ msgid "The rating was submitted successfully." -#~ msgstr "दरजा सफलतापूर्वक जमा किया गया." - -#~ msgid "Rating for entry" -#~ msgstr "प्रविष्टि के लिए दरजा" - -#~ msgid "The rating could not be submitted." -#~ msgstr "दरजा जमा नहीं किया जा सका." - -#~ msgid "The comment was submitted successfully." -#~ msgstr "टिप्पणी सफलता पूर्वक जमा किया गया." - -#~ msgid "Comment on entry" -#~ msgstr "प्रविष्टि पर टिप्पणी" - -#~ msgid "The comment could not be submitted." -#~ msgstr "टिप्पणी जमा नहीं किया जा सका." - -#~ msgid "KNewStuff contributions" -#~ msgstr "के-न्यू-स्टफ़ में सहयोग" - -#~ msgid "This operation requires authentication." -#~ msgstr "इस प्रक्रिया को प्रमाणीकरण की आवश्यकता है." - -#~ msgid "Version %1" -#~ msgstr "संस्करण %1" - -#~ msgid "Leave a comment" -#~ msgstr "टिप्पणियाँ छोड़ें" - -#~ msgid "User comments" -#~ msgstr "उपयोक्ता टिप्पणियाँ" - -#~ msgid "Rate this entry" -#~ msgstr "इस प्रविष्टि को दरजा दें" - -#~ msgid "Translate this entry" -#~ msgstr "इस प्रविष्टि का अनुवाद करें" - -#~ msgid "Payload" -#~ msgstr "पेलोड" - -#~ msgid "Download New Stuff..." -#~ msgstr "ताज़ा सामग्री डाउनलोड करें" - -#~ msgid "Hot New Stuff Providers" -#~ msgstr "नई ताज़ा सामग्रियों के प्रदायक" - -#~ msgid "Please select one of the providers listed below:" -#~ msgstr "कृपया नीचे सूची में दिए प्रोवाइडर्स में से एक चुनें:" - -#~ msgid "No provider selected." -#~ msgstr "कोई प्रोवाइडर चयनित नहीं." - -#~ msgid "Share Hot New Stuff" -#~ msgstr "नए ताज़ा सामग्रियों का साझा करें" - -#~ msgctxt "Program name followed by 'Add On Uploader'" -#~ msgid "%1 Add-On Uploader" -#~ msgstr "%1 एड-ऑन अपलोडर" - -#~ msgid "Please put in a name." -#~ msgstr "कृपया नाम भरें" - -#~ msgid "Old upload information found, fill out fields?" -#~ msgstr "पुराना अपलोड जानकारी मिला, फ़ील्ड्स को भरें?" - -#~ msgid "Fill Out" -#~ msgstr "भरें" - -#~ msgid "Do Not Fill Out" -#~ msgstr "नहीं भरें" - -#~ msgid "Author:" -#~ msgstr "लेखकः" - -#~ msgid "Email address:" -#~ msgstr "ई-मेल पताः" - -#~ msgid "License:" -#~ msgstr "लाइसेंस:" - -#~ msgid "GPL" -#~ msgstr "जीपीएल" - -#~ msgid "LGPL" -#~ msgstr "एलजीपीएल" - -#~ msgid "BSD" -#~ msgstr "बीएसडी" - -#~ msgid "Preview URL:" -#~ msgstr "पूर्वावलोकन यूआरएल:" - -#~ msgid "Language:" -#~ msgstr "भाषा:" - -#~ msgid "In which language did you describe the above?" -#~ msgstr "किस भाषा में आपने ऊपर दिया गया वर्णन किया है?" - -#~ msgid "Please describe your upload." -#~ msgstr "अपने अपलोड का वर्णन करें." - -#~ msgid "Summary:" -#~ msgstr "सारांशः" - -#~ msgid "Please give some information about yourself." -#~ msgstr "कृपया अपने बारे में उचित जानकारी दें." - -#~ msgctxt "" -#~ "the price of a download item, parameter 1 is the currency, 2 is the price" -#~ msgid "" -#~ "This item costs %1 %2.\n" -#~ "Do you want to buy it?" -#~ msgstr "" -#~ "वस्तु की कीमत %1 %2 है.\n" -#~ "क्या आप इसे खरीदेंगें?" - -#~ msgid "" -#~ "Your account balance is too low:\n" -#~ "Your balance: %1\n" -#~ "Price: %2" -#~ msgstr "" -#~ "खाते में बकाया बहुत कम है:\n" -#~ "बकाया : %1\n" -#~ "कीमत : %2" - -#~ msgctxt "voting for an item (good/bad)" -#~ msgid "Your vote was recorded." -#~ msgstr "आपका मतदान दर्ज किया गया" - -#~ msgid "You are now a fan." -#~ msgstr "आप चहेते बन गए" - -#~ msgid "Network error. (%1)" -#~ msgstr "नेटवर्क त्रुटि. (%1)" - -#~ msgid "Too many requests to server. Please try again in a few minutes." -#~ msgstr "सर्वर को बहुत अधिक अनुरोध. कुछ मिनटों में फिर कोशिश करें." - -#~ msgid "Initializing" -#~ msgstr "संस्थापित हो रहा" - -#~ msgid "Configuration file not found: \"%1\"" -#~ msgstr "कॉन्फ़िगरेशन फ़ाइल नहीं मिला: \"%1\"" - -#~ msgid "Configuration file is invalid: \"%1\"" -#~ msgstr "कॉन्फ़िगरेशन फ़ाइल अवैध है: \"%1\"" - -#~ msgid "Loading provider information" -#~ msgstr "प्रदाता जानकारी लोड हो रहा है..." - -#~ msgid "Loading data" -#~ msgstr "डॉटा लोड किया जा रहा है" - -#~ msgid "Loading data from provider" -#~ msgstr "प्रदाता से डॉटा लोड हो रहा है" - -#~ msgid "Loading one preview" -#~ msgid_plural "Loading %1 previews" -#~ msgstr[0] "पूर्वावलोकन लोड किया जा रहा है" -#~ msgstr[1] "%1 पूर्वावलोकन लोड किए जा रहे हैं" - -#~ msgid "Installing" -#~ msgstr "संस्थापित हो रहा" - -#~ msgid "Invalid item." -#~ msgstr "अवैध मद." - -#~ msgid "Download of \"%1\" failed, error: %2" -#~ msgstr "\"%1\" का डाउनलोड विफल, त्रुटि: %2" - -#~ msgid "Possibly bad download link" -#~ msgstr "शायद खराब डाउनलोड लिंक" - -#~ msgid "Could not install \"%1\": file not found." -#~ msgstr "%1 को संस्थापित नहीं किया जा सका: फ़ाइल नहीं मिला." - -#~ msgid "Overwrite existing file?" -#~ msgstr "मोजूदा फ़ाइल मिटाकर लिखें?" - -#, fuzzy -#~| msgid "Download File:" -#~ msgid "Download File" -#~ msgstr "फ़ाइल डाउनलोड" - -#~ msgid "Icons view mode" -#~ msgstr "प्रतीक दृश्य मोड" - -#~ msgid "Details view mode" -#~ msgstr "विवरण दृश्य मोड" - -#~ msgid "All Providers" -#~ msgstr "सभी प्रदाता" - -#~ msgid "All Categories" -#~ msgstr "सभी वर्ग" - -#~ msgid "Provider:" -#~ msgstr "प्रदाता:" - -#~ msgid "Category:" -#~ msgstr "श्रेणी:" - -#~ msgid "Newest" -#~ msgstr "नवीनतम" - -#~ msgid "Rating" -#~ msgstr "रेटिंग" - -#~ msgid "Most downloads" -#~ msgstr "अधिकतम डाउनलोड्स" - -#~ msgid "Installed" -#~ msgstr "स्थापित" - -#~ msgid "Order by:" -#~ msgstr "ऐसे जमाएँ" - -#~ msgid "Search:" -#~ msgstr "ढूंढें:" - -#~ msgid "<a href=\"http://opendesktop.org\">Homepage</a>" -#~ msgstr "<a href=\"http://opendesktop.org\">मुखपृष्ठ</a>" - -#~ msgid "Become a Fan" -#~ msgstr "चहेते बनें" - -#~ msgid "Details for %1" -#~ msgstr "%1 के लिए विवरण" - -#~ msgid "Changelog:" -#~ msgstr "बदली खाता" - -#~ msgctxt "A link to the description of this Get Hot New Stuff item" -#~ msgid "Homepage" -#~ msgstr "मुख पृष्ठ" - -#~ msgctxt "" -#~ "A link to make a donation for a Get Hot New Stuff item (opens a web " -#~ "browser)" -#~ msgid "Make a donation" -#~ msgstr "एक दान करें" - -#~ msgctxt "A link to the knowledgebase (like a forum) (opens a web browser)" -#~ msgid "Knowledgebase (no entries)" -#~ msgid_plural "Knowledgebase (%1 entries)" -#~ msgstr[0] "ज्ञानकोश (कोई प्रविष्टि नहीं)" -#~ msgstr[1] "ज्ञानकोश (%1 प्रविष्टियाँ)" - -#~ msgctxt "Tooltip for a link in a dialog" -#~ msgid "Opens in a browser window" -#~ msgstr "नए ब्राउसर विंडो में खोलें" - -#~ msgid "Rating: %1%" -#~ msgstr "रेटिंग: %1%" - -#~ msgctxt "Show the author of this item in a list" -#~ msgid "By <i>%1</i>" -#~ msgstr "<i>%1</i>से" - -#~ msgctxt "fan as in supporter" -#~ msgid "1 fan" -#~ msgid_plural "%1 fans" -#~ msgstr[0] "१ पंखा" -#~ msgstr[1] "%1 पंखे" - -#~ msgid "1 download" -#~ msgid_plural "%1 downloads" -#~ msgstr[0] "१ डाउनलोड" -#~ msgstr[1] "%1 डाउनलोड" - -#~ msgid "Updating" -#~ msgstr "अद्यतन हो रहा" - -#~ msgid "Install Again" -#~ msgstr "फिर स्थापित करें" - -#~ msgid "Fetching license data from server..." -#~ msgstr "सर्वर से लइसेंस डॉटा पा रहा है..." - -#~ msgid "Fetching content data from server..." -#~ msgstr "सर्वर से सामाग्री डॉटा पा रहा है..." - -#~ msgid "Checking login..." -#~ msgstr "लॉगिन जांचें" - -#~ msgid "Could not verify login, please try again." -#~ msgstr "आपका लॉगित जाँट नही पाए, फिर कोशिश करें." - -#~ msgid "Fetching your previously updated content finished." -#~ msgstr "पहले अद्यतित सामाग्री पाना सफल" - -#~ msgid "Fetching content data from server finished." -#~ msgstr "सर्वर से सामाग्री डॉटा पाना सफल" - -#~ msgctxt "" -#~ "A link to the website where the get hot new stuff upload can be seen" -#~ msgid "Visit website" -#~ msgstr "वेबसाईट पर जाएँ" - -#~ msgid "File not found: %1" -#~ msgstr "फ़ाइल नहीं मिला : %1" - -#~ msgid "Upload Failed" -#~ msgstr "अपलोड विफल" - -#~ msgid "The selected category \"%1\" is invalid." -#~ msgstr "चयनित वर्ग \"%1\" अवैध है." - -#~ msgid "Select preview image" -#~ msgstr "पूर्वालोकन की छवि चुनें" - -#~ msgid "There was a network error." -#~ msgstr "नेटवर्क त्रुटि थी" - -#~ msgid "Uploading Failed" -#~ msgstr "अपलोड विफल" - -#~ msgid "Authentication error." -#~ msgstr "प्रमानीकरण त्रुटि" - -#~ msgid "Upload failed: %1" -#~ msgstr "अपलोड विफल: %1" - -#~ msgid "File to upload:" -#~ msgstr "अपलोड के लिए फ़ाइल:" - -#~ msgid "New Upload" -#~ msgstr "नया अपलोड" - -#~ msgid "Please fill out the information about your upload in English." -#~ msgstr "कृपया अपने बारे में उचित जानकारी दें." - -#~ msgid "Name of the file as it will appear on the website" -#~ msgstr "फ़ाईल नाम जैसा वेबसाईट पर दिखेगा" - -#~ msgid "" -#~ "This should clearly describe the file content. It can be the same text as " -#~ "the title of the kvtml file." -#~ msgstr "" -#~ "यहाँ फ़ाईल समाग्री के बारें में सपष्ट बताएँ. यह पाठ kvtml शीर्षक जैसा भी हो सकता है." - -#~ msgid "Preview Images" -#~ msgstr "पूर्वावलोकन छवियाँ" - -#~ msgid "Select Preview..." -#~ msgstr "पूर्वावलोकन चुनें..." - -#~ msgid "Set a price for this item" -#~ msgstr "इस मद के लिए मूल्य तय करें" - -#~ msgid "Price" -#~ msgstr "मूल्य" - -#~ msgid "Price:" -#~ msgstr "मूल्य:" - -#~ msgid "Reason for price:" -#~ msgstr "मूल्य का कारण" - -#~ msgid "Fetch content link from server" -#~ msgstr "लिंक सामाग्री सर्वर से निकालें" - -#~ msgid "Create content on server" -#~ msgstr "सर्वर पर सामाग्री " - -#~ msgid "Upload content" -#~ msgstr "सामाग्री अपलोड करें" - -#~ msgid "Upload first preview" -#~ msgstr "पहला पूर्वावलोकन अपलोड करें" - -#~ msgid "Note: You can edit, update and delete your content on the website." -#~ msgstr "टीप: आप वेबसाईट की सामाग्री अद्यतित, संपादित या मिटा सकते हैं" - -#~ msgid "Upload second preview" -#~ msgstr "दूसरा पूर्वावलोकन अपलोड करें" - -#~ msgid "Upload third preview" -#~ msgstr "तीसरा पूर्वावलोकन अपलोड करें" - -#~ msgid "Start Upload" -#~ msgstr "अपलोड प्रारंभ करें" - -#~ msgid "Play a &sound" -#~ msgstr "ध्वनि बजाएँ" - -#~ msgid "Select the sound to play" -#~ msgstr "बजाने के लिए ध्वनि चुनें" - -#~ msgid "Show a message in a &popup" -#~ msgstr "पाप अप विंडो में संदेश दिखाएँ (&p)" - -#~ msgid "Log to a file" -#~ msgstr "एक फ़ाइल में लॉग करें" - -#~ msgid "Mark &taskbar entry" -#~ msgstr "कार्य पट्टी प्रविष्टि चिह्नित करें (&t)" - -#~ msgid "Run &command" -#~ msgstr "कमांड चलाएँ(&R)" - -#~ msgid "Select the command to run" -#~ msgstr "चलाने के लिए कमांड चुनें" - -#~ msgid "Sp&eech" -#~ msgstr "भाषण (&e)" - -#~ msgid "Speak Event Message" -#~ msgstr "घटना संदेश बोलें" - -#~ msgid "Speak Event Name" -#~ msgstr "घटना नाम बोलें" - -#~ msgid "Speak Custom Text" -#~ msgstr "मनपसंद पाठ बोलें" - -#~ msgid "Configure Notifications" -#~ msgstr "सूचनाएँ कॉन्फ़िगर करें" - -#~ msgctxt "State of the notified event" -#~ msgid "State" -#~ msgstr "स्थिति" - -#~ msgctxt "Title of the notified event" -#~ msgid "Title" -#~ msgstr "शीर्षक" - -#~ msgctxt "Description of the notified event" -#~ msgid "Description" -#~ msgstr "वर्णन" - -#~ msgid "<qt>Do you want to search the Internet for <b>%1</b>?</qt>" -#~ msgstr "<qt>क्या आप इंटरनेट की छानबीन <b>%1</b> के लिए करना चाहते हैं?</qt>" - -#~ msgid "Internet Search" -#~ msgstr "इंटरनेट में ढूंढें" - -#~ msgid "&Search" -#~ msgstr "ढूंढें (&S)" - -#~ msgctxt "@label Type of file" -#~ msgid "Type: %1" -#~ msgstr "प्रकार: %1" - -#~ msgctxt "@label:checkbox" -#~ msgid "Remember action for files of this type" -#~ msgstr "इस प्रकार की फ़ाइलों के लिए क्रिया याद रखें" - -#~ msgctxt "@label:button" -#~ msgid "&Open with %1" -#~ msgstr "%1 के साथ खोलें (&O)" - -#~ msgctxt "@action:inmenu" -#~ msgid "Open &with %1" -#~ msgstr " %1 के साथ खोलें (&w)" - -#~ msgctxt "@info" -#~ msgid "Open '%1'?" -#~ msgstr "'%1' खोलें ?" - -#~ msgctxt "@label:button" -#~ msgid "&Open with..." -#~ msgstr "के साथ खोलें...(&O)" - -#~ msgctxt "@label:button" -#~ msgid "&Open with" -#~ msgstr "के साथ खोलें...(&O)" - -#~ msgctxt "@label:button" -#~ msgid "&Open" -#~ msgstr "खोलें (&O)" - -#~ msgctxt "@label File name" -#~ msgid "Name: %1" -#~ msgstr "नामः %1" - -#~ msgctxt "@info:whatsthis" -#~ msgid "This is the file name suggested by the server" -#~ msgstr "सर्वर द्वारा सुझाया फ़ाइल नाम यह है" - -#~ msgid "Do you really want to execute '%1'?" -#~ msgstr "क्या आप '%1' को सचमुच चलाना चाहेंगे? " - -#~ msgid "Execute File?" -#~ msgstr "फ़ाइल चलाएँ?" - -#~ msgid "Accept" -#~ msgstr "स्वीकृत" - -#~ msgid "Reject" -#~ msgstr "अस्वीकृत" - -#~ msgid "Untitled" -#~ msgstr "बिना शीर्षक" - -#~ msgid "" -#~ "The document \"%1\" has been modified.\n" -#~ "Do you want to save your changes or discard them?" -#~ msgstr "" -#~ "दस्तावेज़ \"%1\" परिवर्तित किया गया है.\n" -#~ "क्या आप इसे सहेजना चाहेंगे या परिवर्तनों को फेंक दें?" - -#~ msgid "Close Document" -#~ msgstr "दस्तावेज़ बन्द करें" - -#~ msgid "Error reading from PTY" -#~ msgstr "पीटीवाई से पढ़ने में त्रुटि" - -#~ msgid "Error writing to PTY" -#~ msgstr "पीटीवाई पर लिखने में त्रुटि हुई" - -#~ msgid "PTY operation timed out" -#~ msgstr "पीटीवाई ऑपरेशन टाइमआउट" - -#~ msgid "Error opening PTY" -#~ msgstr "पीटीवाई खोलने में त्रुटि" - -#~ msgid "Kross" -#~ msgstr "क्रास" - -#~ msgid "KDE application to run Kross scripts." -#~ msgstr "क्रॉस स्क्रिप्ट को चलाने के लिए केडीई अनुप्रयोग." - -#~ msgid "(C) 2006 Sebastian Sauer" -#~ msgstr "(c) 2006 सेबेस्तियन साए" - -#~ msgid "Run Kross scripts." -#~ msgstr "क्रास स्क्रिप्ट चलाएँ." - -#~ msgid "Sebastian Sauer" -#~ msgstr "सेबेस्टियन साए" - -#~ msgid "Scriptfile" -#~ msgstr "स्क्रिप्ट-फ़ाइल" - -#~ msgid "Scriptfile \"%1\" does not exist." -#~ msgstr "स्क्रिप्ट फ़ाइल \"%1\" अस्तित्व में नहीं है." - -#~ msgid "Failed to determine interpreter for scriptfile \"%1\"" -#~ msgstr "स्क्रिप्ट फ़ाइल \"%1\" के लिए इंटरप्रेटर का पता लगाने में असफल" - -#~ msgid "Failed to open scriptfile \"%1\"" -#~ msgstr "स्क्रिप्ट फ़ाइल \"%1\" खोलने में असफल" - -#~ msgid "Failed to load interpreter \"%1\"" -#~ msgstr "इंटरप्रेटर \"%1\" को लोड करने में असफल" - -#~ msgid "No such interpreter \"%1\"" -#~ msgstr "ऐसा कोई इंटरप्रेटर नहीं \"%1\"" - -#~ msgid "Failed to create script for interpreter \"%1\"" -#~ msgstr "इंटरप्रेटर \"%1\" के लिए स्क्रिप्ट बनाने में असफल" - -#~ msgid "Level of safety of the Ruby interpreter" -#~ msgstr "रूबी इंटरप्रेटर का सुरक्षा स्तर" - -#~ msgid "Cancel?" -#~ msgstr "रद्द करें?" - -#~ msgid "No such function \"%1\"" -#~ msgstr "ऐसा कोई फंक्शन नहीं \"%1\"" - -#~ msgid "Text:" -#~ msgstr "पाठः" - -#~ msgid "Comment:" -#~ msgstr "टिप्पणीः" - -#~ msgid "Icon:" -#~ msgstr "प्रतीकः" - -#~ msgid "Interpreter:" -#~ msgstr "इन्टरप्रेटर:" - -#~ msgid "File:" -#~ msgstr "फ़ाइलः" - -#~ msgid "Execute the selected script." -#~ msgstr "चयनित स्क्रिप्ट चलाएँ" - -#~ msgid "Stop execution of the selected script." -#~ msgstr "चयनित स्क्रिप्ट का चलाना रोकें" - -#~ msgid "Edit..." -#~ msgstr "संपादन..." - -#~ msgid "Edit selected script." -#~ msgstr "चयनित स्क्रिप्ट संपादित करें." - -#~ msgid "Add..." -#~ msgstr "जोड़ें..." - -#~ msgid "Add a new script." -#~ msgstr "नया स्क्रिप्ट जोड़ें." - -#~ msgid "Remove selected script." -#~ msgstr "चयनित स्क्रिप्ट हटायें" - -#~ msgid "Edit" -#~ msgstr "संपादन" - -#~ msgctxt "@title:group Script properties" -#~ msgid "General" -#~ msgstr "सामान्य" - -#~ msgid "The module %1 could not be found." -#~ msgstr "मॉड्यूल %1 नहीं मिला." - -#~ msgid "" -#~ "<qt><p>The diagnosis is:<br />The desktop file %1 could not be found.</" -#~ "p></qt>" -#~ msgstr "<qt><p>डायग्नोस्टिक्स है:<br /> डेस्कटॉप फ़ाइल %1 नहीं मिला.</p></qt>" - -#~ msgid "The module %1 is disabled." -#~ msgstr "मॉड्यूल %1 अक्षम है." - -#~ msgid "" -#~ "<qt><p>Either the hardware/software the module configures is not " -#~ "available or the module has been disabled by the administrator.</p></qt>" -#~ msgstr "" -#~ "<qt><p>या तो हार्डवेयर / सॉफ़्टवेयर मॉड्यूल कॉन्फिगर उपलब्ध नहीं हैं या मॉड्यूल को " -#~ "प्रशासक द्वारा अक्षम किया गया है.</p></qt>" - -#~ msgid "The module %1 is not a valid configuration module." -#~ msgstr "मॉड्यूल %1 वैध कॉन्फ़िगरेशन मॉड्यूल नहीं है." - -#~ msgid "" -#~ "<qt>The diagnosis is:<br />The desktop file %1 does not specify a library." -#~ "</qt>" -#~ msgstr "" -#~ "<qt>निदान है:<br />डेस्कटॉप फ़ाइल %1 किसी लाइब्रेरी को निर्दिष्ट नहीं करता.</qt>" - -#~ msgid "There was an error loading the module." -#~ msgstr "मॉड्यूल को लोड करने में त्रुटि हुई." - -#~ msgctxt "Argument is application name" -#~ msgid "This configuration section is already opened in %1" -#~ msgstr "%1 में कॉन्फ़िगरेशन खण्ड पहले ही खोला गया है" - -#~ msgid "" -#~ "The settings of the current module have changed.\n" -#~ "Do you want to apply the changes or discard them?" -#~ msgstr "" -#~ "वर्तमान मोड्यूल के सेटिंग परिवर्तित हो गए है.\n" -#~ "क्या आप इसे सहेजना चाहेंगे या परिवर्तनों को फेंक दें?" - -#~ msgid "Apply Settings" -#~ msgstr "विन्यास लगाएँ" - -#~ msgid "Distance between desktop icons" -#~ msgstr "डेस्कटॉप प्रतीक के बीच दूरी" - -#~ msgid "The distance between icons specified in pixels." -#~ msgstr "प्रतीकों के बीच की दूरी पिक्सेल में निर्धारित है." - -#~ msgid "Widget style to use" -#~ msgstr "विजेट शैली जो उपयोग में लिए जाने हैं" - -#~ msgid "" -#~ "The name of the widget style, for example \"keramik\" or \"plastik\". " -#~ "Without quotes." -#~ msgstr "" -#~ "विजेट शैली का नाम, उदाहरण के लिए, \"keramik\" or \"plastik\". उद्धरण चिह्नों के " -#~ "बगैर." - -#~ msgid "Use the PC speaker" -#~ msgstr "पीसी स्पीकर उपयोग करें" - -#~ msgid "" -#~ "Whether the ordinary PC speaker should be used instead of KDE's own " -#~ "notifications system." -#~ msgstr "" -#~ "क्या केडीई के स्वयं के सूचना तंत्र के बजाए साधारण पीसी स्पीकर का इस्तेमाल किया जाए." - -#~ msgid "What terminal application to use" -#~ msgstr "कौन सा टर्मिनल अनुप्रयोग उपयोग में लिया जाना है" - -#~ msgid "" -#~ "Whenever a terminal application is launched this terminal emulator " -#~ "program will be used.\n" -#~ msgstr "" -#~ "जब भी कोई टर्मिनल अनुप्रयोग चालू किया जाता है तो यह टर्मिनल एमुलेटर प्रोग्राम प्रयोग " -#~ "किया जाएगा.\n" - -#~ msgid "Fixed width font" -#~ msgstr "स्थिर चौड़ाई फ़ॉन्ट" - -#~ msgid "" -#~ "This font is used when a fixed font is needed. A fixed font has a " -#~ "constant width.\n" -#~ msgstr "" -#~ "जब फ़िक्स फ़ॉन्ट आवश्यक होगा तो यह फ़ॉन्ट प्रयोग में लिया जाएगा. फ़िक्स फ़ॉन्ट में स्थिर " -#~ "चौड़ाई होती है .\n" - -#~ msgid "System wide font" -#~ msgstr "तंत्र फ़ॉन्ट" - -#~ msgid "Font for menus" -#~ msgstr "मेन्यू के लिए फ़ॉन्ट" - -#~ msgid "What font to use for menus in applications." -#~ msgstr "अनुप्रयोगों के मेन्यू में कौन सा फ़ॉन्ट इस्तेमाल करें." - -#~ msgid "Color for links" -#~ msgstr "कड़ियों के लिए रंग" - -#~ msgid "What color links should be that have not yet been clicked on" -#~ msgstr "जिन कड़ियों में अभी क्लिक नहीं हुआ है उनके रंग क्या होंगे." - -#~ msgid "Color for visited links" -#~ msgstr "भ्रमण की जा चुकी कड़ियों के लिए रंग" - -#~ msgid "Font for the taskbar" -#~ msgstr "कार्यपट्टी के लिए फ़ॉन्ट" - -#~ msgid "" -#~ "What font to use for the panel at the bottom of the screen, where the " -#~ "currently running applications are." -#~ msgstr "" -#~ "स्क्रीन के नीचे फलक पर जहाँ वर्तमान में चल रहे अनुप्रयोग हैं वहाँ कौन सा फ़ॉन्ट इस्तेमाल " -#~ "किया जाए." - -#~ msgid "Fonts for toolbars" -#~ msgstr "औजारपट्टी के लिए फ़ॉन्ट" - -#~ msgid "Shortcut for taking screenshot" -#~ msgstr "स्क्रीनशॉट लेने के लिए शॉर्टकट" - -#~ msgid "Shortcut for toggling Clipboard Actions on and off" -#~ msgstr "क्लिपबोर्ड क्रिया को चालू बन्द करने के लिए टॉगल करने हेतु शॉर्ट कट" - -#~ msgid "Shortcut for shutting down the computer without confirmation" -#~ msgstr "बिना पुष्टि किए कम्प्यूटर को बन्द करने हेतु शॉर्टकट" - -#~ msgid "Show directories first" -#~ msgstr "पहले डिरेक्ट्री दिखाएँ" - -#~ msgid "" -#~ "Whether directories should be placed at the top when displaying files" -#~ msgstr "जब फ़ाइलें प्रदर्शित की जा रही हों तो क्या डिरेक्ट्रियों को शीर्ष पर रखना है" - -#~ msgid "The URLs recently visited" -#~ msgstr "वर्तमान में भ्रमण किए गए हालिया यूआरएल" - -#~ msgid "Used for auto-completion in file dialogs, for example" -#~ msgstr "उदाहरण के लिए, फ़ाइल संवाद में स्वतःपूर्णता के लिए इस्तेमाल किया जाता है." - -#~ msgid "Show file preview in file dialog" -#~ msgstr "फ़ाइल संवाद में फ़ाइल पूर्वावलोकन दिखाएँ" - -#~ msgid "Show hidden files" -#~ msgstr "छुपी फ़ाइलें दिखाएँ" - -#~ msgid "" -#~ "Whether files starting with a dot (convention for hidden files) should be " -#~ "shown" -#~ msgstr "" -#~ "निर्धारित करता है कि फ़ाइलें जो डॉट एक्सटेंशन से प्रारंभ होती हैं (छुपी फ़ाइलों के लिए " -#~ "प्रचलित) दिखाई जाएँ" - -#~ msgid "Show speedbar" -#~ msgstr "स्पीडबार दिखायें" - -#~ msgid "" -#~ "Whether the shortcut icons to the left in the file dialog should be shown" -#~ msgstr "फ़ाइल संवाद में क्या शॉर्टकट प्रतीक बाईं ओर दिखाई जाएँ" - -#~ msgid "What country" -#~ msgstr "कौन सा देश" - -#~ msgid "" -#~ "Used to determine how to display numbers, currency and time/date, for " -#~ "example" -#~ msgstr "" -#~ "उदाहरण के लिए, संख्या, करेंसी, समय/तिथि इत्यादि कैसे दिखाएँ यह निर्धारित करने हेतु " -#~ "इस्तेमाल किया जाता है." - -#~ msgid "What language to use to display text" -#~ msgstr "इसमें पाठ किस भाषा में प्रदर्शित करना है" - -#~ msgid "Character used for indicating positive numbers" -#~ msgstr "धनात्मक संख्या को दिखाने के लिए इस्तेमाल किया जाने वाला अक्षर" - -#~ msgid "Most countries have no character for this" -#~ msgstr "इसके लिए बहुत से देशों में कोई अक्षर नहीं है" - -#~ msgid "Path to the autostart directory" -#~ msgstr "स्वतःप्रारंभ डिरेक्ट्री के लिए पथ" - -#~ msgid "" -#~ "Path to the directory containing executables to be run on session login" -#~ msgstr "सत्र लॉगिन करते समय चलाने योग्य फ़ाइलों की डिरेक्ट्री का पथ" - -#~ msgid "Enable SOCKS support" -#~ msgstr "सॉक्स समर्थन सक्षम करें" - -#~ msgid "Whether SOCKS version 4 and 5 should be enabled in KDE's sub systems" -#~ msgstr "क्या केडीई के सब_सिस्टम में सॉक्स संस्करण ४ तथा ५ सक्षम किया जाए" - -#~ msgid "Path to custom SOCKS library" -#~ msgstr "मनपसंद सॉक्स लाइब्रेरी का पथ" - -#~ msgid "Highlight toolbar buttons on mouse over" -#~ msgstr "माउस ओवर करने पर औजारपट्टी बटनों को उभारें" - -#~ msgid "Show text on toolbar icons " -#~ msgstr "औजारपट्टी प्रतीकों में पाठ दिखाएँ" - -#~ msgid "Whether text should be shown in addition to icons on toolbar icons" -#~ msgstr "क्या औजारपट्टी प्रतीकों में प्रतीक के अलावा पाठ भी दिखाया जाए" - -#~ msgid "Password echo type" -#~ msgstr "पासवर्ड इको क़िस्म" - -#~ msgid "The size of the dialog" -#~ msgstr "संवाद का आकार" - -#~ msgid "" -#~ "Automatic changes have been performed due to plugin dependencies. Click " -#~ "here for further information" -#~ msgstr "" -#~ "प्लगइन डिपेंडेंसीज़ के कारण स्वचालित परिवर्तन किए गए हैं. अधिक जानकारी के लिए यहाँ " -#~ "क्लिक करें" - -#~ msgid "" -#~ "Automatic changes have been performed in order to satisfy plugin " -#~ "dependencies:\n" -#~ msgstr "प्लगइन डिपेंडेंसीज़ संतुष्ट करने के लिए स्वचालित परिवर्तन किए गए हैं:\n" - -#~ msgid "" -#~ "\n" -#~ " %1 plugin has been automatically checked because of the dependency of " -#~ "%2 plugin" -#~ msgstr "" -#~ "\n" -#~ " %2 प्लगइन डिपेंडेसी के कारण %1 प्लगइनों को पहले ही चेक कर लिया गया है" - -#~ msgid "" -#~ "\n" -#~ " %1 plugin has been automatically unchecked because of its dependency " -#~ "on %2 plugin" -#~ msgstr "" -#~ "\n" -#~ " %2 प्लगइन डिपेंडेसी के कारण %1 प्लगइनों को पहले ही अनचेक कर लिया गया है" - -#~ msgid "Dependency Check" -#~ msgstr "डिपेंडेंसी जाँच" - -#~ msgid "%1 plugin automatically added due to plugin dependencies" -#~ msgid_plural "%1 plugins automatically added due to plugin dependencies" -#~ msgstr[0] "प्लगइन डिपेंडेंसीज़ के कारण %1 प्लगइन स्वचालित जोड़े गए हैं" -#~ msgstr[1] "प्लगइन डिपेंडेंसीज़ के कारण %1 प्लगइनों को स्वचालित जोड़े गए हैं" - -#~ msgid ", " -#~ msgstr ", " - -#~ msgid "%1 plugin automatically removed due to plugin dependencies" -#~ msgid_plural "%1 plugins automatically removed due to plugin dependencies" -#~ msgstr[0] "प्लगइन डिपेंडेंसीज़ के कारण %1 प्लगइन स्वचालित मिटाए गए हैं" -#~ msgstr[1] "प्लगइन डिपेंडेंसीज़ के कारण %1 प्लगइनों को स्वचालित स्वचालित मिटा दिए गए हैं" - -#~ msgid "Search Plugins" -#~ msgstr "खोज प्लगइन" - -#~ msgctxt "Used only for plugins" -#~ msgid "About %1" -#~ msgstr "%1 के बारे में" - -#~ msgid "Could not load print preview part" -#~ msgstr "छपाई पूर्वावलोकन भाग लोड नहीं किया जा सका" - -#~ msgid "Print Preview" -#~ msgstr "छपाई नमूना" - -#~ msgid "Select Components" -#~ msgstr "घटक चुनें " - -#~ msgid "Enable component" -#~ msgstr "अवयव सक्षम करें" - -#~ msgid "Success" -#~ msgstr "सफलता" - -#~ msgid "Communication error" -#~ msgstr "संचारण त्रुटि" - -#~ msgid "Invalid type in Database" -#~ msgstr "डाटाबेस में अवैध किस्म" - -#~ msgctxt "" -#~ "@title UDS_DISPLAY_NAME for a KIO directory listing. %1 is the query the " -#~ "user entered." -#~ msgid "Query Results from '%1'" -#~ msgstr "'%1' से क्वेरी के परिणाम" - -#~ msgctxt "@title UDS_DISPLAY_NAME for a KIO directory listing." -#~ msgid "Query Results" -#~ msgstr "क्वेरी परिणाम" - -#~ msgctxt "" -#~ "Boolean AND keyword in desktop search strings. You can add several " -#~ "variants separated by spaces, e.g. retain the English one alongside the " -#~ "translation; keywords are not case sensitive. Make sure there is no " -#~ "conflict with the OR keyword." -#~ msgid "and" -#~ msgstr "and और" - -#~ msgctxt "" -#~ "Boolean OR keyword in desktop search strings. You can add several " -#~ "variants separated by spaces, e.g. retain the English one alongside the " -#~ "translation; keywords are not case sensitive. Make sure there is no " -#~ "conflict with the AND keyword." -#~ msgid "or" -#~ msgstr "or या व" - -#~ msgid "(c) 2006-2009, Sebastian Trüg" -#~ msgstr "(C) 2006-2009 सेबेस्तिएन तृग" - -#~ msgid "Sebastian Trüg" -#~ msgstr "सेबेस्टियन तृग" - -#~ msgid "Maintainer" -#~ msgstr "अनुरक्षक" - -#~ msgid "Tobias Koenig" -#~ msgstr "टोबियास कोइनिग" - -#~ msgid "Verbose output debugging mode." -#~ msgstr "विस्तृत डिबग मोड आउटपुट" - -#~ msgid "Actually generate the code." -#~ msgstr "अब स्रोत बनाएँ" - -#~ msgctxt "@title:window" -#~ msgid "Change Tags" -#~ msgstr "टैग बदलें" - -#~ msgctxt "@title:window" -#~ msgid "Add Tags" -#~ msgstr "टैग जोडें" - -#~ msgctxt "@label:textbox" -#~ msgid "Configure which tags should be applied." -#~ msgstr "निश्चित करें कोनसे टैग लगाने हैं" - -#~ msgctxt "@label" -#~ msgid "Create new tag:" -#~ msgstr "नया टैग बनाएं :" - -#~ msgctxt "@info" -#~ msgid "Delete tag" -#~ msgstr "टैग मिटाएँ" - -#~ msgctxt "@info" -#~ msgid "" -#~ "Should the tag <resource>%1</resource> really be deleted for all files?" -#~ msgstr "क्या टैग <resource>%1</resource> को सभी फ़ाइलों के लिए हटाना है?" - -#~ msgctxt "@title" -#~ msgid "Delete tag" -#~ msgstr "टैग मिटाएँ" - -#~ msgctxt "@action:button" -#~ msgid "Delete" -#~ msgstr "मिटाएँ" - -#~ msgctxt "@action:button" -#~ msgid "Cancel" -#~ msgstr "रद्द करें" - -#~ msgid "Changing annotations" -#~ msgstr "एनोटेशन बदलना" - -#~ msgctxt "@label" -#~ msgid "Show all tags..." -#~ msgstr "सभी टैग दिखाएँ..." - -#~ msgctxt "@label" -#~ msgid "Add Tags..." -#~ msgstr "टैग जोड़ें..." - -#~ msgctxt "@label" -#~ msgid "Change..." -#~ msgstr "बदलें..." - -#~ msgctxt "" -#~ "referring to a filter on the modification and usage date of files/" -#~ "resources" -#~ msgid "Anytime" -#~ msgstr "कभी भी" - -#~ msgctxt "" -#~ "referring to a filter on the modification and usage date of files/" -#~ "resources" -#~ msgid "Today" -#~ msgstr "आज" - -#~ msgctxt "" -#~ "referring to a filter on the modification and usage date of files/" -#~ "resources" -#~ msgid "Yesterday" -#~ msgstr "कल" - -#~ msgctxt "" -#~ "referring to a filter on the modification and usage date of files/" -#~ "resources" -#~ msgid "This Week" -#~ msgstr "इस हफते" - -#~ msgctxt "" -#~ "referring to a filter on the modification and usage date of files/" -#~ "resources" -#~ msgid "Last Week" -#~ msgstr "पिछले सप्ताह" - -#~ msgctxt "" -#~ "referring to a filter on the modification and usage date of files/" -#~ "resources" -#~ msgid "This Month" -#~ msgstr "यह महिने" - -#~ msgctxt "" -#~ "referring to a filter on the modification and usage date of files/" -#~ "resources" -#~ msgid "Last Month" -#~ msgstr "पिछले माह" - -#~ msgctxt "" -#~ "referring to a filter on the modification and usage date of files/" -#~ "resources" -#~ msgid "This Year" -#~ msgstr "इस साल" - -#~ msgctxt "" -#~ "referring to a filter on the modification and usage date of files/" -#~ "resources" -#~ msgid "Last Year" -#~ msgstr "पिछले वर्ष" - -#~ msgctxt "" -#~ "referring to a filter on the modification and usage date of files/" -#~ "resources that will open a dialog to choose a date range" -#~ msgid "Custom..." -#~ msgstr "मनपसंद..." - -#~ msgid "This Week" -#~ msgstr "इस हफते" - -#~ msgid "This Month" -#~ msgstr "यह महिने" - -#~ msgid "Anytime" -#~ msgstr "कभी भी" - -#~ msgid "Before" -#~ msgstr "पहले" - -#~ msgid "After" -#~ msgstr "पश्चात" - -#~ msgctxt "" -#~ "@option:check An item in a list of resources that allows to query for " -#~ "more resources to put in the list" -#~ msgid "More..." -#~ msgstr "अधिक..." - -#~ msgctxt "@option:check A filter on file type" -#~ msgid "Documents" -#~ msgstr "दस्तावेज़" - -#~ msgctxt "@option:check A filter on file type - audio files" -#~ msgid "Audio" -#~ msgstr "ऑडियो" - -#~ msgctxt "@option:check A filter on file type - media video" -#~ msgid "Video" -#~ msgstr "वीडियो" - -#~ msgctxt "@option:check A filter on file type" -#~ msgid "Images" -#~ msgstr "चित्र" - -#~ msgctxt "" -#~ "@option:radio A filter on prioritizing/sorting a selection of resources" -#~ msgid "No priority" -#~ msgstr "कोई प्राथमिकता नहीं:" - -#~ msgctxt "" -#~ "@option:radio A filter on prioritizing/sorting a selection of resources" -#~ msgid "Last modified" -#~ msgstr "पिछली मर्तबा परिवर्धित" - -#~ msgctxt "" -#~ "@option:radio A filter on prioritizing/sorting a selection of resources" -#~ msgid "Most important" -#~ msgstr "सबसे महत्वपूर्ण" - -#~ msgctxt "" -#~ "@option:radio A filter on prioritizing/sorting a selection of resources" -#~ msgid "Never opened" -#~ msgstr "कभी नहीं खुला" - -#~ msgctxt "@option:radio A filter on the rating of a resource" -#~ msgid "Any Rating" -#~ msgstr "कोई भी रेटिंग" - -#~ msgctxt "@option:radio A filter on the rating of a resource" -#~ msgid "1 or more" -#~ msgstr "1 या अधिक" - -#~ msgctxt "@option:radio A filter on the rating of a resource" -#~ msgid "2 or more" -#~ msgstr "2 या अधिक" - -#~ msgctxt "@option:radio A filter on the rating of a resource" -#~ msgid "3 or more" -#~ msgstr "3 या अधिक" - -#~ msgctxt "@option:radio A filter on the rating of a resource" -#~ msgid "4 or more" -#~ msgstr "4 या अधिक" - -#~ msgctxt "@option:radio A filter on the rating of a resource" -#~ msgid "Max Rating" -#~ msgstr "अधिक्तम रेटिंग" - -#~ msgctxt "" -#~ "@title KCategorizedSortFilterProxyModel grouping for all Nepomukj " -#~ "resources that are of type rdfs:Resource" -#~ msgid "Miscellaneous" -#~ msgstr "विविध" - -#~ msgctxt "@title:column The Nepomuk resource label and icon" -#~ msgid "Resource" -#~ msgstr "संसाधन " - -#~ msgctxt "@title:column The Nepomuk resource's RDF type" -#~ msgid "Resource Type" -#~ msgstr "संसाधन क़िस्म" - -#~ msgid "Enter Search Terms..." -#~ msgstr "ढूंढा जाने वाला पद यहां पर भरें" - -#~ msgctxt "@option:check A filter on resource type" -#~ msgid "Contacts" -#~ msgstr "सम्पर्क" - -#~ msgctxt "@option:check A filter on resource type" -#~ msgid "Emails" -#~ msgstr "ईमेल" - -#~ msgctxt "@option:check A filter on resource type" -#~ msgid "Tasks" -#~ msgstr "कार्य" - -#~ msgctxt "@option:check A filter on resource type" -#~ msgid "Tags" -#~ msgstr "टैग्स" - -#~ msgctxt "@option:check Do filter on type - show only files" -#~ msgid "Files" -#~ msgstr "फ़ाइल " - -#~ msgctxt "@option:check Do filter on type - show everything but files" -#~ msgid "Other" -#~ msgstr "अन्य" - -#~ msgid "ThreadWeaver Jobs Examples" -#~ msgstr "थ्रेड वीवर जॉब उदाहरण" - -#~ msgid "" -#~ "The program executes 100 jobs in 4 threads. Each job waits for a random " -#~ "number of milliseconds between 1 and 1000." -#~ msgstr "" -#~ "प्रोग्राम ४ थ्रेड में १०० जॉब चलाता है. प्रत्येक जॉब १ से १००० मिलीसेकण्ड के बीच बेतरतीब " -#~ "मात्रा में इंतजार करता है." - -#~ msgid "" -#~ "Check to see logging information about thread activity. Watch the console " -#~ "output to see the log information." -#~ msgstr "" -#~ "थ्रेड सक्रियता के बारे में लॉगिंग जानकारी देखने हेतु चेक करें. लॉग जानकारी देखने के लिए " -#~ "कंसोल आउटपुट देखें." - -#~ msgid "Log thread activity" -#~ msgstr "थ्रेड सक्रियता लॉग करें" - -#~ msgid "Displays Thread Activity" -#~ msgstr "थ्रेड सक्रियता प्रदर्शित करता है" - -#~ msgid "Start" -#~ msgstr "प्रारंभ" - -#~ msgid "GUI based example for the Weaver Thread Manager" -#~ msgstr "वीवर थ्रेड प्रबंधक हेतु जीयूआई आधारित उदाहरण" - -#~ msgid "Remaining number of jobs:" -#~ msgstr "बचे हुए कार्यों की संख्या:" - -#~ msgid "What time is it? Click to update." -#~ msgstr "क्या समय हुआ है? अद्यतन करने के लिए क्लिक करें" - -#~ msgid "" -#~ "<html><head><meta name=\"qrichtext\" content=\"1\" /></head><body style=" -#~ "\" white-space: pre-wrap; font-family:Sans Serif; font-weight:400; font-" -#~ "style:normal; text-decoration:none;\"><p style=\" margin-top:0px; margin-" -#~ "bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-" -#~ "indent:0px;\">(do not know yet)</p></body></html>" -#~ msgstr "" -#~ "<html><head><meta name=\"qrichtext\" content=\"1\" /></head><body style=" -#~ "\" white-space: pre-wrap; font-family:Sans Serif; font-weight:400; font-" -#~ "style:normal; text-decoration:none;\"><p style=\" margin-top:0px; margin-" -#~ "bottom:0px; margin-left:0px; margin-right:0px; -qt-block-indent:0; text-" -#~ "indent:0px;\">(अभी तक पता नहीं)</p></body></html>" - -#~ msgid "Select Files..." -#~ msgstr "फ़ाइलें चुनें..." - -#~ msgid "Cancel" -#~ msgstr "रद्द करें" - -#~ msgid "Suspend" -#~ msgstr "निलम्बित" - -#~ msgid "Anonymous" -#~ msgstr "अज्ञातनाम" - -#~ msgctxt "@item font" -#~ msgid "Regular" -#~ msgstr "नियमित" - -#~ msgid "What's &This" -#~ msgstr "यह क्या है (&T)" - -#, fuzzy -#~| msgid "Next year" -#~ msgctxt "@option next week" -#~ msgid "Next week" -#~ msgstr "अगला वर्ष" - -#, fuzzy -#~ msgctxt "@option last week" -#~ msgid "Last week" -#~ msgstr "अंतिम पृष्ठ (&L)" - -#, fuzzy -#~| msgid "Today" -#~ msgctxt "@info/plain" -#~ msgid "today" -#~ msgstr "आज" - -#, fuzzy -#~ msgid "Hide Menubar" -#~ msgstr "मेन्यू पट्टी दिखाएँ (&M)" - -#, fuzzy -#~ msgid "Hide Statusbar" -#~ msgstr "स्थिति पट्टी दिखाएँ" - -#~ msgid "..." -#~ msgstr "..." - -#~ msgid "GroupBox 1" -#~ msgstr "समूह-बक्सा 1" - -#~ msgid "CheckBox" -#~ msgstr "चेकबॉक्स" - -#~ msgid "Other GroupBox" -#~ msgstr "अन्य समूह-बक्सा" - -#~ msgid "RadioButton" -#~ msgstr "रेडियो-बटन" - -#~ msgid "action1" -#~ msgstr "क्रिया1" - -#~ msgid "I like this" -#~ msgstr "मुझे ये पसंद है" - -#~ msgid "I do not like this" -#~ msgstr "मुझे ये पसंद नहीं है" - -#~ msgid "Additional domains for browsing" -#~ msgstr "ब्राउज़िंग के लिए अतिरिक्त डोमेन" - -#~ msgid "List of 'wide-area' (non link-local) domains that should be browsed." -#~ msgstr "'विस्तृत क्षेत्र' (नॉन लिंक_लोकल) डोमेन की सूची जिन्हें ब्राउज किया जाना है." - -#~ msgid "KrossTest" -#~ msgstr "क्रास जांच" - -#~ msgid "KDE application to test the Kross framework." -#~ msgstr "केडीई अनुप्रयोग जांचने के लिए केडीई अनुप्रयोग." - -#~ msgid "(C) 2005-2007 Sebastian Sauer" -#~ msgstr "(C) 2005-2007 सेबेस्तिएन साए" - -#~ msgid "Test the Kross framework!" -#~ msgstr "क्रॉस फ्रेमवर्क को जाँचें!" - -#~ msgid "Find stopped." -#~ msgstr "ढूंढना बंद हो गया." - -#~ msgid "Starting -- find links as you type" -#~ msgstr "प्रारंभ किया जा रहा है - लिंक को टाइप करते करते प्राप्त करें" - -#~ msgid "Starting -- find text as you type" -#~ msgstr "प्रारंभ किया जा रहा है - पाठ को टाइप करते करते प्राप्त करें" - -#~ msgid "Link found: \"%1\"." -#~ msgstr "कड़ी मिली: \"%1\"." - -#~ msgid "Link not found: \"%1\"." -#~ msgstr "कड़ी नहीं मिली: \"%1\"." - -#~ msgid "Text found: \"%1\"." -#~ msgstr "पाठ मिला: \"%1\"." - -#~ msgid "Text not found: \"%1\"." -#~ msgstr "पाठ नहीं मिला: \"%1\"." - -#~ msgctxt "@item Author name in about dialog" -#~ msgid "%1" -#~ msgstr "%1" - -#~ msgid "Sonnet Configuration" -#~ msgstr "सॉन्नेट कॉन्फ़िगरेशन" - -#~ msgid "Starting KTTSD Failed" -#~ msgstr "KTTSD चलाना विफल" diff -Nru kde-l10n-hi-4.12.97/messages/frameworks/kio5.po kde-l10n-hi-4.13.0/messages/frameworks/kio5.po --- kde-l10n-hi-4.12.97/messages/frameworks/kio5.po 2014-03-26 03:45:43.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/frameworks/kio5.po 1970-01-01 00:00:00.000000000 +0000 @@ -1,7219 +0,0 @@ -# translation of kio4.po to Hindi -# Copyright (C) YEAR This_file_is_part_of_KDE -# This file is distributed under the same license as the PACKAGE package. -# -# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007. -msgid "" -msgstr "" -"Project-Id-Version: kio4\n" -"Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-26 01:43+0000\n" -"PO-Revision-Date: 2007-11-17 17:50+0530\n" -"Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" -"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" -"Language: hi\n" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" -"Plural-Forms: nplurals=2; plural=(n!=1);\n" -"X-Generator: KBabel 1.11.4\n" - -#: autotests/jobtest.cpp:1035 -#, fuzzy -#| msgid "1 day %2" -#| msgid_plural "%1 days %2" -msgid "1 day 23:59:00" -msgstr "१ दिन %2" - -#: autotests/jobtest.cpp:1040 -msgid "00:00:50" -msgstr "" - -#: src/core/chmodjob.cpp:204 -#, fuzzy, kde-format -#| msgid "Could not change ownership for %1." -msgid "Could not modify the ownership of file %1" -msgstr "%1 के लिए मालिकाना बदल नहीं सकता." - -#: src/core/chmodjob.cpp:206 -#, kde-format -msgid "" -"<qt>Could not modify the ownership of file <b>%1</b>. You have insufficient " -"access to the file to perform the change.</qt>" -msgstr "" -"<qt>फ़ाइल <b>%1</b> का स्वामित्व परिवर्तित नहीं कर सकता. आपके पास परिवर्तन करने के " -"लिए अपर्याप्त पंहुच है.</qt>" - -#: src/core/copyjob.cpp:1081 src/core/job_error.cpp:503 -msgid "Folder Already Exists" -msgstr "फ़ोल्डर पहले से ही अस्तित्व में है" - -#: src/core/copyjob.cpp:1350 src/core/copyjob.cpp:1916 -#: src/core/filecopyjob.cpp:360 src/core/job_error.cpp:493 -#: src/widgets/paste.cpp:104 -msgid "File Already Exists" -msgstr "फ़ाइल पहले से ही अस्तित्व में है. " - -#: src/core/copyjob.cpp:1350 src/core/copyjob.cpp:1916 -msgid "Already Exists as Folder" -msgstr "पहले से ही फ़ोल्डर के रूप में है" - -#: src/core/global.cpp:79 -#, kde-format -msgctxt "size in bytes" -msgid "%1 B" -msgstr "" - -#: src/core/global.cpp:83 -#, kde-format -msgctxt "size in 1000 bytes" -msgid "%1 kB" -msgstr "" - -#: src/core/global.cpp:84 -#, kde-format -msgctxt "size in 10^6 bytes" -msgid "%1 MB" -msgstr "" - -#: src/core/global.cpp:85 -#, kde-format -msgctxt "size in 10^9 bytes" -msgid "%1 GB" -msgstr "" - -#: src/core/global.cpp:86 -#, kde-format -msgctxt "size in 10^12 bytes" -msgid "%1 TB" -msgstr "" - -#: src/core/global.cpp:87 -#, kde-format -msgctxt "size in 10^15 bytes" -msgid "%1 PB" -msgstr "" - -#: src/core/global.cpp:88 -#, kde-format -msgctxt "size in 10^18 bytes" -msgid "%1 EB" -msgstr "" - -#: src/core/global.cpp:89 -#, kde-format -msgctxt "size in 10^21 bytes" -msgid "%1 ZB" -msgstr "" - -#: src/core/global.cpp:90 -#, kde-format -msgctxt "size in 10^24 bytes" -msgid "%1 YB" -msgstr "" - -#: src/core/global.cpp:94 -#, kde-format -msgctxt "memory size in 1024 bytes" -msgid "%1 KB" -msgstr "" - -#: src/core/global.cpp:95 -#, kde-format -msgctxt "memory size in 2^20 bytes" -msgid "%1 MB" -msgstr "" - -#: src/core/global.cpp:96 -#, kde-format -msgctxt "memory size in 2^30 bytes" -msgid "%1 GB" -msgstr "" - -#: src/core/global.cpp:97 -#, kde-format -msgctxt "memory size in 2^40 bytes" -msgid "%1 TB" -msgstr "" - -#: src/core/global.cpp:98 -#, kde-format -msgctxt "memory size in 2^50 bytes" -msgid "%1 PB" -msgstr "" - -#: src/core/global.cpp:99 -#, kde-format -msgctxt "memory size in 2^60 bytes" -msgid "%1 EB" -msgstr "" - -#: src/core/global.cpp:100 -#, kde-format -msgctxt "memory size in 2^70 bytes" -msgid "%1 ZB" -msgstr "" - -#: src/core/global.cpp:101 -#, kde-format -msgctxt "memory size in 2^80 bytes" -msgid "%1 YB" -msgstr "" - -#: src/core/global.cpp:106 -#, kde-format -msgctxt "size in 1024 bytes" -msgid "%1 KiB" -msgstr "" - -#: src/core/global.cpp:107 -#, kde-format -msgctxt "size in 2^20 bytes" -msgid "%1 MiB" -msgstr "" - -#: src/core/global.cpp:108 -#, kde-format -msgctxt "size in 2^30 bytes" -msgid "%1 GiB" -msgstr "" - -#: src/core/global.cpp:109 -#, kde-format -msgctxt "size in 2^40 bytes" -msgid "%1 TiB" -msgstr "" - -#: src/core/global.cpp:110 -#, kde-format -msgctxt "size in 2^50 bytes" -msgid "%1 PiB" -msgstr "" - -#: src/core/global.cpp:111 -#, kde-format -msgctxt "size in 2^60 bytes" -msgid "%1 EiB" -msgstr "" - -#: src/core/global.cpp:112 -#, kde-format -msgctxt "size in 2^70 bytes" -msgid "%1 ZiB" -msgstr "" - -#: src/core/global.cpp:113 -#, kde-format -msgctxt "size in 2^80 bytes" -msgid "%1 YiB" -msgstr "" - -#: src/core/global.cpp:173 -#, kde-format -msgid "1 day %2" -msgid_plural "%1 days %2" -msgstr[0] "१ दिन %2" -msgstr[1] "%1 दिन %2" - -#: src/core/global.cpp:208 src/core/global.cpp:225 -#, fuzzy, kde-format -#| msgctxt "Items in a folder" -#| msgid "1 item" -#| msgid_plural "%1 items" -msgid "%1 Item" -msgid_plural "%1 Items" -msgstr[0] "१ वस्तु" -msgstr[1] "%1 वस्तुएँ" - -#: src/core/global.cpp:212 -#, fuzzy, kde-format -#| msgid "No Folders" -msgid "1 Folder" -msgid_plural "%1 Folders" -msgstr[0] "कोई फ़ोल्डर नहीं." -msgstr[1] "कोई फ़ोल्डर नहीं." - -#: src/core/global.cpp:213 -#, fuzzy, kde-format -#| msgid "1 file" -#| msgid_plural "%1 files" -msgid "1 File" -msgid_plural "%1 Files" -msgstr[0] "१ फ़ाइल" -msgstr[1] "%1 फ़ाइलें" - -#: src/core/global.cpp:216 -#, fuzzy, kde-format -#| msgctxt "Items (Folders, Files)" -#| msgid "%1 (%2, %3)" -msgctxt "folders, files (size)" -msgid "%1, %2 (%3)" -msgstr "%1 (%2, %3)" - -#: src/core/global.cpp:217 -#, fuzzy, kde-format -#| msgid "%1 (%2)" -msgctxt "folders, files" -msgid "%1, %2" -msgstr "%1 (%2)" - -#: src/core/global.cpp:219 -#, fuzzy, kde-format -#| msgid "%1 (%2)" -msgctxt "files (size)" -msgid "%1 (%2)" -msgstr "%1 (%2)" - -#: src/core/global.cpp:226 -#, fuzzy, kde-format -#| msgid "%1 (%2)" -msgctxt "items: folders, files (size)" -msgid "%1: %2" -msgstr "%1 (%2)" - -#: src/core/job.cpp:108 -msgctxt "@title job" -msgid "Moving" -msgstr "खिसकाते हुए " - -#: src/core/job.cpp:109 src/core/job.cpp:116 src/core/job.cpp:141 -#: src/widgets/fileundomanager.cpp:130 -#, fuzzy -#| msgid "Source" -msgctxt "The source of a file operation" -msgid "Source" -msgstr "स्रोत" - -#: src/core/job.cpp:110 src/core/job.cpp:117 -#: src/widgets/fileundomanager.cpp:131 -#, fuzzy -#| msgid "Destination" -msgctxt "The destination of a file operation" -msgid "Destination" -msgstr "गंतव्य" - -#: src/core/job.cpp:115 -msgctxt "@title job" -msgid "Copying" -msgstr "नक़ल किया जा रहा है" - -#: src/core/job.cpp:122 -msgctxt "@title job" -msgid "Creating directory" -msgstr "डिरेक्ट्री बनाया जा रहा है" - -#: src/core/job.cpp:123 src/widgets/fileundomanager.cpp:125 -msgid "Directory" -msgstr "डिरेक्ट्री" - -#: src/core/job.cpp:128 -msgctxt "@title job" -msgid "Deleting" -msgstr "मिटाया जा रहा है" - -#: src/core/job.cpp:129 src/core/job.cpp:135 -#: src/widgets/fileundomanager.cpp:136 -msgid "File" -msgstr "फ़ाइल" - -#: src/core/job.cpp:134 -msgctxt "@title job" -msgid "Examining" -msgstr "" - -#: src/core/job.cpp:140 -msgctxt "@title job" -msgid "Transferring" -msgstr "ट्रांसफ़र किया जा रहा है" - -#: src/core/job.cpp:146 -msgctxt "@title job" -msgid "Mounting" -msgstr "माउंट किया जा रहा है" - -#: src/core/job.cpp:147 -msgid "Device" -msgstr "उपकरण" - -#: src/core/job.cpp:148 src/core/job.cpp:154 -msgid "Mountpoint" -msgstr "माउन्ट पाइंट" - -#: src/core/job.cpp:153 -msgctxt "@title job" -msgid "Unmounting" -msgstr "अनमाउंटिंग" - -#: src/core/job_error.cpp:37 -#, kde-format -msgid "Could not read %1." -msgstr " %1 पढ़ नहीं सका." - -#: src/core/job_error.cpp:40 -#, kde-format -msgid "Could not write to %1." -msgstr " %1 पर लिख नहीं सका." - -#: src/core/job_error.cpp:43 -#, kde-format -msgid "Could not start process %1." -msgstr "प्रक्रिया %1 चालू नहीं कर सका." - -#: src/core/job_error.cpp:46 -#, kde-format -msgid "" -"Internal Error\n" -"Please send a full bug report at http://bugs.kde.org\n" -"%1" -msgstr "" -"आंतरिक त्रुटि\n" -" कृपया सम्पूर्ण बग रपट यहाँ भेजें- http://bugs.kde.org\n" -"%1" - -#: src/core/job_error.cpp:49 -#, kde-format -msgid "Malformed URL %1." -msgstr "गलत यूआरएल %1." - -#: src/core/job_error.cpp:52 -#, kde-format -msgid "The protocol %1 is not supported." -msgstr "प्रोटोकॉल %1 समर्थित नहीं है" - -#: src/core/job_error.cpp:55 -#, kde-format -msgid "The protocol %1 is only a filter protocol." -msgstr "प्रोटोकॉल %1 सिर्फ एक फ़िल्टर प्रोटोकॉल है." - -#: src/core/job_error.cpp:62 -#, kde-format -msgid "%1 is a folder, but a file was expected." -msgstr "%1 फ़ोल्डर है, परन्तु एक फ़ाइल प्रत्याशित है." - -#: src/core/job_error.cpp:65 -#, kde-format -msgid "%1 is a file, but a folder was expected." -msgstr "%1 फ़ाइल है, परन्तु एक फ़ोल्डर प्रत्याशित है." - -#: src/core/job_error.cpp:68 -#, kde-format -msgid "The file or folder %1 does not exist." -msgstr "फ़ाइल या फ़ोल्डर %1 मौज़ूदनहीं है." - -#: src/core/job_error.cpp:71 -#, kde-format -msgid "A file named %1 already exists." -msgstr "एक फ़ाइल %1 के नाम से पहले से ही मौज़ूद है." - -#: src/core/job_error.cpp:74 -#, kde-format -msgid "A folder named %1 already exists." -msgstr "एक फ़ोल्डर %1 नाम से पहले ही मौज़ूद है." - -#: src/core/job_error.cpp:77 -msgid "No hostname specified." -msgstr "कोई होस्टनाम उल्लेखित नहीं है." - -#: src/core/job_error.cpp:77 -#, kde-format -msgid "Unknown host %1" -msgstr "अज्ञात होस्ट %1" - -#: src/core/job_error.cpp:80 -#, kde-format -msgid "Access denied to %1." -msgstr " %1 पर पंहुच अस्वीकृत." - -#: src/core/job_error.cpp:83 -#, kde-format -msgid "" -"Access denied.\n" -"Could not write to %1." -msgstr "" -"पँहुच अस्वीकृत\n" -"%1 पर लिख नहीं सका." - -#: src/core/job_error.cpp:86 -#, kde-format -msgid "Could not enter folder %1." -msgstr "फ़ोल्डर %1 में जा नहीं सका." - -#: src/core/job_error.cpp:89 -#, kde-format -msgid "The protocol %1 does not implement a folder service." -msgstr "प्रोटोकॉल %1 फ़ोल्डर सेवा कार्यान्वित नहीं करता." - -#: src/core/job_error.cpp:92 -#, kde-format -msgid "Found a cyclic link in %1." -msgstr " %1 में साइक्लिक लिंक मिला." - -#: src/core/job_error.cpp:98 -#, kde-format -msgid "Found a cyclic link while copying %1." -msgstr "%1 की नक़ल के दौरान साइक्लिक लिंक मिला." - -#: src/core/job_error.cpp:101 -#, kde-format -msgid "Could not create socket for accessing %1." -msgstr " %1 पर पँहुच के लिए सॉकेट तैयार नहीं कर सका." - -#: src/core/job_error.cpp:104 -#, kde-format -msgid "Could not connect to host %1." -msgstr "होस्ट %1 से जुड़ नहीं सका." - -#: src/core/job_error.cpp:107 -#, kde-format -msgid "Connection to host %1 is broken." -msgstr "होस्ट %1 से कनेक्शन टूट गया." - -#: src/core/job_error.cpp:110 -#, kde-format -msgid "The protocol %1 is not a filter protocol." -msgstr "प्रोटोकॉल %1 एक फ़िल्टर प्रोटोकॉल नहीं है." - -#: src/core/job_error.cpp:113 -#, kde-format -msgid "" -"Could not mount device.\n" -"The reported error was:\n" -"%1" -msgstr "" -"उपकरण माउन्ट नहीं कर सका.\n" -" रिपोर्ट की गई त्रुटि थी:\n" -"%1" - -#: src/core/job_error.cpp:116 -#, kde-format -msgid "" -"Could not unmount device.\n" -"The reported error was:\n" -"%1" -msgstr "" -"उपकरण अनमाउन्ट नहीं कर सका.\n" -" रिपोर्ट की गई त्रुटि थी:\n" -"%1" - -#: src/core/job_error.cpp:119 -#, kde-format -msgid "Could not read file %1." -msgstr "फ़ाइल %1 को पढ़ नहीं सका." - -#: src/core/job_error.cpp:122 -#, kde-format -msgid "Could not write to file %1." -msgstr "फ़ाइल %1 पर लिख नहीं सका." - -#: src/core/job_error.cpp:125 -#, kde-format -msgid "Could not bind %1." -msgstr " %1 बाइंड नहीं कर सका." - -#: src/core/job_error.cpp:128 -#, kde-format -msgid "Could not listen %1." -msgstr " %1 पर सुन नहीं सका." - -#: src/core/job_error.cpp:131 -#, kde-format -msgid "Could not accept %1." -msgstr " %1 को स्वीकार नहीं सका." - -#: src/core/job_error.cpp:137 -#, kde-format -msgid "Could not access %1." -msgstr " %1 पर पँहुच नहीं सका." - -#: src/core/job_error.cpp:140 -#, kde-format -msgid "Could not terminate listing %1." -msgstr "लिस्टिंग %1 बन्द नहीं कर सका." - -#: src/core/job_error.cpp:143 -#, kde-format -msgid "Could not make folder %1." -msgstr "फ़ोल्डर %1 बना नहीं सका." - -#: src/core/job_error.cpp:146 -#, kde-format -msgid "Could not remove folder %1." -msgstr "फ़ोल्डर %1 मिटा नहीं सका." - -#: src/core/job_error.cpp:149 -#, kde-format -msgid "Could not resume file %1." -msgstr "फ़ाइल %1 पुनरारंभ नहीं कर सका." - -#: src/core/job_error.cpp:152 -#, kde-format -msgid "Could not rename file %1." -msgstr "फ़ाइल %1 का नाम बदल नहीं सका." - -#: src/core/job_error.cpp:155 -#, kde-format -msgid "Could not change permissions for %1." -msgstr " %1 के लिए अनुमतियाँ बदल नहीं सका." - -#: src/core/job_error.cpp:158 -#, kde-format -msgid "Could not change ownership for %1." -msgstr "%1 के लिए मालिकाना बदल नहीं सकता." - -#: src/core/job_error.cpp:161 -#, kde-format -msgid "Could not delete file %1." -msgstr "फ़ाइल %1 को मिटा नहीं सका." - -#: src/core/job_error.cpp:164 -#, kde-format -msgid "The process for the %1 protocol died unexpectedly." -msgstr "प्रोटोकॉल %1 के लिए प्रक्रिया अप्रत्याशित रूप से बन्द हो गई." - -#: src/core/job_error.cpp:167 -#, kde-format -msgid "" -"Error. Out of memory.\n" -"%1" -msgstr "" -"त्रुटि. मेमोरी की कमी.\n" -"%1" - -#: src/core/job_error.cpp:170 -#, kde-format -msgid "" -"Unknown proxy host\n" -"%1" -msgstr "" -"अज्ञात प्रॉक्सी होस्ट\n" -"%1" - -#: src/core/job_error.cpp:173 -#, kde-format -msgid "Authorization failed, %1 authentication not supported" -msgstr "अनुमोदन असपल, %1 प्रमाणीकरण समर्थित नहीं है" - -#: src/core/job_error.cpp:176 -#, kde-format -msgid "" -"User canceled action\n" -"%1" -msgstr "" -"उपयोक्ता ने क्रिया रद्द किया\n" -"%1" - -#: src/core/job_error.cpp:179 -#, kde-format -msgid "" -"Internal error in server\n" -"%1" -msgstr "" -"सर्वर में आंतरिक त्रुटि\n" -"%1" - -#: src/core/job_error.cpp:182 -#, kde-format -msgid "" -"Timeout on server\n" -"%1" -msgstr "" -"सर्वर में टाइमआउट त्रुटि\n" -"%1" - -#: src/core/job_error.cpp:185 -#, kde-format -msgid "" -"Unknown error\n" -"%1" -msgstr "" -"अज्ञात त्रुटि\n" -"%1" - -#: src/core/job_error.cpp:188 -#, kde-format -msgid "" -"Unknown interrupt\n" -"%1" -msgstr "" -"अज्ञात इंटरप्ट\n" -"%1" - -#: src/core/job_error.cpp:199 -#, kde-format -msgid "" -"Could not delete original file %1.\n" -"Please check permissions." -msgstr "" -"मूल फ़ाइल %1 मिटा नहीं सकता.\n" -"कृपया अनुमतियाँ जाँचें." - -#: src/core/job_error.cpp:202 -#, kde-format -msgid "" -"Could not delete partial file %1.\n" -"Please check permissions." -msgstr "" -"आधा-अधूरा फ़ाइल %1 मिटा नहीं सकता.\n" -"कृपया अनुमतियाँ जाँचें." - -#: src/core/job_error.cpp:205 -#, kde-format -msgid "" -"Could not rename original file %1.\n" -"Please check permissions." -msgstr "" -"मूल फ़ाइल %1 का नाम बदल नहीं सकता.\n" -"कृपया अनुमतियाँ जाँचें." - -#: src/core/job_error.cpp:208 -#, kde-format -msgid "" -"Could not rename partial file %1.\n" -"Please check permissions." -msgstr "" -"आधा-अधूरा फ़ाइल %1 का नाम बदल नहीं सकता.\n" -"कृपया अनुमतियाँ जाँचें." - -#: src/core/job_error.cpp:211 -#, kde-format -msgid "" -"Could not create symlink %1.\n" -"Please check permissions." -msgstr "" -"सिमलिंक %1 बना नहीं सकता.\n" -"कृपया अनुमतियाँ जाँचें." - -#: src/core/job_error.cpp:217 -#, kde-format -msgid "" -"Could not write file %1.\n" -"Disk full." -msgstr "" -"फ़ाइल %1 लिख नहीं सका.\n" -" डिस्क पूरा भरा है." - -#: src/core/job_error.cpp:220 -#, kde-format -msgid "" -"The source and destination are the same file.\n" -"%1" -msgstr "" -"स्रोत एवं गंतव्य दोनों एक ही फ़ाइल है.\n" -"%1" - -#: src/core/job_error.cpp:226 -#, kde-format -msgid "%1 is required by the server, but is not available." -msgstr "सर्वर के लिए %1 आवश्यक है, परंतु यह उपलब्ध नहीं है." - -#: src/core/job_error.cpp:229 -msgid "Access to restricted port in POST denied." -msgstr "पोस्ट में रेस्ट्रिक्टेड पोर्ट पर पहुँच को नकारा गया." - -#: src/core/job_error.cpp:232 -msgid "" -"The required content size information was not provided for a POST operation." -msgstr "" - -#: src/core/job_error.cpp:235 -#, kde-format -msgid "" -"Unknown error code %1\n" -"%2\n" -"Please send a full bug report at http://bugs.kde.org." -msgstr "" -"अज्ञात त्रुटि कोड %1\n" -"%2\n" -" कृपया संपूर्ण बग रपट यहाँ भेजें- http://bugs.kde.org." - -#: src/core/job_error.cpp:260 -msgctxt "@info url" -msgid "(unknown)" -msgstr "(अज्ञात)" - -#: src/core/job_error.cpp:267 -#, kde-format -msgctxt "@info %1 error name, %2 description" -msgid "<qt><p><b>%1</b></p><p>%2</p></qt>" -msgstr "" - -#: src/core/job_error.cpp:271 -msgid "<b>Technical reason</b>: " -msgstr "<b>तकनीकी कारण</b>: " - -#: src/core/job_error.cpp:273 -#, fuzzy -#| msgid "</p><p><b>Details of the request</b>:" -msgid "<b>Details of the request</b>:" -msgstr "</p><p><b>निवेदन का विवरण</b>:" - -#: src/core/job_error.cpp:274 -#, fuzzy, kde-format -#| msgid "</p><ul><li>URL: %1</li>" -msgid "<li>URL: %1</li>" -msgstr "</p><ul><li>यूआरएल: %1</li>" - -#: src/core/job_error.cpp:276 -#, kde-format -msgid "<li>Protocol: %1</li>" -msgstr "<li>प्रोटोकॉल: %1</li>" - -#: src/core/job_error.cpp:278 -#, kde-format -msgid "<li>Date and time: %1</li>" -msgstr "<li>तारीख़ तथा समय: %1</li>" - -#: src/core/job_error.cpp:279 -#, fuzzy, kde-format -#| msgid "<li>Additional information: %1</li></ul>" -msgid "<li>Additional information: %1</li>" -msgstr "<li>अतिरिक्त जानकारी: %1</li></ul>" - -#: src/core/job_error.cpp:282 -#, fuzzy -#| msgid "<p><b>Possible causes</b>:</p><ul><li>" -msgid "<b>Possible causes</b>:" -msgstr "<p><b>संभावित कारण</b>:</p><ul><li>" - -#: src/core/job_error.cpp:287 -#, fuzzy -#| msgid "<p><b>Possible solutions</b>:</p><ul><li>" -msgid "<b>Possible solutions</b>:" -msgstr "<p><b>संभावित समाधान</b>:</p><ul><li>" - -#: src/core/job_error.cpp:321 -msgctxt "@info protocol" -msgid "(unknown)" -msgstr "(अज्ञात)" - -#: src/core/job_error.cpp:330 -msgid "" -"Contact your appropriate computer support system, whether the system " -"administrator, or technical support group for further assistance." -msgstr "" -"अतिरिक्त मदद के लिए आप उपयुक्त कम्प्यूटर सपोर्ट सिस्टम जो कि तंत्र प्रशासक या तकनीकी " -"सपोर्ट समूह हो सकते हैं, से सम्पर्क साधें." - -#: src/core/job_error.cpp:333 -msgid "Contact the administrator of the server for further assistance." -msgstr "अतिरिक्त मदद के लिए सर्वर के प्रशासक से संपर्क करें." - -#: src/core/job_error.cpp:336 -msgid "Check your access permissions on this resource." -msgstr "इस रिसोर्स पर आप अपनी पहूँच अनुमतियाँ जाँचें." - -#: src/core/job_error.cpp:337 -msgid "" -"Your access permissions may be inadequate to perform the requested operation " -"on this resource." -msgstr "" -"इस रिसोर्स पर निवेदित आपरेशन निष्पादित करने के लिए आपकी पहुँच अनुमतियाँ शायद अपूर्ण हैं." - -#: src/core/job_error.cpp:339 -msgid "" -"The file may be in use (and thus locked) by another user or application." -msgstr "फ़ाइल शायद अन्य उपयोक्ता या अनुप्रयोग के उपयोग में है (और इसीलिए तालाबंद है)." - -#: src/core/job_error.cpp:341 -msgid "" -"Check to make sure that no other application or user is using the file or " -"has locked the file." -msgstr "" -"सुनिश्चित करने के लिए जाँचें कि कोई अन्य अनुप्रयोग या उपयोक्ता तो फ़ाइल का उपयोग नहीं कर " -"रहा है, और फ़ाइल को तालाबंद किया है." - -#: src/core/job_error.cpp:343 -msgid "Although unlikely, a hardware error may have occurred." -msgstr "यद्यपि संभावना कम ही है, एक हार्डवेयर त्रुटि हो सकती है." - -#: src/core/job_error.cpp:345 -msgid "You may have encountered a bug in the program." -msgstr "आपको प्रोग्राम में एक बग से सामना हुआ होगा." - -#: src/core/job_error.cpp:346 -msgid "" -"This is most likely to be caused by a bug in the program. Please consider " -"submitting a full bug report as detailed below." -msgstr "" -"अधिक संभावना है कि यह प्रोग्राम में बग के कारण हुआ है. कृपया नीचे दिए विवरण अनुसार बग " -"रपट भेजने के बारे में विचार करें." - -#: src/core/job_error.cpp:348 -msgid "" -"Update your software to the latest version. Your distribution should provide " -"tools to update your software." -msgstr "" -"अपने साफ्टवेयर को नवीनतम संस्करण में अद्यतन करें. आपका डिस्ट्रीब्यूशन आपके साफ्टवेयर को अद्यतन " -"करने के औज़ार जुटाता है." - -#: src/core/job_error.cpp:350 -msgid "" -"When all else fails, please consider helping the KDE team or the third party " -"maintainer of this software by submitting a high quality bug report. If the " -"software is provided by a third party, please contact them directly. " -"Otherwise, first look to see if the same bug has been submitted by someone " -"else by searching at the <a href=\"http://bugs.kde.org/\">KDE bug reporting " -"website</a>. If not, take note of the details given above, and include them " -"in your bug report, along with as many other details as you think might help." -msgstr "" - -#: src/core/job_error.cpp:358 -msgid "There may have been a problem with your network connection." -msgstr "आपके नेटवर्क कनेक्शन के साथ कोई समस्या हो सकती है." - -#: src/core/job_error.cpp:361 -msgid "" -"There may have been a problem with your network configuration. If you have " -"been accessing the Internet with no problems recently, this is unlikely." -msgstr "" -"आपके नेटवर्क कॉन्फ़िगरेशन के साथ कोई समस्या हो सकती है. यदि आप हाल ही में इंटरनेट एक्सेस " -"किए होंगे तो फिर इसकी संभावना कम ही है." - -#: src/core/job_error.cpp:364 -msgid "" -"There may have been a problem at some point along the network path between " -"the server and this computer." -msgstr "सर्वर और इस कंप्यूटर के नेटवर्क पथ के बीच किसी बिंदु पर कोई समस्या हो सकती है." - -#: src/core/job_error.cpp:366 -msgid "Try again, either now or at a later time." -msgstr "फिर से कोशिश करें या अभी या कभी बाद में." - -#: src/core/job_error.cpp:367 -msgid "A protocol error or incompatibility may have occurred." -msgstr "कोई प्रोटोकॉल त्रुटि या असंगति हो गई होगी." - -#: src/core/job_error.cpp:368 -msgid "Ensure that the resource exists, and try again." -msgstr "सुनिश्चित हों कि रिसोर्स उपलब्ध है, एवं फिर से कोशिश करें." - -#: src/core/job_error.cpp:369 -msgid "The specified resource may not exist." -msgstr "उल्लेखित रिसोर्स अस्तित्व में नहीं है." - -#: src/core/job_error.cpp:370 -msgid "You may have incorrectly typed the location." -msgstr "आपने शायद गलत स्थान टाइप किया होगा." - -#: src/core/job_error.cpp:371 -msgid "Double-check that you have entered the correct location and try again." -msgstr "दोबारा जाँचें कि आपने सही स्थान भरा है, एवं फिर से कोशिश करें." - -#: src/core/job_error.cpp:373 -msgid "Check your network connection status." -msgstr "अपना नेटवर्क कनेक्शन स्थिति जांचें." - -#: src/core/job_error.cpp:377 -msgid "Cannot Open Resource For Reading" -msgstr "रिसोर्स पढ़ने के लिए खोल नहीं सकता " - -#: src/core/job_error.cpp:378 -#, kde-format -msgid "" -"This means that the contents of the requested file or folder <strong>%1</" -"strong> could not be retrieved, as read access could not be obtained." -msgstr "" -"इसका अर्थ है कि निवेदित फ़ाइल या फ़ोल्डर <strong>%1</strong> की विषयवस्तु पाई नहीं जा " -"सकती चूंकि पढ़ने की पहुँच प्राप्त नहीं हुई." - -#: src/core/job_error.cpp:381 -msgid "You may not have permissions to read the file or open the folder." -msgstr "आपके पास फ़ाइल को पढ़ने की या फ़ोल्डर खोलने की अनुमति नहीं होगी." - -#: src/core/job_error.cpp:387 -msgid "Cannot Open Resource For Writing" -msgstr "लिखने के लिए रिसोर्स खोल नहीं सका" - -#: src/core/job_error.cpp:388 -#, kde-format -msgid "" -"This means that the file, <strong>%1</strong>, could not be written to as " -"requested, because access with permission to write could not be obtained." -msgstr "" -"इसका अर्थ है कि फ़ाइल <strong>%1</strong> जैसा कि निवेदित है, लिखी नहीं जा सकी चूंकि " -"लिखने की पहुँच अनुमतियाँ प्राप्त नहीं हुई." - -#: src/core/job_error.cpp:396 -#, kde-format -msgid "Cannot Initiate the %1 Protocol" -msgstr "प्रोटोकॉल %1 प्रारंभ नहीं कर सका" - -#: src/core/job_error.cpp:397 -msgid "Unable to Launch Process" -msgstr "प्रक्रिया चलाने में अक्षम" - -#: src/core/job_error.cpp:398 -#, kde-format -msgid "" -"The program on your computer which provides access to the <strong>%1</" -"strong> protocol could not be started. This is usually due to technical " -"reasons." -msgstr "" - -#: src/core/job_error.cpp:401 -msgid "" -"The program which provides compatibility with this protocol may not have " -"been updated with your last update of KDE. This can cause the program to be " -"incompatible with the current version and thus not start." -msgstr "" - -#: src/core/job_error.cpp:409 -msgid "Internal Error" -msgstr "आंतरिक त्रुटि" - -#: src/core/job_error.cpp:410 -#, kde-format -msgid "" -"The program on your computer which provides access to the <strong>%1</" -"strong> protocol has reported an internal error." -msgstr "" -"आपके कम्प्यूटर पर प्रोग्राम जो <strong>%1</strong> प्रोटोकाल को एक्सेस प्रदान करता है " -"उसने एक आंतरिक त्रुटि की रपट दी." - -#: src/core/job_error.cpp:418 -msgid "Improperly Formatted URL" -msgstr "गलत फॉर्मेटेड यूआरएल" - -#: src/core/job_error.cpp:419 -msgid "" -"The <strong>U</strong>niform <strong>R</strong>esource <strong>L</" -"strong>ocator (URL) that you entered was not properly formatted. The format " -"of a URL is generally as follows:<blockquote><strong>protocol://user:" -"password@www.example.org:port/folder/filename.extension?query=value</" -"strong></blockquote>" -msgstr "" - -#: src/core/job_error.cpp:428 -#, kde-format -msgid "Unsupported Protocol %1" -msgstr "असमर्थित प्रोटोकॉल %1" - -#: src/core/job_error.cpp:429 -#, kde-format -msgid "" -"The protocol <strong>%1</strong> is not supported by the KDE programs " -"currently installed on this computer." -msgstr "" -"प्रोटोकॉल <strong>%1</strong> वर्तमान में इस कम्प्यूटर पर स्थापित केडीई प्रोग्राम द्वारा " -"समर्थित नहीं है. " - -#: src/core/job_error.cpp:432 -msgid "The requested protocol may not be supported." -msgstr "निवेदित प्रोटोकॉल शायद समर्थित नहीं है." - -#: src/core/job_error.cpp:433 -#, kde-format -msgid "" -"The versions of the %1 protocol supported by this computer and the server " -"may be incompatible." -msgstr "" -"प्रोटोकॉल %1 का संस्करण जो इस कम्प्यूटर तथा सर्वर द्वारा समर्थित हैं, शायद असंगत हैं." - -#: src/core/job_error.cpp:435 -msgid "" -"You may perform a search on the Internet for a KDE program (called a " -"kioslave or ioslave) which supports this protocol. Places to search include " -"<a href=\"http://kde-apps.org/\">http://kde-apps.org/</a> and <a href=" -"\"http://freshmeat.net/\">http://freshmeat.net/</a>." -msgstr "" - -#: src/core/job_error.cpp:444 -msgid "URL Does Not Refer to a Resource." -msgstr "यूआरएल रिसोर्स को रेफर नहीं करता." - -#: src/core/job_error.cpp:445 -msgid "Protocol is a Filter Protocol" -msgstr "प्रोटोकॉल एक फ़िल्टर प्रोटोकॉल है" - -#: src/core/job_error.cpp:446 -msgid "" -"The <strong>U</strong>niform <strong>R</strong>esource <strong>L</" -"strong>ocator (URL) that you entered did not refer to a specific resource." -msgstr "" -" <strong>यू</strong> <strong>आर</strong> <strong>एल</strong> (यूनिफ़ॉर्म रिसोर्स " -"लोकेटर) जो आपने भरा है वह किसी विशिष्ट रिसोर्स को संदर्भित नहीं करता है." - -#: src/core/job_error.cpp:449 -msgid "" -"KDE is able to communicate through a protocol within a protocol; the " -"protocol specified is only for use in such situations, however this is not " -"one of these situations. This is a rare event, and is likely to indicate a " -"programming error." -msgstr "" - -#: src/core/job_error.cpp:457 -#, kde-format -msgid "Unsupported Action: %1" -msgstr "असमर्थित क्रिया: %1" - -#: src/core/job_error.cpp:458 -#, kde-format -msgid "" -"The requested action is not supported by the KDE program which is " -"implementing the <strong>%1</strong> protocol." -msgstr "" -"निवेदित क्रिया केडीई प्रोग्राम के द्वारा समर्थित नहीं है जो कि <strong>%1</strong> " -"प्रोटोकॉल को लागू करती है." - -#: src/core/job_error.cpp:461 -msgid "" -"This error is very much dependent on the KDE program. The additional " -"information should give you more information than is available to the KDE " -"input/output architecture." -msgstr "" - -#: src/core/job_error.cpp:464 -msgid "Attempt to find another way to accomplish the same outcome." -msgstr "वैसा ही परिणाम पूरा करने के लिए अन्य रास्ता ढूंढने की कोशिश." - -#: src/core/job_error.cpp:469 -msgid "File Expected" -msgstr "फ़ाइल प्रत्याशित" - -#: src/core/job_error.cpp:470 -#, kde-format -msgid "" -"The request expected a file, however the folder <strong>%1</strong> was " -"found instead." -msgstr "निवेदन में फ़ाइल वांछित है, पर बदले में फ़ोल्डर <strong>%1</strong> पाया गया." - -#: src/core/job_error.cpp:472 -msgid "This may be an error on the server side." -msgstr "यह सर्वर की तरफ की एक त्रुटि हो सकती है." - -#: src/core/job_error.cpp:477 -msgid "Folder Expected" -msgstr "फ़ोल्डर प्रत्याशित" - -#: src/core/job_error.cpp:478 -#, kde-format -msgid "" -"The request expected a folder, however the file <strong>%1</strong> was " -"found instead." -msgstr "निवेदन में फ़ोल्डर वांछित है, पर बदले में फ़ाइल <strong>%1</strong> पाया गया." - -#: src/core/job_error.cpp:485 -msgid "File or Folder Does Not Exist" -msgstr "फ़ाइल या फ़ोल्डर अस्तित्व में नहीं है." - -#: src/core/job_error.cpp:486 -#, kde-format -msgid "The specified file or folder <strong>%1</strong> does not exist." -msgstr "उल्लेखित फ़ाइल या फोल्डर <strong>%1</strong> मौज़ूद नहीं है." - -#: src/core/job_error.cpp:494 -msgid "" -"The requested file could not be created because a file with the same name " -"already exists." -msgstr "" -"निवेदित फ़ाइल तैयार नहीं की जा सकी चूंकि इसी नाम की एक फ़ाइल पहले से ही उपलब्ध है." - -#: src/core/job_error.cpp:496 -msgid "Try moving the current file out of the way first, and then try again." -msgstr "मौज़ूदा फ़ाइल को पहले रास्ते से बाहर खिसकाने की कोशिश करें, फिर फिर से कोशिश करें." - -#: src/core/job_error.cpp:498 -msgid "Delete the current file and try again." -msgstr "मौज़ूदा फ़ाइल मिटाकर फिर से कोशिश करें." - -#: src/core/job_error.cpp:499 -msgid "Choose an alternate filename for the new file." -msgstr "नई फ़ाइल के लिए वैकल्पिक नाम चुनें." - -#: src/core/job_error.cpp:504 -msgid "" -"The requested folder could not be created because a folder with the same " -"name already exists." -msgstr "" -"निवेदित फ़ोल्डर तैयार नहीं की जा सकी चूंकि इसी नाम का एक फ़ोल्डर पहले से ही उपलब्ध है." - -#: src/core/job_error.cpp:506 -msgid "Try moving the current folder out of the way first, and then try again." -msgstr "" -"मौज़ूदा फ़ोल्डर को पहले रास्ते से बाहर खिसकाने की कोशिश करें, फिर फिर से कोशिश करें." - -#: src/core/job_error.cpp:508 -msgid "Delete the current folder and try again." -msgstr "मौज़ूदा फ़ोल्डर मिटाकर फिर से कोशिश करें." - -#: src/core/job_error.cpp:509 -msgid "Choose an alternate name for the new folder." -msgstr "नए फ़ोल्डर के लिए वैकल्पिक नाम चुनें." - -#: src/core/job_error.cpp:513 -msgid "Unknown Host" -msgstr "अज्ञात होस्ट" - -#: src/core/job_error.cpp:514 -#, kde-format -msgid "" -"An unknown host error indicates that the server with the requested name, " -"<strong>%1</strong>, could not be located on the Internet." -msgstr "" -"एक अज्ञात होस्ट त्रुटि दर्शाता है कि निवेदित नाम का सर्वर, <strong>%1</strong>, " -"इंटरनेट पर पता नहीं लगाया जा सका." - -#: src/core/job_error.cpp:517 -#, kde-format -msgid "" -"The name that you typed, %1, may not exist: it may be incorrectly typed." -msgstr "" -"जो नाम आपने टाइप किया है, %1, शायद अस्तित्व में नहीं है: या शायद गलत टाइप किया गया है." - -#: src/core/job_error.cpp:524 -msgid "Access Denied" -msgstr "पंहुच अस्वीकृत" - -#: src/core/job_error.cpp:525 -#, kde-format -msgid "Access was denied to the specified resource, <strong>%1</strong>." -msgstr "उल्लेखित रिसोर्स <strong>%1</strong> में पहुँच नकार दिया गया." - -#: src/core/job_error.cpp:527 src/core/job_error.cpp:753 -msgid "You may have supplied incorrect authentication details or none at all." -msgstr "आपने गलत अनुमोदन विवरण दिया है या फिर दिया ही नहीं है." - -#: src/core/job_error.cpp:529 src/core/job_error.cpp:755 -msgid "Your account may not have permission to access the specified resource." -msgstr "उल्लेखित रिसोर्स पर पहूँच के लिए आपके अकाउन्ट में शायद अनुमति नहीं है." - -#: src/core/job_error.cpp:531 src/core/job_error.cpp:757 -#: src/core/job_error.cpp:769 -msgid "" -"Retry the request and ensure your authentication details are entered " -"correctly." -msgstr "" -"निवेदन फिर से कोशिश करें तथा यह सुनिश्चित हों कि आपका अनुमोदन विवरण उचित प्रकार भरा " -"है." - -#: src/core/job_error.cpp:539 -msgid "Write Access Denied" -msgstr "लिखने की पंहुच अस्वीकृत" - -#: src/core/job_error.cpp:540 -#, kde-format -msgid "" -"This means that an attempt to write to the file <strong>%1</strong> was " -"rejected." -msgstr "" -"इसका अर्थ है कि फ़ाइल <strong>%1</strong> पर लिखने की कोशिश अस्वीकृत कर दी गई." - -#: src/core/job_error.cpp:547 -msgid "Unable to Enter Folder" -msgstr "फ़ोल्डर में जाने में अक्षम." - -#: src/core/job_error.cpp:548 -#, kde-format -msgid "" -"This means that an attempt to enter (in other words, to open) the requested " -"folder <strong>%1</strong> was rejected." -msgstr "" -"इसका अर्थ है कि फ़ोल्डर <strong>%1</strong> पर जाने (अन्य शब्दों में, खोलने) की कोशिश " -"अस्वीकृत कर दी गई." - -#: src/core/job_error.cpp:556 -msgid "Folder Listing Unavailable" -msgstr "फ़ोल्डर सूची अनुपलब्ध" - -#: src/core/job_error.cpp:557 -#, kde-format -msgid "Protocol %1 is not a Filesystem" -msgstr "प्रोटोकॉल %1 फ़ाइलसिस्टम नहीं है" - -#: src/core/job_error.cpp:558 -msgid "" -"This means that a request was made which requires determining the contents " -"of the folder, and the KDE program supporting this protocol is unable to do " -"so." -msgstr "" - -#: src/core/job_error.cpp:566 -msgid "Cyclic Link Detected" -msgstr "साइक्लिक लिंक पता लगा" - -#: src/core/job_error.cpp:567 -msgid "" -"UNIX environments are commonly able to link a file or folder to a separate " -"name and/or location. KDE detected a link or series of links that results in " -"an infinite loop - i.e. the file was (perhaps in a roundabout way) linked to " -"itself." -msgstr "" - -#: src/core/job_error.cpp:571 src/core/job_error.cpp:593 -msgid "" -"Delete one part of the loop in order that it does not cause an infinite " -"loop, and try again." -msgstr "लूप के एक भाग को मिटाएँ जिससे कि यह अनंत लूप न बनाए, एवं फिर कोशिश करें." - -#: src/core/job_error.cpp:580 -msgid "Request Aborted By User" -msgstr "उपयोक्ता द्वारा निवेदन रोका गया" - -#: src/core/job_error.cpp:581 src/core/job_error.cpp:896 -msgid "The request was not completed because it was aborted." -msgstr "निवेदन पूरा नहीं किया जा सका चूंकि इसे रोक दिया गया." - -#: src/core/job_error.cpp:583 src/core/job_error.cpp:787 -#: src/core/job_error.cpp:898 -msgid "Retry the request." -msgstr "निवेदन को फिर से कोशिश करें" - -#: src/core/job_error.cpp:587 -msgid "Cyclic Link Detected During Copy" -msgstr "नक़ल के दौरान साइक्लिक लिंक पता लगा" - -#: src/core/job_error.cpp:588 -msgid "" -"UNIX environments are commonly able to link a file or folder to a separate " -"name and/or location. During the requested copy operation, KDE detected a " -"link or series of links that results in an infinite loop - i.e. the file was " -"(perhaps in a roundabout way) linked to itself." -msgstr "" - -#: src/core/job_error.cpp:598 -msgid "Could Not Create Network Connection" -msgstr "नेटवर्क कनेक्शन तैयार नहीं कर सकते." - -#: src/core/job_error.cpp:599 -msgid "Could Not Create Socket" -msgstr "सॉकेट तैयार नहीं कर सकते" - -#: src/core/job_error.cpp:600 -msgid "" -"This is a fairly technical error in which a required device for network " -"communications (a socket) could not be created." -msgstr "" -"यह पूरी तकनीकी त्रुटि है जिसमें नेटवर्क कम्यूनिकेशन (सॉकेट) के लिए वांछित उपकरण बनाया नहीं " -"जा सका." - -#: src/core/job_error.cpp:602 src/core/job_error.cpp:723 -#: src/core/job_error.cpp:734 src/core/job_error.cpp:743 -msgid "" -"The network connection may be incorrectly configured, or the network " -"interface may not be enabled." -msgstr "नेटवर्क कनेक्शन शायद सही कॉन्फ़िगर नहीं है, या नेटवर्क इंटरफेस इनेबल्ड नहीं है." - -#: src/core/job_error.cpp:608 -msgid "Connection to Server Refused" -msgstr "सर्वर से कनेक्शन अस्वीकृत" - -#: src/core/job_error.cpp:609 -#, kde-format -msgid "" -"The server <strong>%1</strong> refused to allow this computer to make a " -"connection." -msgstr "सर्वर <strong>%1</strong> इस कम्प्यूटर को कनेक्शन करने की स्वीकृति नहीं देता." - -#: src/core/job_error.cpp:611 -msgid "" -"The server, while currently connected to the Internet, may not be configured " -"to allow requests." -msgstr "" -"सर्वर जब तक कि वर्तमान में इंटरनेट से जुड़ा है, निवेदन स्वीकार करने के लिए कॉन्फ़िगर नहीं " -"होगा." - -#: src/core/job_error.cpp:613 -#, kde-format -msgid "" -"The server, while currently connected to the Internet, may not be running " -"the requested service (%1)." -msgstr "" -"सर्वर जब तक कि वर्तमान में इंटरनेट से जुड़ा है, निवेदित सेवा (%1) नहीं चला रहा होगा." - -#: src/core/job_error.cpp:615 -msgid "" -"A network firewall (a device which restricts Internet requests), either " -"protecting your network or the network of the server, may have intervened, " -"preventing this request." -msgstr "" - -#: src/core/job_error.cpp:622 -msgid "Connection to Server Closed Unexpectedly" -msgstr "सर्वर से कनेक्शन अप्रत्याशित रूप से बन्द हो गया" - -#: src/core/job_error.cpp:623 -#, kde-format -msgid "" -"Although a connection was established to <strong>%1</strong>, the connection " -"was closed at an unexpected point in the communication." -msgstr "" -"हालांकि <strong>%1</strong> पर कनेक्शन तो बनाया जा चुका थाै, कनेक्शनसंचार के एक " -"अप्रत्याशित बिन्दु पर बन्द हो गया ." - -#: src/core/job_error.cpp:626 -msgid "" -"A protocol error may have occurred, causing the server to close the " -"connection as a response to the error." -msgstr "" -"कोई प्रोटोकॉल त्रुटि हो गई होगी, जिससे त्रुटि की प्रतिक्रिया स्वरूप सर्वर का कनेक्शन बन्द " -"हो गया." - -#: src/core/job_error.cpp:632 -msgid "URL Resource Invalid" -msgstr "यूआरएल रिसोर्स अवैध है" - -#: src/core/job_error.cpp:633 -#, kde-format -msgid "Protocol %1 is not a Filter Protocol" -msgstr "प्रोटोकॉल %1 एक फ़िल्टर प्रोटोकॉल नहीं है." - -#: src/core/job_error.cpp:634 -#, kde-format -msgid "" -"The <strong>U</strong>niform <strong>R</strong>esource <strong>L</" -"strong>ocator (URL) that you entered did not refer to a valid mechanism of " -"accessing the specific resource, <strong>%1%2</strong>." -msgstr "" - -#: src/core/job_error.cpp:639 -msgid "" -"KDE is able to communicate through a protocol within a protocol. This " -"request specified a protocol be used as such, however this protocol is not " -"capable of such an action. This is a rare event, and is likely to indicate a " -"programming error." -msgstr "" - -#: src/core/job_error.cpp:647 -msgid "Unable to Initialize Input/Output Device" -msgstr "इनपुट / आउटपुट उपकरण इनिशियलाइज करने में अक्षम" - -#: src/core/job_error.cpp:648 -msgid "Could Not Mount Device" -msgstr "उपकरण माउन्ट नहीं कर सका" - -#: src/core/job_error.cpp:649 -#, kde-format -msgid "" -"The requested device could not be initialized (\"mounted\"). The reported " -"error was: <strong>%1</strong>" -msgstr "" -"निवेदित उपकरण इनिशियलाइज़ (\"माउन्टेड\") नहीं किया जा सकता. रिपोर्ट की गई त्रुटि हैः " -"<strong>%1</strong>" - -#: src/core/job_error.cpp:652 -msgid "" -"The device may not be ready, for example there may be no media in a " -"removable media device (i.e. no CD-ROM in a CD drive), or in the case of a " -"peripheral/portable device, the device may not be correctly connected." -msgstr "" - -#: src/core/job_error.cpp:656 -msgid "" -"You may not have permissions to initialize (\"mount\") the device. On UNIX " -"systems, often system administrator privileges are required to initialize a " -"device." -msgstr "" - -#: src/core/job_error.cpp:660 -msgid "" -"Check that the device is ready; removable drives must contain media, and " -"portable devices must be connected and powered on.; and try again." -msgstr "" -"जांचें कि उपकरण तैयार है, हटाए जा सकने वाले ड्राइव में मीडिया होना चाहिए तथा पोर्टेबल " -"उपकरण कनेक्ट होना चाहिएँ तथा पावर चालू होना चाहिए, और फिर से कोशिश करें." - -#: src/core/job_error.cpp:666 -msgid "Unable to Uninitialize Input/Output Device" -msgstr "इनपुट / आउटपुट उपकरण अनइनिशियलाइज करने में अक्षम" - -#: src/core/job_error.cpp:667 -msgid "Could Not Unmount Device" -msgstr "उपकरण अनमाउन्ट नहीं कर सका" - -#: src/core/job_error.cpp:668 -#, kde-format -msgid "" -"The requested device could not be uninitialized (\"unmounted\"). The " -"reported error was: <strong>%1</strong>" -msgstr "" -"निवेदित उपकरण अनइनिशियलाइज़ (\"अनमाउन्टेड\") नहीं किया जा सकता. रिपोर्ट की गई त्रुटि " -"हैः <strong>%1</strong>" - -#: src/core/job_error.cpp:671 -msgid "" -"The device may be busy, that is, still in use by another application or " -"user. Even such things as having an open browser window on a location on " -"this device may cause the device to remain in use." -msgstr "" - -#: src/core/job_error.cpp:675 -msgid "" -"You may not have permissions to uninitialize (\"unmount\") the device. On " -"UNIX systems, system administrator privileges are often required to " -"uninitialize a device." -msgstr "" - -#: src/core/job_error.cpp:679 -msgid "Check that no applications are accessing the device, and try again." -msgstr "जाँचें कि कोई अनुप्रयोग उपकरण को एक्सेस नही कर रहा है, एवं फिर से कोशिश करें." - -#: src/core/job_error.cpp:684 -msgid "Cannot Read From Resource" -msgstr "रिसोर्स से पढ़ नहीं सका" - -#: src/core/job_error.cpp:685 -#, kde-format -msgid "" -"This means that although the resource, <strong>%1</strong>, was able to be " -"opened, an error occurred while reading the contents of the resource." -msgstr "" - -#: src/core/job_error.cpp:688 -msgid "You may not have permissions to read from the resource." -msgstr "आपके पास रिसोर्स से पढ़ने की अनुमति शायद नहीं होगी." - -#: src/core/job_error.cpp:701 -msgid "Cannot Write to Resource" -msgstr "रिसोर्स पर लिख नहीं सका" - -#: src/core/job_error.cpp:702 -#, kde-format -msgid "" -"This means that although the resource, <strong>%1</strong>, was able to be " -"opened, an error occurred while writing to the resource." -msgstr "" - -#: src/core/job_error.cpp:705 -msgid "You may not have permissions to write to the resource." -msgstr "आपके पास रिसोर्स से लिखने की अनुमति शायद नहीं होगी." - -#: src/core/job_error.cpp:718 src/core/job_error.cpp:729 -msgid "Could Not Listen for Network Connections" -msgstr "नेटवर्क कनेक्शन के लिए सुन नहीं सकते" - -#: src/core/job_error.cpp:719 -msgid "Could Not Bind" -msgstr "बाइंड नहीं कर सका" - -#: src/core/job_error.cpp:720 src/core/job_error.cpp:731 -msgid "" -"This is a fairly technical error in which a required device for network " -"communications (a socket) could not be established to listen for incoming " -"network connections." -msgstr "" - -#: src/core/job_error.cpp:730 -msgid "Could Not Listen" -msgstr "पर सुन नहीं सका" - -#: src/core/job_error.cpp:740 -msgid "Could Not Accept Network Connection" -msgstr "नेटवर्क कनेक्शन स्वीकार नहीं कर सका" - -#: src/core/job_error.cpp:741 -msgid "" -"This is a fairly technical error in which an error occurred while attempting " -"to accept an incoming network connection." -msgstr "" -"यह पूरी तकनीकी त्रुटि है जिसमें आवक नेटवर्क कनेक्शन को स्वीकारने की कोशिश में त्रुटि हुई." - -#: src/core/job_error.cpp:745 -msgid "You may not have permissions to accept the connection." -msgstr "आपके पास कनेक्शन स्वीकारने की अनुमति शायद नहीं होगी." - -#: src/core/job_error.cpp:750 -#, kde-format -msgid "Could Not Login: %1" -msgstr " %1 पर लॉगिन नहीं कर सका" - -#: src/core/job_error.cpp:751 -msgid "" -"An attempt to login to perform the requested operation was unsuccessful." -msgstr "निवेदित ऑपरेशन निष्पादित करने के लिए लॉगिन की एक कोशिश असफल हुई." - -#: src/core/job_error.cpp:762 -msgid "Could Not Determine Resource Status" -msgstr "रिसोर्स स्थिति निर्धारित नहीं कर सका" - -#: src/core/job_error.cpp:763 -msgid "Could Not Stat Resource" -msgstr "रिसोर्स स्टेट नहीं कर सका" - -#: src/core/job_error.cpp:764 -#, kde-format -msgid "" -"An attempt to determine information about the status of the resource <strong>" -"%1</strong>, such as the resource name, type, size, etc., was unsuccessful." -msgstr "" -"रिसोर्स <strong>%1</strong> की स्थिति के बारे में जानकारी निर्धारित करने की कोशिश, " -"जैसे कि रिसोर्स नाम, क़िस्म, इत्यादि सफल नहीं रही." - -#: src/core/job_error.cpp:767 -msgid "The specified resource may not have existed or may not be accessible." -msgstr "उल्लेखित रिसोर्स या तो उपलब्ध नहीं है, या फिर पहुँच योग्य नहीं है." - -#: src/core/job_error.cpp:775 -msgid "Could Not Cancel Listing" -msgstr "लिस्टिंग रद्द नहीं कर सका" - -#: src/core/job_error.cpp:776 -msgid "FIXME: Document this" -msgstr "FIXME: इसका दस्तावेज़ बनाएँ" - -#: src/core/job_error.cpp:780 -msgid "Could Not Create Folder" -msgstr "फ़ोल्डर बना नहीं सका" - -#: src/core/job_error.cpp:781 -msgid "An attempt to create the requested folder failed." -msgstr "निवेदित फ़ोल्डर बनाने की एक कोशिश असफल हुई." - -#: src/core/job_error.cpp:782 -msgid "The location where the folder was to be created may not exist." -msgstr "स्थान जहाँ फ़ोल्डर बनाया जाना है, शायद अस्तित्व में नहीं है." - -#: src/core/job_error.cpp:791 -msgid "Could Not Remove Folder" -msgstr "फ़ोल्डर नहीं सका" - -#: src/core/job_error.cpp:792 -#, kde-format -msgid "An attempt to remove the specified folder, <strong>%1</strong>, failed." -msgstr "उल्लेखित फ़ोल्डर <strong>%1</strong> को मिटाने की कोशिश असफल हुई." - -#: src/core/job_error.cpp:794 -msgid "The specified folder may not exist." -msgstr "उल्लेखित फ़ोल्डर अस्तित्व में नहीं है." - -#: src/core/job_error.cpp:795 -msgid "The specified folder may not be empty." -msgstr "उल्लेखित फ़ोल्डर शायद खाली नहीं है." - -#: src/core/job_error.cpp:800 -msgid "Ensure that the folder exists and is empty, and try again." -msgstr "सुनिश्चित हों कि फ़ोल्डर विद्यमान है, एवं फिर से कोशिश करें." - -#: src/core/job_error.cpp:805 -msgid "Could Not Resume File Transfer" -msgstr "फ़ाइल हस्तांतरण पुनरारंभ नहीं कर सकता" - -#: src/core/job_error.cpp:806 -#, kde-format -msgid "" -"The specified request asked that the transfer of file <strong>%1</strong> be " -"resumed at a certain point of the transfer. This was not possible." -msgstr "" -"निर्दिष्ट निवेदन ने पूछा है कि फ़ाइल <strong>%1</strong> का ट्रांसफर किसी विशिष्ट बिन्दु " -"से रीज्यूम किया जाना चाहिए. यह संभव नहीं है." - -#: src/core/job_error.cpp:809 -msgid "The protocol, or the server, may not support file resuming." -msgstr "प्रोटोकॉल या फ़ाइल सर्वर शायद फ़ाइल रिज़्यूमिंग समर्थित नहीं करते." - -#: src/core/job_error.cpp:811 -msgid "Retry the request without attempting to resume transfer." -msgstr "ट्रांसफर पुनरारंभ करने की कोशिश किए बगैर निवेदन फिर से कोशिश करें" - -#: src/core/job_error.cpp:816 -msgid "Could Not Rename Resource" -msgstr "रिसोर्स नाम बदल नहीं सका" - -#: src/core/job_error.cpp:817 -#, kde-format -msgid "An attempt to rename the specified resource <strong>%1</strong> failed." -msgstr "उल्लेखित रिसोर्स <strong>%1</strong> का नाम बदलने की कोशिश असफल हुई." - -#: src/core/job_error.cpp:827 -msgid "Could Not Alter Permissions of Resource" -msgstr "रिसोर्स की अनुमतियाँ बदल नहीं सका." - -#: src/core/job_error.cpp:828 -#, kde-format -msgid "" -"An attempt to alter the permissions on the specified resource <strong>%1</" -"strong> failed." -msgstr "उल्लेखित रिसोर्स <strong>%1</strong> की अनुमतिययाँ बदलने की कोशिश असफल हुई." - -#: src/core/job_error.cpp:835 -msgid "Could Not Change Ownership of Resource" -msgstr "रीसोर्स का मालिकाना बदला नहीं जा सका" - -#: src/core/job_error.cpp:836 -#, kde-format -msgid "" -"An attempt to change the ownership of the specified resource <strong>%1</" -"strong> failed." -msgstr "निर्दिष्ट रिसोर्स <strong>%1</strong> की मालिकाना बदलने की कोशिश असफल रही." - -#: src/core/job_error.cpp:843 -msgid "Could Not Delete Resource" -msgstr "रिसोर्स मिटा नहीं सका" - -#: src/core/job_error.cpp:844 -#, kde-format -msgid "An attempt to delete the specified resource <strong>%1</strong> failed." -msgstr "उल्लेखित रिसोर्स <strong>%1</strong> को मिटाने की कोशिश असफल हुई." - -#: src/core/job_error.cpp:851 -msgid "Unexpected Program Termination" -msgstr " प्रोग्राम अप्रत्याशित बन्द" - -#: src/core/job_error.cpp:852 -#, kde-format -msgid "" -"The program on your computer which provides access to the <strong>%1</" -"strong> protocol has unexpectedly terminated." -msgstr "" -"आपके कम्प्यूटर पर <strong>%1</strong> प्रोटोकॉल पर पहुँच के लिए संस्थापित प्रोग्राम " -"अप्रत्याशित रूप से बन्द हो गया." - -#: src/core/job_error.cpp:860 -msgid "Out of Memory" -msgstr "मेमोरी कम पड़ गई" - -#: src/core/job_error.cpp:861 -#, kde-format -msgid "" -"The program on your computer which provides access to the <strong>%1</" -"strong> protocol could not obtain the memory required to continue." -msgstr "" -"आपके कम्प्यूटर पर <strong>%1</strong> प्रोटोकॉल पर पहुँच स्थापित करने वाले प्रोग्राम में " -"जारी रखने लायक वांछित मेमोरी प्राप्त नहीं हो सकी." - -#: src/core/job_error.cpp:869 -msgid "Unknown Proxy Host" -msgstr "अज्ञात प्रॉक्सी होस्ट" - -#: src/core/job_error.cpp:870 -#, kde-format -msgid "" -"While retrieving information about the specified proxy host, <strong>%1</" -"strong>, an Unknown Host error was encountered. An unknown host error " -"indicates that the requested name could not be located on the Internet." -msgstr "" - -#: src/core/job_error.cpp:874 -msgid "" -"There may have been a problem with your network configuration, specifically " -"your proxy's hostname. If you have been accessing the Internet with no " -"problems recently, this is unlikely." -msgstr "" - -#: src/core/job_error.cpp:878 -msgid "Double-check your proxy settings and try again." -msgstr "अपनी प्रॉक्सी सेटिंग दोबार जांचें एवं फिर से कोशिश करें." - -#: src/core/job_error.cpp:883 -#, kde-format -msgid "Authentication Failed: Method %1 Not Supported" -msgstr "अनुमोदन असफल, विधि %1 समर्थित नहीं है" - -#: src/core/job_error.cpp:885 -#, kde-format -msgid "" -"Although you may have supplied the correct authentication details, the " -"authentication failed because the method that the server is using is not " -"supported by the KDE program implementing the protocol %1." -msgstr "" - -#: src/core/job_error.cpp:889 -msgid "" -"Please file a bug at <a href=\"http://bugs.kde.org/\">http://bugs.kde.org/</" -"a> to inform the KDE team of the unsupported authentication method." -msgstr "" -"असमर्थित प्रमाणीकरण विधि के बारे में केडीई टोली को बताने के लिए कृपया <a href=\"http://" -"bugs.kde.org/\">http://bugs.kde.org/</a> पर बग रपट दर्ज करें." - -#: src/core/job_error.cpp:895 -msgid "Request Aborted" -msgstr "निवेदन रोका गया" - -#: src/core/job_error.cpp:902 -msgid "Internal Error in Server" -msgstr "सर्वर में आंतरिक त्रुटि" - -#: src/core/job_error.cpp:903 -#, kde-format -msgid "" -"The program on the server which provides access to the <strong>%1</strong> " -"protocol has reported an internal error: %2." -msgstr "" -"सर्वर में <strong>%1</strong> प्रोटोकॉल पर पहुँच प्रदान करने वाले प्रोग्राम ने आंतरिक " -"त्रुटि रपट दी: %2." - -#: src/core/job_error.cpp:906 -msgid "" -"This is most likely to be caused by a bug in the server program. Please " -"consider submitting a full bug report as detailed below." -msgstr "" -"बहुत संभव है कि यह सर्वर प्रोग्राम में बग के कारण हुआ है. कृपया नीचे दिए विवरण अनुसार पूरा " -"बग रपट जमा करें" - -#: src/core/job_error.cpp:909 -msgid "Contact the administrator of the server to advise them of the problem." -msgstr "समस्या के बारे में परामर्श के लिए सर्वर के प्रशासक से सम्पर्क करें." - -#: src/core/job_error.cpp:911 -msgid "" -"If you know who the authors of the server software are, submit the bug " -"report directly to them." -msgstr "यदि आप जानते हैं कि सर्वर सॉफ़्टवेयर के कौन लेखक हैं, तो बग रपट उन्हें सीधे जमा करें." - -#: src/core/job_error.cpp:916 -msgid "Timeout Error" -msgstr "टाइम-आउट त्रुटि" - -#: src/core/job_error.cpp:917 -#, kde-format -msgid "" -"Although contact was made with the server, a response was not received " -"within the amount of time allocated for the request as follows:" -"<ul><li>Timeout for establishing a connection: %1 seconds</li><li>Timeout " -"for receiving a response: %2 seconds</li><li>Timeout for accessing proxy " -"servers: %3 seconds</li></ul>Please note that you can alter these timeout " -"settings in the KDE System Settings, by selecting Network Settings -> " -"Connection Preferences." -msgstr "" - -#: src/core/job_error.cpp:928 -msgid "The server was too busy responding to other requests to respond." -msgstr "अन्य निवेदनों को उत्तर देने में सर्वर बहुत ज्यादा व्यस्त है." - -#: src/core/job_error.cpp:934 src/core/slavebase.cpp:1414 -msgid "Unknown Error" -msgstr "अज्ञात त्रुटि" - -#: src/core/job_error.cpp:935 -#, kde-format -msgid "" -"The program on your computer which provides access to the <strong>%1</" -"strong> protocol has reported an unknown error: %2." -msgstr "" -"आपके कम्प्यूटर में <strong>%1</strong> प्रोटोकॉल पर पहुँच प्रदान करने वाले प्रोग्राम ने एक " -"अज्ञात त्रुटि रपट की: %2." - -#: src/core/job_error.cpp:943 -msgid "Unknown Interruption" -msgstr "अज्ञात इंटरप्शन" - -#: src/core/job_error.cpp:944 -#, kde-format -msgid "" -"The program on your computer which provides access to the <strong>%1</" -"strong> protocol has reported an interruption of an unknown type: %2." -msgstr "" -"आपके कम्प्यूटर में <strong>%1</strong> प्रोटोकॉल पर पहुँच प्रदान करने वाले प्रोग्राम ने एक " -"अज्ञात इंटरप्शन रपट की: %2." - -#: src/core/job_error.cpp:952 -msgid "Could Not Delete Original File" -msgstr "मूल फ़ाइल मिटा नहीं सकते." - -#: src/core/job_error.cpp:953 -#, kde-format -msgid "" -"The requested operation required the deleting of the original file, most " -"likely at the end of a file move operation. The original file <strong>%1</" -"strong> could not be deleted." -msgstr "" -"निवेदित ऑपरेशन मूल फ़ाइल को मिटाना चाहता है, बहुत संभव है फ़ाइल खिसकाने के अंत में. मूल " -"फ़ाइल <strong>%1</strong> मिटाया नहीं जा सका." - -#: src/core/job_error.cpp:962 -msgid "Could Not Delete Temporary File" -msgstr "अस्थायी फ़ाइल मिटा नहीं सकते." - -#: src/core/job_error.cpp:963 -#, kde-format -msgid "" -"The requested operation required the creation of a temporary file in which " -"to save the new file while being downloaded. This temporary file <strong>%1</" -"strong> could not be deleted." -msgstr "" - -#: src/core/job_error.cpp:972 -msgid "Could Not Rename Original File" -msgstr "मूल फ़ाइल का नाम बदल नहीं सकते." - -#: src/core/job_error.cpp:973 -#, kde-format -msgid "" -"The requested operation required the renaming of the original file <strong>" -"%1</strong>, however it could not be renamed." -msgstr "" -"निवेदित ऑपरेशन मूल फ़ाइल <strong>%1</strong> का नाम बदलना चाहता है, हालांकि यह नाम " -"नहीं बदला जा सका." - -#: src/core/job_error.cpp:981 -msgid "Could Not Rename Temporary File" -msgstr "अस्थायी फ़ाइल तैयार नहीं कर सकते." - -#: src/core/job_error.cpp:982 -#, kde-format -msgid "" -"The requested operation required the creation of a temporary file <strong>" -"%1</strong>, however it could not be created." -msgstr "" -"निवेदित ऑपरेशन में अस्थायी फ़ाइल <strong>%1</strong> बनाना आवश्यक है, हालांकि यह " -"बनाया नहीं जा सका." - -#: src/core/job_error.cpp:990 -msgid "Could Not Create Link" -msgstr "लिंक तैयार नहीं कर सकते." - -#: src/core/job_error.cpp:991 -msgid "Could Not Create Symbolic Link" -msgstr "सिंबॉलिक लिंक तैयार नहीं कर सकते." - -#: src/core/job_error.cpp:992 -#, kde-format -msgid "The requested symbolic link %1 could not be created." -msgstr "निवेदित सिंबालिक लिंक %1 तैयार नहीं की जा सकी." - -#: src/core/job_error.cpp:999 -msgid "No Content" -msgstr "कोई विषयवस्तु नहीं" - -#: src/core/job_error.cpp:1004 -msgid "Disk Full" -msgstr "डिस्क पूरा भर गया" - -#: src/core/job_error.cpp:1005 -#, kde-format -msgid "" -"The requested file <strong>%1</strong> could not be written to as there is " -"inadequate disk space." -msgstr "" -"निवेदित फ़ाइल <strong>%1</strong> लिखी नहीं जा सकी चूंकि डिस्क में अपर्याप्त जगह है." - -#: src/core/job_error.cpp:1007 -msgid "" -"Free up enough disk space by 1) deleting unwanted and temporary files; 2) " -"archiving files to removable media storage such as CD-Recordable discs; or " -"3) obtain more storage capacity." -msgstr "" - -#: src/core/job_error.cpp:1014 -msgid "Source and Destination Files Identical" -msgstr "स्रोत तथा गंतव्य फ़ाइलें एक ही हैं" - -#: src/core/job_error.cpp:1015 -msgid "" -"The operation could not be completed because the source and destination " -"files are the same file." -msgstr "ऑपरेशन पूरा नहीं किया जा सका चूंकि स्रोत तथा गंतव्य फ़ाइल एक ही है." - -#: src/core/job_error.cpp:1017 -msgid "Choose a different filename for the destination file." -msgstr "गंतव्य फ़ाइल के लिए पृथक नाम चुनें." - -#: src/core/job_error.cpp:1028 -msgid "Undocumented Error" -msgstr "अदस्तावेज़ीकृत त्रुटि" - -#: src/core/kcoredirlister.cpp:397 src/widgets/krun.cpp:834 -#: src/widgets/paste.cpp:260 src/widgets/renamedialog.cpp:410 -#, kde-format -msgid "" -"Malformed URL\n" -"%1" -msgstr "" -"गलत URL\n" -"%1" - -#: src/core/kcoredirlister.cpp:402 -#, kde-format -msgid "" -"URL cannot be listed\n" -"%1" -msgstr "" -"यूआरएल सूचीबद्ध नहीं किया जा सकता\n" -"%1" - -#: src/core/kfileitem.cpp:1202 -#, kde-format -msgid "(Symbolic Link to %1)" -msgstr "( %1 पर एक सिंबालिक लिंक)" - -#: src/core/kfileitem.cpp:1204 -#, kde-format -msgid "(%1, Link to %2)" -msgstr "(%1, इस पर कड़ी: %2)" - -#: src/core/kfileitem.cpp:1207 -#, fuzzy, kde-format -#| msgid "Points to:" -msgid " (Points to %1)" -msgstr "की ओर इशाराः" - -#: src/core/klocalsocket_unix.cpp:192 src/core/klocalsocket_unix.cpp:260 -#, fuzzy -#| msgid "The certificate is invalid." -msgid "Specified socket path is invalid" -msgstr "प्रमाणपत्र अवैध है." - -#: src/core/klocalsocket_unix.cpp:201 src/core/klocalsocket_unix.cpp:248 -#: src/core/klocalsocket_unix.cpp:269 -#, fuzzy -#| msgid "The protocol %1 is not supported." -msgid "The socket operation is not supported" -msgstr "प्रोटोकॉल %1 समर्थित नहीं है" - -#: src/core/klocalsocket_unix.cpp:214 -#, fuzzy -#| msgid "Connection to Server Refused" -msgid "Connection refused" -msgstr "सर्वर से कनेक्शन अस्वीकृत" - -#: src/core/klocalsocket_unix.cpp:219 src/core/klocalsocket_unix.cpp:282 -#, fuzzy -#| msgctxt "@title:column" -#| msgid "Permissions" -msgid "Permission denied" -msgstr "अनुमतियाँ" - -#: src/core/klocalsocket_unix.cpp:223 -#, fuzzy -#| msgid "Connection timed out." -msgid "Connection timed out" -msgstr "कनेक्शन टाइम आउट" - -#: src/core/klocalsocket_unix.cpp:227 src/core/klocalsocket_unix.cpp:307 -#, fuzzy -#| msgid "Unknown Error" -msgid "Unknown error" -msgstr "अज्ञात त्रुटि" - -#: src/core/klocalsocket_unix.cpp:235 src/core/klocalsocket_unix.cpp:315 -#, fuzzy -#| msgid "Could not login to %1." -msgid "Could not set non-blocking mode" -msgstr " %1 पर लॉगइन नहीं हो सका." - -#: src/core/klocalsocket_unix.cpp:286 -msgid "Address is already in use" -msgstr "" - -#: src/core/klocalsocket_unix.cpp:291 -#, fuzzy -#| msgid "" -#| "URL cannot be listed\n" -#| "%1" -msgid "Path cannot be used" -msgstr "" -"यूआरएल सूचीबद्ध नहीं किया जा सकता\n" -"%1" - -#: src/core/klocalsocket_unix.cpp:295 -msgid "No such file or directory" -msgstr "" - -#: src/core/klocalsocket_unix.cpp:299 -#, fuzzy -#| msgctxt "@title job" -#| msgid "Creating directory" -msgid "Not a directory" -msgstr "डिरेक्ट्री बनाया जा रहा है" - -#: src/core/klocalsocket_unix.cpp:303 -msgid "Read-only filesystem" -msgstr "" - -#: src/core/klocalsocket_unix.cpp:370 src/core/klocalsocket_unix.cpp:404 -#, fuzzy -#| msgid "Unknown Error" -msgid "Unknown socket error" -msgstr "अज्ञात त्रुटि" - -#: src/core/klocalsocket_win.cpp:31 src/core/klocalsocket_win.cpp:36 -#, fuzzy -#| msgid "Writing to %1 is not supported." -msgid "Operation not supported" -msgstr " %1 पर लिखा जाना समर्थित नहीं है." - -#: src/core/ktcpsocket.cpp:165 -msgctxt "SSL error" -msgid "No error" -msgstr "" - -#: src/core/ktcpsocket.cpp:167 -#, fuzzy -#| msgid "The certificate is invalid." -msgctxt "SSL error" -msgid "The certificate authority's certificate is invalid" -msgstr "प्रमाणपत्र अवैध है." - -#: src/core/ktcpsocket.cpp:169 -#, fuzzy -#| msgid "Certificate has expired." -msgctxt "SSL error" -msgid "The certificate has expired" -msgstr "प्रमाणपत्र की मियाद ख़त्म हो चुकी है." - -#: src/core/ktcpsocket.cpp:171 -#, fuzzy -#| msgid "The certificate is invalid." -msgctxt "SSL error" -msgid "The certificate is invalid" -msgstr "प्रमाणपत्र अवैध है." - -#: src/core/ktcpsocket.cpp:173 -#, fuzzy -#| msgid "The certificate has not been issued for this host." -msgctxt "SSL error" -msgid "The certificate is not signed by any trusted certificate authority" -msgstr "इस होस्ट के लिए प्रमाणपत्र जारी नहीं हुआ है." - -#: src/core/ktcpsocket.cpp:175 -#, fuzzy -#| msgid "Certificate has been revoked." -msgctxt "SSL error" -msgid "The certificate has been revoked" -msgstr "प्रमाणपत्र रद्द कर दिया गया है." - -#: src/core/ktcpsocket.cpp:177 -#, fuzzy -#| msgid "The certificate has not been issued for this host." -msgctxt "SSL error" -msgid "The certificate is unsuitable for this purpose" -msgstr "इस होस्ट के लिए प्रमाणपत्र जारी नहीं हुआ है." - -#: src/core/ktcpsocket.cpp:179 -#, fuzzy -#| msgid "The certificate has not been issued for this host." -msgctxt "SSL error" -msgid "" -"The root certificate authority's certificate is not trusted for this purpose" -msgstr "इस होस्ट के लिए प्रमाणपत्र जारी नहीं हुआ है." - -#: src/core/ktcpsocket.cpp:181 -#, fuzzy -#| msgid "" -#| "The IP address of the host %1 does not match the one the certificate was " -#| "issued to." -msgctxt "SSL error" -msgid "" -"The certificate authority's certificate is marked to reject this " -"certificate's purpose" -msgstr "होस्ट %1 का आईपी पता जो प्रमाणपत्र जारी किया गया है, उससे मेल नहीं खाता." - -#: src/core/ktcpsocket.cpp:183 -#, fuzzy -#| msgid "Do not send a certificate" -msgctxt "SSL error" -msgid "The peer did not present any certificate" -msgstr "कोई प्रमाणपत्र नहीं भेजें" - -#: src/core/ktcpsocket.cpp:185 -#, fuzzy -#| msgid "The certificate has not been issued for this host." -msgctxt "SSL error" -msgid "The certificate does not apply to the given host" -msgstr "इस होस्ट के लिए प्रमाणपत्र जारी नहीं हुआ है." - -#: src/core/ktcpsocket.cpp:187 -#, fuzzy -#| msgid "The certificate has not been issued for this host." -msgctxt "SSL error" -msgid "The certificate cannot be verified for internal reasons" -msgstr "इस होस्ट के लिए प्रमाणपत्र जारी नहीं हुआ है." - -#: src/core/ktcpsocket.cpp:189 -#, fuzzy -#| msgid "The certificate is valid." -msgctxt "SSL error" -msgid "The certificate chain is too long" -msgstr "प्रमाणपत्र वैध है." - -#: src/core/ktcpsocket.cpp:192 -#, fuzzy -#| msgid "Unknown Error" -msgctxt "SSL error" -msgid "Unknown error" -msgstr "अज्ञात त्रुटि" - -#: src/core/slave.cpp:445 -#, kde-format -msgid "Unknown protocol '%1'." -msgstr "अज्ञात प्रोटोकॉल '%1'." - -#: src/core/slave.cpp:455 -#, kde-format -msgid "Can not find io-slave for protocol '%1'." -msgstr "प्रोटोकॉल '%1' के लिए आइओ-स्लेव प्राप्त नहीं कर सका." - -#: src/core/slave.cpp:466 -#, fuzzy -#| msgid "Can not find io-slave for protocol '%1'." -msgid "Can not find 'kioslave' executable" -msgstr "प्रोटोकॉल '%1' के लिए आइओ-स्लेव प्राप्त नहीं कर सका." - -#: src/core/slave.cpp:481 -#, kde-format -msgid "Cannot talk to klauncher: %1" -msgstr "के-लांचर से बात नहीं कर सका: %1" - -#: src/core/slave.cpp:488 -#, kde-format -msgid "" -"Unable to create io-slave:\n" -"klauncher said: %1" -msgstr "" -"आइओ-स्लेव तैयार करने में अक्षम:\n" -" के-लांचर का कथन: %1" - -#: src/core/slavebase.cpp:768 -#, kde-format -msgid "Opening connections is not supported with the protocol %1." -msgstr "प्रोटोकॉल %1 के साथ कनेक्शन खोलना समर्थित नहीं है." - -#: src/core/slavebase.cpp:770 -#, kde-format -msgid "Closing connections is not supported with the protocol %1." -msgstr "प्रोटोकॉल %1 के साथ कनेक्शन बंद करना समर्थित नहीं है." - -#: src/core/slavebase.cpp:772 -#, kde-format -msgid "Accessing files is not supported with the protocol %1." -msgstr "प्रोटोकॉल %1 के साथ फ़ाइल एक्सेस करना समर्थित नहीं है." - -#: src/core/slavebase.cpp:774 -#, kde-format -msgid "Writing to %1 is not supported." -msgstr " %1 पर लिखा जाना समर्थित नहीं है." - -#: src/core/slavebase.cpp:776 -#, kde-format -msgid "There are no special actions available for protocol %1." -msgstr "प्रोटोकॉल %1 के लिए कोई विशेष क्रिया उपलब्ध नहीं है." - -#: src/core/slavebase.cpp:778 -#, kde-format -msgid "Listing folders is not supported for protocol %1." -msgstr "प्रोटोकॉल %1 के लिए फ़ोल्डर की सूची बनाना समर्थित नहीं है." - -#: src/core/slavebase.cpp:780 -#, kde-format -msgid "Retrieving data from %1 is not supported." -msgstr "%1 से डाटा निकालना समर्थित नहीं है." - -#: src/core/slavebase.cpp:782 -#, kde-format -msgid "Retrieving mime type information from %1 is not supported." -msgstr "%1 से माइम क़िस्म जानकारी निकालना समर्थित नहीं है." - -#: src/core/slavebase.cpp:784 -#, kde-format -msgid "Renaming or moving files within %1 is not supported." -msgstr "%1 के भीतर फ़ाइल खिसकाना या नाम बदलना समर्थित नहीं है." - -#: src/core/slavebase.cpp:786 -#, kde-format -msgid "Creating symlinks is not supported with protocol %1." -msgstr "प्रोटोकॉल %1 के साथ सिमलिंक तैयार करना समर्थित नहीं है." - -#: src/core/slavebase.cpp:788 -#, kde-format -msgid "Copying files within %1 is not supported." -msgstr "%1 के भीतर फ़ाइल नक़ल करना समर्थित नहीं है." - -#: src/core/slavebase.cpp:790 -#, kde-format -msgid "Deleting files from %1 is not supported." -msgstr "%1 से फ़ाइल मिटाना समर्थित नहीं है." - -#: src/core/slavebase.cpp:792 -#, kde-format -msgid "Creating folders is not supported with protocol %1." -msgstr "प्रोटोकॉल %1 के साथ फ़ोल्डर तैयार करना समर्थित नहीं है." - -#: src/core/slavebase.cpp:794 -#, kde-format -msgid "Changing the attributes of files is not supported with protocol %1." -msgstr "प्रोटोकॉल %1 के साथ फ़ाइल विशेषता बदलना समर्थित नहीं है." - -#: src/core/slavebase.cpp:796 -#, kde-format -msgid "Changing the ownership of files is not supported with protocol %1." -msgstr "प्रोटोकॉल %1 के साथ फ़ाइलों का मालिकाना बदलना समर्थित नहीं है." - -#: src/core/slavebase.cpp:798 -#, kde-format -msgid "Using sub-URLs with %1 is not supported." -msgstr "%1 के साथ सब-यूआरएल उपयोग करना समर्थित नहीं है." - -#: src/core/slavebase.cpp:800 -#, kde-format -msgid "Multiple get is not supported with protocol %1." -msgstr "प्रोटोकॉल %1 के साथ मल्टीपल गेट समर्थित नहीं है." - -#: src/core/slavebase.cpp:802 -#, kde-format -msgid "Opening files is not supported with protocol %1." -msgstr "प्रोटोकॉल %1 के साथ फ़ाइलें खोलना समर्थित नहीं है." - -#: src/core/slavebase.cpp:804 -#, kde-format -msgid "Protocol %1 does not support action %2." -msgstr "प्रोटोकॉल %1 क्रिया %2 को समर्थित नहीं करता." - -#: src/core/slavebase.cpp:960 -msgid "&Yes" -msgstr "" - -#: src/core/slavebase.cpp:961 -msgid "&No" -msgstr "" - -#: src/core/slaveinterface.cpp:413 src/core/tcpslavebase.cpp:822 -#: src/widgets/sslui.cpp:78 -msgid "&Details" -msgstr "विवरण (&D) " - -#: src/core/slaveinterface.cpp:415 src/core/tcpslavebase.cpp:839 -#: src/widgets/sslui.cpp:114 -msgid "&Forever" -msgstr "सर्वदा (&F)" - -#: src/core/slaveinterface.cpp:419 src/core/tcpslavebase.cpp:822 -#: src/widgets/sslui.cpp:79 -msgid "Co&ntinue" -msgstr "जारी रहें (&n)" - -#: src/core/slaveinterface.cpp:421 src/core/tcpslavebase.cpp:840 -#: src/widgets/sslui.cpp:115 -#, fuzzy -#| msgid "&Current Sessions Only" -msgid "&Current Session only" -msgstr "सिर्फ मौज़ूदा सत्र (&C)" - -#: src/core/socketconnectionbackend.cpp:144 -#, kde-format -msgid "Unable to create io-slave: %1" -msgstr "आइओ-स्लेव तैयार करने में अक्षम: %1" - -#: src/core/tcpslavebase.cpp:319 -msgid "" -"You are about to leave secure mode. Transmissions will no longer be " -"encrypted.\n" -"This means that a third party could observe your data in transit." -msgstr "" -"आप सुरक्षित प्रणाली को छोड़ने वाले हैं संचारण अब एनक्रिप्टेड नहीं रहेगा.\n" -" इसका अर्थ है कि कोई तीसरा पक्ष संचार के दौरान आपका डाटा देख सकता है." - -#: src/core/tcpslavebase.cpp:325 src/core/tcpslavebase.cpp:590 -msgid "Security Information" -msgstr "सुरक्षा जानकारी" - -#: src/core/tcpslavebase.cpp:326 -msgid "C&ontinue Loading" -msgstr "लोड करना जारी रखें (&o)" - -#: src/core/tcpslavebase.cpp:421 -#, fuzzy, kde-format -#| msgid "Authentication Failed." -msgctxt "%1 is a host name" -msgid "%1: SSL negotiation failed" -msgstr "प्रमाणीकरण असफल." - -#: src/core/tcpslavebase.cpp:584 -msgid "" -"You are about to enter secure mode. All transmissions will be encrypted " -"unless otherwise noted.\n" -"This means that no third party will be able to easily observe your data in " -"transit." -msgstr "" -"आप सुरक्षित विधि में जाने वाले हैं. सभी संचारण एनक्रिप्टेड होंगे, जब तक कि संकेत नहीं दिया " -"जाएगा.\n" -" इसका अर्थ है कि कोई भी तीसरा पक्ष आपके डाटा को पारगमन के दोरान आसानी से देख नहीं " -"सकेंगे." - -#: src/core/tcpslavebase.cpp:591 -msgid "Display SSL &Information" -msgstr "एसएसएल जानकारी दिखाएँ (&I)" - -#: src/core/tcpslavebase.cpp:592 -msgid "C&onnect" -msgstr "कनेक्ट (&o)" - -#: src/core/tcpslavebase.cpp:736 -msgid "Enter the certificate password:" -msgstr "प्रमाणपत्र पासवर्ड भरें:" - -#: src/core/tcpslavebase.cpp:737 -msgid "SSL Certificate Password" -msgstr "एसएसएल प्रमाणपत्र पासवर्ड" - -#: src/core/tcpslavebase.cpp:751 -msgid "Unable to open the certificate. Try a new password?" -msgstr "प्रमाणपत्र खोलने में अक्षम. एक नया पासवर्ड आज़माएँ?" - -#: src/core/tcpslavebase.cpp:765 -msgid "The procedure to set the client certificate for the session failed." -msgstr "सत्र के लिए क्लाएँट प्रमाणपत्र नियत करने की प्रक्रिया असफल." - -#: src/core/tcpslavebase.cpp:767 src/widgets/jobuidelegate.cpp:341 -msgid "SSL" -msgstr "एसएसएल" - -#: src/core/tcpslavebase.cpp:811 src/widgets/sslui.cpp:68 -#, fuzzy, kde-format -#| msgid "The server certificate failed the authenticity test (%1)." -msgid "" -"The server failed the authenticity check (%1).\n" -"\n" -msgstr "सर्वर प्रमाणपत्र प्रमाणीकरण जांच (%1) में सर्वर प्रमाणपत्र असफल हो गया." - -#: src/core/tcpslavebase.cpp:821 src/core/tcpslavebase.cpp:838 -#: src/core/tcpslavebase.cpp:942 src/core/tcpslavebase.cpp:954 -#: src/widgets/sslui.cpp:77 src/widgets/sslui.cpp:113 -msgid "Server Authentication" -msgstr "सर्वर प्रमाणीकरण" - -#: src/core/tcpslavebase.cpp:835 src/widgets/sslui.cpp:110 -msgid "" -"Would you like to accept this certificate forever without being prompted?" -msgstr "क्या आप इस प्रमाणपत्र को हमेशा के लिए स्वीकृत करना चाहेंगे बिना पूछे?" - -#: src/core/tcpslavebase.cpp:941 -msgid "" -"You have indicated that you wish to accept this certificate, but it is not " -"issued to the server who is presenting it. Do you wish to continue loading?" -msgstr "" -"आपने सूचित किया है कि आप इस प्रमाणपत्र को स्वीकारते हैं, पर इसे सर्वर को जारी नहीं किया " -"गया है जिसने इसे पेश किया है. क्या आप इसे लोड करना जारी रखना चाहते हैं?" - -#: src/core/tcpslavebase.cpp:953 -#, fuzzy -#| msgid "" -#| "SSL certificate is being rejected as requested. You can disable this in " -#| "the KDE Control Center." -msgid "" -"SSL certificate is being rejected as requested. You can disable this in the " -"KDE System Settings." -msgstr "" -"एसएसएल प्रमाणपत्र अस्वीकृत किया गया है जैसा कि निवेदित किया गया. आप इसे केडीई नियंत्रण " -"केंद्र में अक्षम कर सकते हैं." - -#: src/filewidgets/kdiroperator.cpp:761 -#, kde-format -msgid "A file or folder named %1 already exists." -msgstr "एक फ़ाइल या फ़ोल्डर नाम %1 पहले से ही अस्तित्व में है. " - -#: src/filewidgets/kdiroperator.cpp:764 -msgid "You do not have permission to create that folder." -msgstr "इस फ़ोल्डर को बनाने के लिए आपके पास अनुमति नहीं है." - -#: src/filewidgets/kdiroperator.cpp:779 -msgid "You did not select a file to delete." -msgstr "मिटाने के लिए आपने फ़ाइल चुना नहीं है" - -#: src/filewidgets/kdiroperator.cpp:780 -msgid "Nothing to Delete" -msgstr "मिटाने के लिए कुछ नहीं " - -#: src/filewidgets/kdiroperator.cpp:801 -#, kde-format -msgid "" -"<qt>Do you really want to delete\n" -" <b>'%1'</b>?</qt>" -msgstr "" -"<qt>क्या आप सचमुच में मिटाना चाहते हैं इसे-\n" -" <b>'%1'</b>?</qt>" - -#: src/filewidgets/kdiroperator.cpp:803 -msgid "Delete File" -msgstr "फ़ाइल मिटाएँ" - -#: src/filewidgets/kdiroperator.cpp:808 src/widgets/jobuidelegate.cpp:223 -#, kde-format -msgid "Do you really want to delete this item?" -msgid_plural "Do you really want to delete these %1 items?" -msgstr[0] "क्या आप सचमुच इस वस्तु को मिटाना चाहते हैं?" -msgstr[1] "क्या आप सचमुच इन %1 वस्तुऔं को मिटाना चाहते हैं?" - -#: src/filewidgets/kdiroperator.cpp:810 src/widgets/jobuidelegate.cpp:225 -msgid "Delete Files" -msgstr "फ़ाइलें मिटाएँ" - -#: src/filewidgets/kdiroperator.cpp:841 -msgid "You did not select a file to trash." -msgstr "मिटाने के लिए आपने फ़ाइल चुना नहीं है" - -#: src/filewidgets/kdiroperator.cpp:842 -msgid "Nothing to Trash" -msgstr "मिटाने के लिए कुछ नहीं " - -#: src/filewidgets/kdiroperator.cpp:859 -#, kde-format -msgid "" -"<qt>Do you really want to trash\n" -" <b>'%1'</b>?</qt>" -msgstr "<qt>क्या आप सचमुच <b>%1</b> को मिटाना चाहते हैं?</qt>" - -#: src/filewidgets/kdiroperator.cpp:861 -msgid "Trash File" -msgstr "फ़ाइल मिटाएँ" - -#: src/filewidgets/kdiroperator.cpp:862 src/filewidgets/kdiroperator.cpp:869 -msgctxt "to trash" -msgid "&Trash" -msgstr "रद्दी (&T)" - -#: src/filewidgets/kdiroperator.cpp:866 -#, kde-format -msgid "translators: not called for n == 1" -msgid_plural "Do you really want to trash these %1 items?" -msgstr[0] "क्या आप सचमुच इन %1 वस्तुओं को मिटाना चाहते हैं?" -msgstr[1] "क्या आप सचमुच इन %1 वस्तुओं को मिटाना चाहते हैं?" - -#: src/filewidgets/kdiroperator.cpp:868 -msgid "Trash Files" -msgstr "फ़ाइलों को रद्दी में भेजें" - -#: src/filewidgets/kdiroperator.cpp:1058 src/filewidgets/kdiroperator.cpp:1196 -msgid "The specified folder does not exist or was not readable." -msgstr "उल्लेखित फ़ाइल या फोल्ड उपलब्ध नहीं है या पढ़ने लायक नहीं है." - -#: src/filewidgets/kdiroperator.cpp:1858 -msgid "Menu" -msgstr "मेन्यू" - -#: src/filewidgets/kdiroperator.cpp:1862 -msgid "Parent Folder" -msgstr "पेरेन्ट फ़ोल्डर " - -#: src/filewidgets/kdiroperator.cpp:1869 -msgid "Home Folder" -msgstr "घर फ़ोल्डर" - -#: src/filewidgets/kdiroperator.cpp:1872 -msgid "Reload" -msgstr "री-लोड" - -#: src/filewidgets/kdiroperator.cpp:1875 -msgid "New Folder..." -msgstr "नया फ़ोल्डर..." - -#: src/filewidgets/kdiroperator.cpp:1880 src/widgets/jobuidelegate.cpp:246 -msgid "Move to Trash" -msgstr "रद्दी पर ले जाएँ" - -#: src/filewidgets/kdiroperator.cpp:1886 -msgid "Delete" -msgstr "मिटाएँ" - -#: src/filewidgets/kdiroperator.cpp:1893 -msgid "Sorting" -msgstr "क्रमबद्ध करने में" - -#: src/filewidgets/kdiroperator.cpp:1896 -msgid "By Name" -msgstr "नाम से" - -#: src/filewidgets/kdiroperator.cpp:1900 -msgid "By Size" -msgstr "आकार से " - -#: src/filewidgets/kdiroperator.cpp:1904 -msgid "By Date" -msgstr "तारीख़ से" - -#: src/filewidgets/kdiroperator.cpp:1908 -msgid "By Type" -msgstr "क़िस्म से " - -#: src/filewidgets/kdiroperator.cpp:1912 -msgid "Descending" -msgstr "घटते क्रम में" - -#: src/filewidgets/kdiroperator.cpp:1916 -msgid "Folders First" -msgstr "" - -#: src/filewidgets/kdiroperator.cpp:1926 -msgid "Icon Position" -msgstr "" - -#: src/filewidgets/kdiroperator.cpp:1929 -msgid "Next to File Name" -msgstr "" - -#: src/filewidgets/kdiroperator.cpp:1933 -msgid "Above File Name" -msgstr "" - -#: src/filewidgets/kdiroperator.cpp:1944 -msgid "Short View" -msgstr "छोटा दृश्य" - -#: src/filewidgets/kdiroperator.cpp:1949 -msgid "Detailed View" -msgstr "विस्तृत दृश्य" - -#: src/filewidgets/kdiroperator.cpp:1954 -#, fuzzy -#| msgid "Detailed View" -msgid "Tree View" -msgstr "विस्तृत दृश्य" - -#: src/filewidgets/kdiroperator.cpp:1959 -#, fuzzy -#| msgid "Detailed View" -msgid "Detailed Tree View" -msgstr "विस्तृत दृश्य" - -#: src/filewidgets/kdiroperator.cpp:1970 -msgid "Show Hidden Files" -msgstr "छुपी फ़ाइलें दिखाएँ" - -#: src/filewidgets/kdiroperator.cpp:1974 -#, fuzzy -#| msgid "Show Preview" -msgid "Show Aside Preview" -msgstr "पूर्वावलोकन दिखाएँ" - -#: src/filewidgets/kdiroperator.cpp:1980 -msgid "Show Preview" -msgstr "पूर्वावलोकन दिखाएँ" - -#: src/filewidgets/kdiroperator.cpp:1984 -#, fuzzy -#| msgid "Open file dialog" -msgid "Open File Manager" -msgstr "फ़ाइल खोलने का संवाद" - -#: src/filewidgets/kdiroperator.cpp:1989 -msgid "Properties" -msgstr "गुण" - -#: src/filewidgets/kdiroperator.cpp:1996 -msgid "&View" -msgstr "देखें (&V)" - -#: src/filewidgets/kencodingfiledialog.cpp:86 -msgid "Encoding:" -msgstr "एनकोडिंग:" - -#: src/filewidgets/kencodingfiledialog.cpp:142 -#: src/filewidgets/kencodingfiledialog.cpp:161 -#: src/filewidgets/kencodingfiledialog.cpp:179 -#: src/filewidgets/kencodingfiledialog.cpp:198 -#: src/widgets/kurlrequesterdialog.cpp:131 -msgid "Open" -msgstr "खोलें" - -#: src/filewidgets/kencodingfiledialog.cpp:217 -#: src/filewidgets/kencodingfiledialog.cpp:240 -msgid "Save As" -msgstr "ऐसे सहेजें" - -#: src/filewidgets/kfilefiltercombo.cpp:36 -#: src/filewidgets/kfilewidget.cpp:1842 -msgid "*|All Files" -msgstr "*|सभी फ़ाइलें" - -#: src/filewidgets/kfilefiltercombo.cpp:180 -msgid "All Supported Files" -msgstr "सभी समर्थित फ़ाइलें" - -#: src/filewidgets/kfilefiltercombo.cpp:189 -#, fuzzy -#| msgid "*|All Files" -msgid "All Files" -msgstr "*|सभी फ़ाइलें" - -#: src/filewidgets/kfileplaceeditdialog.cpp:85 -#, fuzzy -#| msgid "Edit Places Entry" -msgid "Add Places Entry" -msgstr "स्थान प्रविष्टि संपादन" - -#: src/filewidgets/kfileplaceeditdialog.cpp:87 -msgid "Edit Places Entry" -msgstr "स्थान प्रविष्टि संपादन" - -#: src/filewidgets/kfileplaceeditdialog.cpp:96 -msgid "" -"<qt>This is the text that will appear in the Places panel.<br /><br />The " -"label should consist of one or two words that will help you remember what " -"this entry refers to. If you do not enter a label, it will be derived from " -"the location's URL.</qt>" -msgstr "" - -#: src/filewidgets/kfileplaceeditdialog.cpp:102 -#, fuzzy -#| msgid "&Name:" -msgid "L&abel:" -msgstr "नाम: (&N)" - -#: src/filewidgets/kfileplaceeditdialog.cpp:104 -#, fuzzy -#| msgid "Description" -msgid "Enter descriptive label here" -msgstr "वर्णन" - -#: src/filewidgets/kfileplaceeditdialog.cpp:108 -#, kde-format -msgid "" -"<qt>This is the location associated with the entry. Any valid URL may be " -"used. For example:<br /><br />%1<br />http://www.kde.org<br />ftp://ftp.kde." -"org/pub/kde/stable<br /><br />By clicking on the button next to the text " -"edit box you can browse to an appropriate URL.</qt>" -msgstr "" - -#: src/filewidgets/kfileplaceeditdialog.cpp:114 -msgid "&Location:" -msgstr "स्थानः (&L)" - -#: src/filewidgets/kfileplaceeditdialog.cpp:120 -msgid "" -"<qt>This is the icon that will appear in the Places panel.<br /><br />Click " -"on the button to select a different icon.</qt>" -msgstr "" -"<qt>यह प्रतीक स्थान फलक में प्रकट होगा.<br /><br />भिन्न प्रतीक चुनने के लिए बटन पर " -"क्लिक करें.</qt>" - -#: src/filewidgets/kfileplaceeditdialog.cpp:123 -msgid "Choose an &icon:" -msgstr "एक प्रतीक चुनें (&i)" - -#: src/filewidgets/kfileplaceeditdialog.cpp:141 -#, kde-format -msgid "&Only show when using this application (%1)" -msgstr "जब इस अनुप्रयोग (%1) का इस्तेमाल करें तभी दिखाएँ (&O)" - -#: src/filewidgets/kfileplaceeditdialog.cpp:143 -#, kde-format -msgid "" -"<qt>Select this setting if you want this entry to show only when using the " -"current application (%1).<br /><br />If this setting is not selected, the " -"entry will be available in all applications.</qt>" -msgstr "" - -#: src/filewidgets/kfileplacesmodel.cpp:118 -#, fuzzy -#| msgid "Home" -msgctxt "KFile System Bookmarks" -msgid "Home" -msgstr "घर" - -#: src/filewidgets/kfileplacesmodel.cpp:121 -#, fuzzy -#| msgid "Network" -msgctxt "KFile System Bookmarks" -msgid "Network" -msgstr "नेटवर्क" - -#: src/filewidgets/kfileplacesmodel.cpp:133 -#, fuzzy -#| msgid "Root" -msgctxt "KFile System Bookmarks" -msgid "Root" -msgstr "रूट" - -#: src/filewidgets/kfileplacesmodel.cpp:137 -#, fuzzy -#| msgid "Trash" -msgctxt "KFile System Bookmarks" -msgid "Trash" -msgstr "रद्दी" - -#: src/filewidgets/kfileplacesmodel.cpp:798 -#, fuzzy, kde-format -#| msgid "&Remove '%1'" -msgid "&Release '%1'" -msgstr "मिटाएँ '%1' (&R)" - -#: src/filewidgets/kfileplacesmodel.cpp:800 -#, fuzzy, kde-format -#| msgid "&Safely remove '%1'" -msgid "&Safely Remove '%1'" -msgstr "'%1' को सुरक्षित निकाल सकते हैं (&S)" - -#: src/filewidgets/kfileplacesmodel.cpp:803 -#, kde-format -msgid "&Unmount '%1'" -msgstr "अनमाउन्ट '%1' (&U)" - -#: src/filewidgets/kfileplacesmodel.cpp:824 -#, kde-format -msgid "&Eject '%1'" -msgstr "'%1' बाहर करें (&E)" - -#: src/filewidgets/kfileplacesmodel.cpp:858 -#, fuzzy, kde-format -#| msgid "The specified resource may not exist." -msgid "The device '%1' is not a disk and cannot be ejected." -msgstr "उल्लेखित रिसोर्स अस्तित्व में नहीं है." - -#: src/filewidgets/kfileplacesmodel.cpp:894 -#, fuzzy, kde-format -#| msgid "An error occurred while accessing '%1', the system said: %2" -msgid "An error occurred while accessing '%1', the system responded: %2" -msgstr "'%1' पर पहुँचने की कोशिश में एक त्रुटि हुई, तंत्र ने कहा: %2" - -#: src/filewidgets/kfileplacesmodel.cpp:898 -#, kde-format -msgid "An error occurred while accessing '%1'" -msgstr "'%1' पर पहुँचने की कोशिश में एक त्रुटि हुई" - -#: src/filewidgets/kfileplacesview.cpp:584 -#, fuzzy -#| msgid "Trash" -msgctxt "@action:inmenu" -msgid "Empty Trash" -msgstr "रद्दी" - -#: src/filewidgets/kfileplacesview.cpp:589 -#: src/filewidgets/kfileplacesview.cpp:610 -#: src/filewidgets/kfileplacesview.cpp:617 src/widgets/kacleditwidget.cpp:96 -msgid "Add Entry..." -msgstr "प्रविष्टि जोड़ें..." - -#: src/filewidgets/kfileplacesview.cpp:591 -#, fuzzy, kde-format -#| msgid "Edit Entry..." -msgid "&Edit Entry '%1'..." -msgstr "प्रविष्टि संपादित करें..." - -#: src/filewidgets/kfileplacesview.cpp:613 -#, fuzzy, kde-format -#| msgid "&Hide '%1'" -msgid "&Hide Entry '%1'" -msgstr "छुपाएँ '%1' (&H)" - -#: src/filewidgets/kfileplacesview.cpp:622 -msgid "&Show All Entries" -msgstr "सभी प्रविष्टियाँ दिखाएँ (&S)" - -#: src/filewidgets/kfileplacesview.cpp:633 -#, fuzzy, kde-format -#| msgid "&Remove '%1'" -msgid "&Remove Entry '%1'" -msgstr "मिटाएँ '%1' (&R)" - -#: src/filewidgets/kfileplacesview.cpp:645 -#, fuzzy -#| msgid "Do you really want to delete this item?" -#| msgid_plural "Do you really want to delete these %1 items?" -msgctxt "@info" -msgid "Do you really want to empty the Trash? All items will be deleted." -msgstr "क्या आप सचमुच इस वस्तु को मिटाना चाहते हैं?" - -#: src/filewidgets/kfileplacesview.cpp:649 src/widgets/jobuidelegate.cpp:235 -#, fuzzy -#| msgid "Trash" -msgctxt "@action:button" -msgid "Empty Trash" -msgstr "रद्दी" - -#: src/filewidgets/kfilewidget.cpp:297 -msgid "" -"<qt>While typing in the text area, you may be presented with possible " -"matches. This feature can be controlled by clicking with the right mouse " -"button and selecting a preferred mode from the <b>Text Completion</b> menu.</" -"qt>" -msgstr "" - -#: src/filewidgets/kfilewidget.cpp:381 -#, kde-format -msgid "Drive: %1" -msgstr "ड्राइव: %1" - -#: src/filewidgets/kfilewidget.cpp:437 -#, kde-format -msgid "" -"<qt>Click this button to enter the parent folder.<br /><br />For instance, " -"if the current location is file:/home/%1 clicking this button will take you " -"to file:/home.</qt>" -msgstr "" -"<qt>पैरेन्ट फ़ोल्डर में जाने के लिए इस बटन को क्लिक करें.<br /><br /> उदाहरण के लिए, यदि " -"मौज़ूदा स्थान है फ़ाइल:/home/%1 तो इस बटन पर क्लिक करने पर यह आपको फ़ाइल:/home में ले " -"जाएगा</qt>" - -#: src/filewidgets/kfilewidget.cpp:441 -msgid "Click this button to move backwards one step in the browsing history." -msgstr "ब्राउज़िंग इतिहास में एक स्तर पीछे जाने के लिए इस बटन को क्लिक करें." - -#: src/filewidgets/kfilewidget.cpp:442 -msgid "Click this button to move forward one step in the browsing history." -msgstr "ब्राउज़िंग इतिहास में एक स्तर आगे जाने के लिए इस बटन को क्लिक करें." - -#: src/filewidgets/kfilewidget.cpp:444 -msgid "Click this button to reload the contents of the current location." -msgstr "मौज़ूदा स्थान के विषयवस्तु को फिर से लोड करने के लिए इस बटन को क्लिक करें." - -#: src/filewidgets/kfilewidget.cpp:446 -msgid "Click this button to create a new folder." -msgstr "नया फ़ोल्डर बनाने के लिए इस बटन को क्लिक करें." - -#: src/filewidgets/kfilewidget.cpp:452 -msgid "Show Places Navigation Panel" -msgstr "प्लेस नेविगेशन फलक दिखाएँ" - -#: src/filewidgets/kfilewidget.cpp:459 -msgid "Show Bookmarks" -msgstr "पसंदीदा दिखाएँ" - -#: src/filewidgets/kfilewidget.cpp:464 -msgid "Options" -msgstr "विकल्प" - -#: src/filewidgets/kfilewidget.cpp:466 -msgid "" -"<qt>This is the preferences menu for the file dialog. Various options can be " -"accessed from this menu including: <ul><li>how files are sorted in the list</" -"li><li>types of view, including icon and list</li><li>showing of hidden " -"files</li><li>the Places navigation panel</li><li>file previews</" -"li><li>separating folders from files</li></ul></qt>" -msgstr "" - -#: src/filewidgets/kfilewidget.cpp:509 -msgid "Zoom out" -msgstr "" - -#: src/filewidgets/kfilewidget.cpp:511 -msgid "Zoom in" -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, nameLabel) -#: src/filewidgets/kfilewidget.cpp:552 -#: src/widgets/kpropertiesdesktopbase.ui:17 -msgid "&Name:" -msgstr "नाम: (&N)" - -#: src/filewidgets/kfilewidget.cpp:575 -msgid "" -"<qt>This is the filter to apply to the file list. File names that do not " -"match the filter will not be shown.<p>You may select from one of the preset " -"filters in the drop down menu, or you may enter a custom filter directly " -"into the text area.</p><p>Wildcards such as * and ? are allowed.</p></qt>" -msgstr "" - -#: src/filewidgets/kfilewidget.cpp:581 -msgid "&Filter:" -msgstr "फ़िल्टर: (&F)" - -#: src/filewidgets/kfilewidget.cpp:813 -#, fuzzy -#| msgid "You can only select local files." -msgid "You can only select one file" -msgstr "आप सिर्फ स्थानीय फ़ाइलें चुन सकते हैं." - -#: src/filewidgets/kfilewidget.cpp:814 -msgid "More than one file provided" -msgstr "" - -#: src/filewidgets/kfilewidget.cpp:983 -#, fuzzy -#| msgid "You can only select local files." -msgid "You can only select local files" -msgstr "आप सिर्फ स्थानीय फ़ाइलें चुन सकते हैं." - -#: src/filewidgets/kfilewidget.cpp:984 -#, fuzzy -#| msgid "Remote Files Not Accepted" -msgid "Remote files not accepted" -msgstr "रिमोट फ़ाइलें स्वीकार्य नहीं हैं" - -#: src/filewidgets/kfilewidget.cpp:1003 -msgid "" -"More than one folder has been selected and this dialog does not accept " -"folders, so it is not possible to decide which one to enter. Please select " -"only one folder to list it." -msgstr "" - -#: src/filewidgets/kfilewidget.cpp:1003 -msgid "More than one folder provided" -msgstr "" - -#: src/filewidgets/kfilewidget.cpp:1011 -msgid "" -"At least one folder and one file has been selected. Selected files will be " -"ignored and the selected folder will be listed" -msgstr "" - -#: src/filewidgets/kfilewidget.cpp:1011 -#, fuzzy -#| msgid "%1 is a file, but a folder was expected." -msgid "Files and folders selected" -msgstr "%1 फ़ाइल है, परन्तु एक फ़ोल्डर प्रत्याशित है." - -#: src/filewidgets/kfilewidget.cpp:1026 -#, fuzzy, kde-format -#| msgid "The requested lock could not be granted. %1" -msgid "The file \"%1\" could not be found" -msgstr "निवेदित तालाबंद दिया नहीं जा सकता. %1" - -#: src/filewidgets/kfilewidget.cpp:1026 -msgid "Cannot open file" -msgstr "" - -#: src/filewidgets/kfilewidget.cpp:1300 -msgid "This is the name to save the file as." -msgstr "यह इस रुप में सहेजे जाने वाले फ़ाइल का नाम है." - -#: src/filewidgets/kfilewidget.cpp:1303 -msgid "" -"This is the list of files to open. More than one file can be specified by " -"listing several files, separated by spaces." -msgstr "" -"फ़ाइलों को खोलने की यह सूची है. एक से अधिक फ़ाइलों को उल्लेखित किया जा सकता है, फ़ाइलों " -"को स्पेस से अलग-अलग कर सूची बद्ध करके." - -#: src/filewidgets/kfilewidget.cpp:1308 -msgid "This is the name of the file to open." -msgstr "यह खोले जाने वाले फ़ाइल का नाम है." - -#: src/filewidgets/kfilewidget.cpp:1322 -#, fuzzy -#| msgid "Places" -msgctxt "@title:window" -msgid "Places" -msgstr "स्थान" - -#: src/filewidgets/kfilewidget.cpp:1512 -#, kde-format -msgid "The file \"%1\" already exists. Do you wish to overwrite it?" -msgstr "" - -#: src/filewidgets/kfilewidget.cpp:1513 -#, fuzzy -#| msgid "O&verwrite All" -msgid "Overwrite File?" -msgstr "सभी मिटाकर लिखें (&v)" - -#: src/filewidgets/kfilewidget.cpp:1647 -msgid "" -"The chosen filenames do not\n" -"appear to be valid." -msgstr "" -"चुने गये फ़ाइल नाम\n" -"प्रतीत होते हैं कि वैध नहीं हैं." - -#: src/filewidgets/kfilewidget.cpp:1649 -msgid "Invalid Filenames" -msgstr "अवैध फ़ाइल नाम" - -#: src/filewidgets/kfilewidget.cpp:1734 -msgid "You can only select local files." -msgstr "आप सिर्फ स्थानीय फ़ाइलें चुन सकते हैं." - -#: src/filewidgets/kfilewidget.cpp:1735 -msgid "Remote Files Not Accepted" -msgstr "रिमोट फ़ाइलें स्वीकार्य नहीं हैं" - -#: src/filewidgets/kfilewidget.cpp:1840 -msgid "*|All Folders" -msgstr "*|सारे फ़ोल्डर" - -#: src/filewidgets/kfilewidget.cpp:2009 src/widgets/kfileitemactions.cpp:536 -msgid "&Open" -msgstr "खोलें (&O)" - -#: src/filewidgets/kfilewidget.cpp:2095 -#, kde-format -msgid "Icon size: %1 pixels (standard size)" -msgstr "" - -#: src/filewidgets/kfilewidget.cpp:2098 -#, kde-format -msgid "Icon size: %1 pixels" -msgstr "" - -#: src/filewidgets/kfilewidget.cpp:2232 -#, kde-format -msgid "Automatically select filename e&xtension (%1)" -msgstr "फ़ाइल नाम एक्सटेंशन स्वतः चुनें (%1) (&x)" - -#: src/filewidgets/kfilewidget.cpp:2233 -#, kde-format -msgid "the extension <b>%1</b>" -msgstr "एक्सटेंशन <b>%1</b>" - -#: src/filewidgets/kfilewidget.cpp:2239 -msgid "Automatically select filename e&xtension" -msgstr "फ़ाइल नाम एक्सटेंशन स्वतः चुनें (&x)" - -#: src/filewidgets/kfilewidget.cpp:2240 -msgid "a suitable extension" -msgstr "एक उपयुक्त एक्सटेंशन " - -#: src/filewidgets/kfilewidget.cpp:2250 -#, kde-format -msgid "" -"This option enables some convenient features for saving files with " -"extensions:<br /><ol><li>Any extension specified in the <b>%1</b> text area " -"will be updated if you change the file type to save in.<br /><br /></" -"li><li>If no extension is specified in the <b>%2</b> text area when you " -"click <b>Save</b>, %3 will be added to the end of the filename (if the " -"filename does not already exist). This extension is based on the file type " -"that you have chosen to save in.<br /><br />If you do not want KDE to supply " -"an extension for the filename, you can either turn this option off or you " -"can suppress it by adding a period (.) to the end of the filename (the " -"period will be automatically removed).</li></ol>If unsure, keep this option " -"enabled as it makes your files more manageable." -msgstr "" - -#: src/filewidgets/kfilewidget.cpp:2560 -msgid "Bookmarks" -msgstr " पसंदीदा " - -#: src/filewidgets/kfilewidget.cpp:2564 -msgid "" -"<qt>This button allows you to bookmark specific locations. Click on this " -"button to open the bookmark menu where you may add, edit or select a " -"bookmark.<br /><br />These bookmarks are specific to the file dialog, but " -"otherwise operate like bookmarks elsewhere in KDE.</qt>" -msgstr "" - -#: src/filewidgets/knewfilemenu.cpp:380 src/filewidgets/knewfilemenu.cpp:923 -#, fuzzy -#| msgid "Store" -msgid "Sorry" -msgstr "भंडारित करें" - -#: src/filewidgets/knewfilemenu.cpp:389 -#, fuzzy, kde-format -#| msgid "" -#| "<qt>Unable to run the command specified. The file or folder <b>%1</b> " -#| "does not exist.</qt>" -msgid "<qt>The template file <b>%1</b> does not exist.</qt>" -msgstr "" -"<qt>उल्लेखित कमांड चलाने में अक्षम. फ़ाइल या फ़ोल्डर<b>%1</b> अस्तित्व में नहीं है.</qt>" - -#: src/filewidgets/knewfilemenu.cpp:408 -#, fuzzy -#| msgctxt "@title job" -#| msgid "Creating directory" -msgctxt "@action:button" -msgid "Create directory" -msgstr "डिरेक्ट्री बनाया जा रहा है" - -#: src/filewidgets/knewfilemenu.cpp:410 -#, fuzzy -#| msgid "Ru&n as a different user" -msgctxt "@action:button" -msgid "Enter a different name" -msgstr "भिन्न उपयोक्ता जैसे चलाएँ (&n)" - -#: src/filewidgets/knewfilemenu.cpp:413 -#, fuzzy -#| msgctxt "@title job" -#| msgid "Creating directory" -msgid "Create hidden directory?" -msgstr "डिरेक्ट्री बनाया जा रहा है" - -#: src/filewidgets/knewfilemenu.cpp:423 -#, kde-format -msgid "" -"The name \"%1\" starts with a dot, so the directory will be hidden by " -"default." -msgstr "" - -#: src/filewidgets/knewfilemenu.cpp:425 -msgid "Do not ask again" -msgstr "" - -#: src/filewidgets/knewfilemenu.cpp:518 src/filewidgets/knewfilemenu.cpp:591 -#, fuzzy -#| msgid "Device name" -msgid "File name:" -msgstr "उपकरण नाम" - -#: src/filewidgets/knewfilemenu.cpp:521 -#, fuzzy -#| msgid "Could Not Create Symbolic Link" -msgid "Create Symlink" -msgstr "सिंबॉलिक लिंक तैयार नहीं कर सकते." - -#: src/filewidgets/knewfilemenu.cpp:595 -#, fuzzy -#| msgid "C&reate" -msgid "Create link to URL" -msgstr "बनाएँ (&r)" - -#: src/filewidgets/knewfilemenu.cpp:640 src/filewidgets/knewfilemenu.cpp:685 -#, kde-format -msgctxt "@item:inmenu Create New" -msgid "%1" -msgstr "" - -#: src/filewidgets/knewfilemenu.cpp:934 -msgid "" -"Basic links can only point to local files or directories.\n" -"Please use \"Link to Location\" for remote URLs." -msgstr "" - -#: src/filewidgets/knewfilemenu.cpp:1011 -#, fuzzy -#| msgid "C&reate" -msgid "Create New" -msgstr "बनाएँ (&r)" - -#: src/filewidgets/knewfilemenu.cpp:1024 -#, fuzzy -#| msgid "Device" -msgid "Link to Device" -msgstr "उपकरण" - -#: src/filewidgets/knewfilemenu.cpp:1071 -#, fuzzy -#| msgid "New Folder" -msgctxt "Default name for a new folder" -msgid "New Folder" -msgstr "नया फ़ोल्डर" - -#: src/filewidgets/knewfilemenu.cpp:1081 -#, fuzzy -#| msgid "New Folder" -msgctxt "@title:window" -msgid "New Folder" -msgstr "नया फ़ोल्डर" - -#: src/filewidgets/knewfilemenu.cpp:1084 -#, kde-format -msgid "" -"Create new folder in:\n" -"%1" -msgstr "" -"नया फ़ोल्डर:\n" -"%1 में बनाएँ" - -#: src/filewidgets/kstatusbarofflineindicator.cpp:52 -msgid "The desktop is offline" -msgstr "डेस्कटॉप ऑफ़लाइन है" - -#: src/filewidgets/kurlnavigator.cpp:421 -msgid "Copy" -msgstr "नक़ल" - -#: src/filewidgets/kurlnavigator.cpp:425 -msgid "Paste" -msgstr "चिपकाएँ" - -#: src/filewidgets/kurlnavigator.cpp:432 -msgid "Edit" -msgstr "संपादन" - -#: src/filewidgets/kurlnavigator.cpp:435 -msgid "Navigate" -msgstr "नेविगेट" - -#: src/filewidgets/kurlnavigator.cpp:450 -msgid "Show Full Path" -msgstr "" - -#: src/filewidgets/kurlnavigator.cpp:685 -msgid "Custom Path" -msgstr "मनपसंद पथ" - -#: src/filewidgets/kurlnavigatorbutton.cpp:687 -#, fuzzy -#| msgid "Store" -msgctxt "@action:inmenu" -msgid "More" -msgstr "भंडारित करें" - -#: src/filewidgets/kurlnavigatorprotocolcombo.cpp:174 -#, fuzzy -#| msgid "Devices" -msgctxt "@item:inmenu" -msgid "Devices" -msgstr "औज़ार" - -#: src/filewidgets/kurlnavigatorprotocolcombo.cpp:178 -#, fuzzy -#| msgid "SSL version:" -msgctxt "@item:inmenu" -msgid "Subversion" -msgstr "एसएसएल संस्करण:" - -#: src/filewidgets/kurlnavigatorprotocolcombo.cpp:182 -#, fuzzy -#| msgid "Others" -msgctxt "@item:inmenu" -msgid "Other" -msgstr "अन्य" - -#: src/filewidgets/kurlnavigatortogglebutton.cpp:42 -#, fuzzy -#| msgid "Edit" -msgid "Edit mode" -msgstr "संपादन" - -#: src/filewidgets/kurlnavigatortogglebutton.cpp:97 -msgid "Click for Location Navigation" -msgstr "स्थान नेविगेशन के लिए क्लिक करें" - -#: src/filewidgets/kurlnavigatortogglebutton.cpp:99 -msgid "Click to Edit Location" -msgstr "स्थान संपादन के लिये क्लिक करें" - -#: src/ioslaves/file/file.cpp:226 -#, kde-format -msgid "Setting ACL for %1" -msgstr " %1 के लिए एसीएल सेट करना" - -#: src/ioslaves/file/file.cpp:682 src/ioslaves/file/file_unix.cpp:261 -#, kde-format -msgid "" -"Could not change permissions for\n" -"%1" -msgstr "" -" %1 के लिए \n" -"अनुमतियाँ बदल नहीं सका." - -#: src/ioslaves/file/file.cpp:888 -msgid "No Media inserted or Media not recognized." -msgstr "कोई मीडिया प्रविष्ट नहीं किया गया है या मीडिया को पहचाना नहीं जा सका." - -#: src/ioslaves/file/file.cpp:897 src/ioslaves/file/file.cpp:1093 -msgid "\"vold\" is not running." -msgstr "\"vold\" चल नहीं रहा है." - -#: src/ioslaves/file/file.cpp:930 -msgid "Could not find program \"mount\"" -msgstr "प्रोग्राम \"mount\" नहीं मिला" - -#: src/ioslaves/file/file.cpp:999 -#, fuzzy -#| msgid "Writing to %1 is not supported." -msgid "mounting is not supported by wince." -msgstr " %1 पर लिखा जाना समर्थित नहीं है." - -#: src/ioslaves/file/file.cpp:1104 -msgid "Could not find program \"umount\"" -msgstr "प्रोग्राम \"umount\" नहीं मिला" - -#: src/ioslaves/file/file.cpp:1119 -#, fuzzy -#| msgid "Writing to %1 is not supported." -msgid "unmounting is not supported by wince." -msgstr " %1 पर लिखा जाना समर्थित नहीं है." - -#: src/ioslaves/file/file_unix.cpp:194 -#, kde-format -msgid "Cannot copy file from %1 to %2. (Errno: %3)" -msgstr "फ़ाइल को %1 से %2 पर नक़ल नहीं कर सका. (त्रुटि क्र.: %3)" - -#: src/ioslaves/file/file_unix.cpp:326 -#, kde-format -msgid "No media in device for %1" -msgstr "%1 के लिए उपकरण में कोई मीडिया नहीं " - -#: src/ioslaves/file/file_unix.cpp:559 -#, kde-format -msgid "Could not get user id for given user name %1" -msgstr "दिए गए उपयोक्ता नाम %1 के लिए उपयोक्ता आईडी प्राप्त नहीं कर सका" - -#: src/ioslaves/file/file_unix.cpp:572 -#, kde-format -msgid "Could not get group id for given group name %1" -msgstr "दिए गए समूह नाम %1 के लिए समूह आईडी प्राप्त नहीं कर सका" - -#: src/ioslaves/ftp/ftp.cpp:347 -#, kde-format -msgid "Opening connection to host %1" -msgstr "होस्ट %1 से कनेक्शन खोला जा रहा है" - -#: src/ioslaves/ftp/ftp.cpp:362 -#, kde-format -msgid "Connected to host %1" -msgstr "होस्ट %1 से जुड़ा है" - -#: src/ioslaves/ftp/ftp.cpp:472 -#, kde-format -msgid "" -"%1.\n" -"\n" -"Reason: %2" -msgstr "" -"%1.\n" -"\n" -"कारण: %2" - -#: src/ioslaves/ftp/ftp.cpp:502 -msgid "Sending login information" -msgstr "लॉगइन जानकारी भेज रहे" - -#: src/ioslaves/ftp/ftp.cpp:560 -#, kde-format -msgid "" -"Message sent:\n" -"Login using username=%1 and password=[hidden]\n" -"\n" -"Server replied:\n" -"%2\n" -"\n" -msgstr "" -"संदेश भेजा:\n" -"उपयोक्ता नाम =%1 तथा पासवर्ड=[hidden] से लॉगिन किया\n" -"\n" -"सर्वर ने जवाब दिया:\n" -"%2\n" -"\n" - -#: src/ioslaves/ftp/ftp.cpp:569 src/ioslaves/http/http.cpp:5313 -msgid "You need to supply a username and a password to access this site." -msgstr "इस साइट पर पहुँचने के लिए आपको उपयोक्ता नाम और पासवर्ड देना होगा." - -#: src/ioslaves/ftp/ftp.cpp:571 src/ioslaves/http/http.cpp:5315 -msgid "Site:" -msgstr "साइटः" - -#: src/ioslaves/ftp/ftp.cpp:572 -#, kde-format -msgid "<b>%1</b>" -msgstr "<b>%1</b>" - -#: src/ioslaves/ftp/ftp.cpp:655 -msgid "Login OK" -msgstr "लॉगइन ठीक" - -#: src/ioslaves/ftp/ftp.cpp:684 -#, kde-format -msgid "Could not login to %1." -msgstr " %1 पर लॉगइन नहीं हो सका." - -#: src/ioslaves/ftp/ftp.cpp:2580 src/ioslaves/http/http.cpp:5199 -#: src/ioslaves/http/http.cpp:5325 -msgid "" -"You need to supply a username and a password for the proxy server listed " -"below before you are allowed to access any sites." -msgstr "" -"इससे पहले कि आपको किसी साइट पर पहुँच की अनुमति दी जाए, नीचे सूची-बद्ध किए प्रॉक्सी " -"सर्वर के लिए आपको उपयोक्ता नाम तथा पासवर्ड देना होगा." - -#: src/ioslaves/ftp/ftp.cpp:2584 src/ioslaves/http/http.cpp:5203 -#: src/ioslaves/http/http.cpp:5328 -msgid "Proxy:" -msgstr "प्रॉक्सीः" - -#: src/ioslaves/ftp/ftp.cpp:2585 src/ioslaves/http/http.cpp:5204 -#: src/ioslaves/http/http.cpp:5409 -#, kde-format -msgid "<b>%1</b> at <b>%2</b>" -msgstr "<b>%1</b> पर <b>%2</b>" - -#: src/ioslaves/ftp/ftp.cpp:2586 src/ioslaves/http/http.cpp:5206 -#: src/ioslaves/http/http.cpp:5345 -msgid "Proxy Authentication Failed." -msgstr "प्रॉक्सी प्रमाणीकरण असफल." - -#: src/ioslaves/help/kio_help.cpp:124 -#, fuzzy, kde-format -#| msgid "There are no special actions available for protocol %1." -msgid "There is no documentation available for %1." -msgstr "प्रोटोकॉल %1 के लिए कोई विशेष क्रिया उपलब्ध नहीं है." - -#: src/ioslaves/help/kio_help.cpp:178 -msgid "Looking up correct file" -msgstr "" - -#: src/ioslaves/help/kio_help.cpp:229 -msgid "Preparing document" -msgstr "" - -#: src/ioslaves/help/kio_help.cpp:238 src/ioslaves/help/kio_help.cpp:283 -#, fuzzy, kde-format -#| msgid "The requested lock could not be granted. %1" -msgid "The requested help file could not be parsed:<br />%1" -msgstr "निवेदित तालाबंद दिया नहीं जा सकता. %1" - -#: src/ioslaves/help/kio_help.cpp:260 -msgid "Saving to cache" -msgstr "" - -#: src/ioslaves/help/kio_help.cpp:277 -msgid "Using cached version" -msgstr "" - -#: src/ioslaves/help/kio_help.cpp:339 -msgid "Looking up section" -msgstr "" - -#: src/ioslaves/help/kio_help.cpp:350 -#, fuzzy, kde-format -#| msgid "Could not read file %1." -msgid "Could not find filename %1 in %2." -msgstr "फ़ाइल %1 को पढ़ नहीं सका." - -#: src/ioslaves/http/http.cpp:592 -msgid "No host specified." -msgstr "कोई होस्ट उल्लेखित नहीं है." - -#: src/ioslaves/http/http.cpp:1555 -msgid "Otherwise, the request would have succeeded." -msgstr "अन्यथा, निवेदन पूरा हो गया होता." - -#: src/ioslaves/http/http.cpp:1559 -msgctxt "request type" -msgid "retrieve property values" -msgstr "गुण मान निकालें" - -#: src/ioslaves/http/http.cpp:1562 -msgctxt "request type" -msgid "set property values" -msgstr "गुण मान नियत करें. " - -#: src/ioslaves/http/http.cpp:1565 -msgctxt "request type" -msgid "create the requested folder" -msgstr "निवेदित फ़ोल्डर बनाएँ" - -#: src/ioslaves/http/http.cpp:1568 -msgctxt "request type" -msgid "copy the specified file or folder" -msgstr "उल्लेखित फ़ाइल या फ़ोल्डर की नक़ल करें" - -#: src/ioslaves/http/http.cpp:1571 -msgctxt "request type" -msgid "move the specified file or folder" -msgstr "उल्लेखित फ़ाइल या फ़ोल्डर खिसकाएँ" - -#: src/ioslaves/http/http.cpp:1574 -msgctxt "request type" -msgid "search in the specified folder" -msgstr "उल्लेखित फ़ोल्डर में ढूंढें" - -#: src/ioslaves/http/http.cpp:1577 -msgctxt "request type" -msgid "lock the specified file or folder" -msgstr "उल्लेखित फ़ाइल या फ़ोल्डर को तालाबंद करें" - -#: src/ioslaves/http/http.cpp:1580 -msgctxt "request type" -msgid "unlock the specified file or folder" -msgstr "उल्लेखित फ़ाइल या फ़ोल्डर का ताला खोलें" - -#: src/ioslaves/http/http.cpp:1583 -msgctxt "request type" -msgid "delete the specified file or folder" -msgstr "उल्लेखित फ़ाइल या फ़ोल्डर को मिटाएँ" - -#: src/ioslaves/http/http.cpp:1586 -msgctxt "request type" -msgid "query the server's capabilities" -msgstr "सर्वर केपेबिलिटी क्वेरी करें" - -#: src/ioslaves/http/http.cpp:1589 -msgctxt "request type" -msgid "retrieve the contents of the specified file or folder" -msgstr "उल्लेखित फ़ाइल या फ़ोल्डर के विषयवस्तुओं को निकालें" - -#: src/ioslaves/http/http.cpp:1592 -#, fuzzy -#| msgctxt "request type" -#| msgid "search in the specified folder" -msgctxt "request type" -msgid "run a report in the specified folder" -msgstr "उल्लेखित फ़ोल्डर में ढूंढें" - -#: src/ioslaves/http/http.cpp:1603 -#, fuzzy, kde-format -#| msgctxt "%1: response code, %2: request type" -#| msgid "An unexpected error (%1) occurred while attempting to %2." -msgctxt "%1: code, %2: request type" -msgid "An unexpected error (%1) occurred while attempting to %2." -msgstr " एक त्रुटि %1 हुई, %2 की कोशिश में" - -#: src/ioslaves/http/http.cpp:1610 -msgid "The server does not support the WebDAV protocol." -msgstr "सर्वर वेब-डीएवी प्रोटोकॉल समर्थित नहीं करते." - -#: src/ioslaves/http/http.cpp:1652 -#, fuzzy, kde-format -#| msgctxt "%1: request type, %2: url" -#| msgid "" -#| "An error occurred while attempting to %1, %2. A summary of the reasons is " -#| "below.<ul>" -msgctxt "%1: request type, %2: url" -msgid "" -"An error occurred while attempting to %1, %2. A summary of the reasons is " -"below." -msgstr " %1 की कोशिश में एक त्रुटि हुई, %2. कारणों का संक्षिप्त निम्न है.<ul>" - -#: src/ioslaves/http/http.cpp:1667 src/ioslaves/http/http.cpp:1800 -#, kde-format -msgctxt "%1: request type" -msgid "Access was denied while attempting to %1." -msgstr "%1 की कोशिश में पहुँच नकार दिया गया." - -#: src/ioslaves/http/http.cpp:1680 src/ioslaves/http/http.cpp:1806 -msgid "" -"A resource cannot be created at the destination until one or more " -"intermediate collections (folders) have been created." -msgstr "" - -#: src/ioslaves/http/http.cpp:1688 -#, kde-format -msgid "" -"The server was unable to maintain the liveness of the properties listed in " -"the propertybehavior XML element or you attempted to overwrite a file while " -"requesting that files are not overwritten. %1" -msgstr "" - -#: src/ioslaves/http/http.cpp:1696 -#, kde-format -msgid "The requested lock could not be granted. %1" -msgstr "निवेदित तालाबंद दिया नहीं जा सकता. %1" - -#: src/ioslaves/http/http.cpp:1702 -msgid "The server does not support the request type of the body." -msgstr "सर्वर निवेदित क़िस्म के बॉडी समर्थित नहीं करते." - -#: src/ioslaves/http/http.cpp:1707 src/ioslaves/http/http.cpp:1814 -#, kde-format -msgctxt "%1: request type" -msgid "Unable to %1 because the resource is locked." -msgstr " %1 पर अक्षम चूंकि रिसोर्स ताला बंद है." - -#: src/ioslaves/http/http.cpp:1711 -msgid "This action was prevented by another error." -msgstr "अन्य त्रुटि के द्वारा यह क्रिया रोकी गई." - -#: src/ioslaves/http/http.cpp:1717 src/ioslaves/http/http.cpp:1820 -#, kde-format -msgctxt "%1: request type" -msgid "" -"Unable to %1 because the destination server refuses to accept the file or " -"folder." -msgstr " %1 को असमर्थ चूंकि गंतव्य सर्वर ने फ़ाइल या फ़ोल्डर को स्वीकार करने से मना किया." - -#: src/ioslaves/http/http.cpp:1724 src/ioslaves/http/http.cpp:1827 -msgid "" -"The destination resource does not have sufficient space to record the state " -"of the resource after the execution of this method." -msgstr "" - -#: src/ioslaves/http/http.cpp:1778 -#, fuzzy -#| msgid "The specified resource may not exist." -msgid "The resource cannot be deleted." -msgstr "उल्लेखित रिसोर्स अस्तित्व में नहीं है." - -#: src/ioslaves/http/http.cpp:1791 -#, kde-format -msgctxt "request type" -msgid "upload %1" -msgstr "अपलोड %1" - -#: src/ioslaves/http/http.cpp:1841 -#, kde-format -msgctxt "%1: response code, %2: request type" -msgid "An unexpected error (%1) occurred while attempting to %2." -msgstr " एक त्रुटि %1 हुई, %2 की कोशिश में" - -#: src/ioslaves/http/http.cpp:2669 -#, kde-format -msgid "%1 contacted. Waiting for reply..." -msgstr "%1 सम्पर्क में. जवाब की प्रतीक्षा में..." - -#: src/ioslaves/http/http.cpp:3008 -#, kde-format -msgctxt "@info Security check on url being accessed" -msgid "" -"<p>You are about to log in to the site \"%1\" with the username \"%2\", but " -"the website does not require authentication. This may be an attempt to trick " -"you.</p><p>Is \"%1\" the site you want to visit?</p>" -msgstr "" - -#: src/ioslaves/http/http.cpp:3014 -msgctxt "@title:window" -msgid "Confirm Website Access" -msgstr "" - -#: src/ioslaves/http/http.cpp:3105 -msgid "Server processing request, please wait..." -msgstr "सर्वर प्रक्रिया के लिए निवेदन, कृपया इंतजार करें..." - -#: src/ioslaves/http/http.cpp:3810 src/ioslaves/http/http.cpp:3864 -#, kde-format -msgid "Sending data to %1" -msgstr " %1 को डाटा भेज रहे" - -#: src/ioslaves/http/http.cpp:4321 -#, kde-format -msgid "Retrieving %1 from %2..." -msgstr " %1 की फिर से प्राप्ति %2 से किया जा रहा है..." - -#: src/ioslaves/http/http.cpp:5344 -msgid "Authentication Failed." -msgstr "प्रमाणीकरण असफल." - -#: src/ioslaves/http/http.cpp:5442 -#, fuzzy -#| msgid "Authorization Dialog" -msgid "Authorization failed." -msgstr "अनुमोदन संवाद " - -#: src/ioslaves/http/http.cpp:5458 -#, fuzzy -#| msgid "Authorization Dialog" -msgid "Unknown Authorization method." -msgstr "अनुमोदन संवाद " - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:66 -msgid "Cookie Alert" -msgstr "कुकी चेतावनी" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:90 -#, fuzzy, kde-format -#| msgid "Do you want to accept or reject?" -msgctxt "%2 hostname, %3 optional cross domain suffix (translated below)" -msgid "" -"<p>You received a cookie from<br/><b>%2%3</b><br/>Do you want to accept or " -"reject this cookie?</p>" -msgid_plural "" -"<p>You received %1 cookies from<br/><b>%2%3</b><br/>Do you want to accept or " -"reject these cookies?</p>" -msgstr[0] "क्या आप स्वीकृत या अस्वीकृत करना चाहते हैं?" -msgstr[1] "क्या आप स्वीकृत या अस्वीकृत करना चाहते हैं?" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:98 -#, fuzzy -#| msgid " <b>[Cross Domain]</b>" -msgctxt "@item:intext cross domain cookie" -msgid " [Cross Domain]" -msgstr " <b>[क्रास डोमेन]</b>" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:108 -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:363 -msgid "See or modify the cookie information" -msgstr "कुकी जानकारी पढ़ें या बदलें " - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:112 -msgid "Accept for this &session" -msgstr "" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:114 -msgid "Accept cookie(s) until the end of the current session" -msgstr "" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:121 -msgid "&Accept" -msgstr "स्वीकारें (&A)" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:122 -msgid "&Reject" -msgstr "अस्वीकृत (&R)" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:156 -msgid "Apply Choice To" -msgstr "चयन लागू करें यहाँ..." - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:159 -msgid "&Only this cookie" -msgstr "सिर्फ यही कुकी (&O)" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:159 -msgid "&Only these cookies" -msgstr "सिर्फ ये कुकीज़ (&O)" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:163 -#, fuzzy -#| msgid "" -#| "Select this option to accept/reject only this cookie. You will be " -#| "prompted if another cookie is received. <em>(see WebBrowsing/Cookies in " -#| "the Control Center)</em>." -msgid "" -"Select this option to only accept or reject this cookie. You will be " -"prompted again if you receive another cookie." -msgstr "" -"इस विकल्प को सिर्फ इस कुकी के स्वीकार / अस्वीकार करने के लिए चुनें. जब आपको अन्य कुकी " -"मिलेगा तो सूचित किया जाएगा. <em>(देखें वेब-ब्राउज़िंग/कुकीज़ नियंत्रण केंद्र में)</em>." - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:166 -msgid "All cookies from this do&main" -msgstr "इस डोमेन से सभी कुकीज़ (&m)" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:169 -#, fuzzy -#| msgid "" -#| "Select this option to accept/reject all cookies from this site. Choosing " -#| "this option will add a new policy for the site this cookie originated " -#| "from. This policy will be permanent until you manually change it from the " -#| "Control Center <em>(see WebBrowsing/Cookies in the Control Center)</em>." -msgid "" -"Select this option to accept or reject all cookies from this site. Choosing " -"this option will add a new policy for the site this cookie originated from. " -"This policy will be permanent until you manually change it from the System " -"Settings." -msgstr "" -"इस विकल्प को सभी कुकीज़ के स्वीकार / अस्वीकार करने के लिए चुनें. इस ऑप्शन को चुनने पर साइट " -"से आने वाली कुकी के लिए नई नीति जोड़ दी जाएगी. यह नीति स्थायी होगी जब तक कि आप " -"नियंत्रण केंद्र में हाथों से बदल नहीं देते. <em>(देखें वेब-ब्राउज़िंग/कुकीज़ नियंत्रण केंद्र में)</em>." - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:174 -msgid "All &cookies" -msgstr "सभी कुकीज़ (&c)" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:177 -#, fuzzy -#| msgid "" -#| "Select this option to accept/reject all cookies from anywhere. Choosing " -#| "this option will change the global cookie policy set in the Control " -#| "Center for all cookies <em>(see WebBrowsing/Cookies in the Control Center)" -#| "</em>." -msgid "" -"Select this option to accept/reject all cookies from anywhere. Choosing this " -"option will change the global cookie policy for all cookies until you " -"manually change it from the System Settings." -msgstr "" -"इस विकल्प को कहीं से भी सभी कुकी के स्वीकार / अस्वीकार करने के लिए चुनें. इस ऑप्शन को चुनने " -"पर ग्लोबल कुकी नीति, नियंत्रण केंद्र में सभी कुकी के लिए नियत कर दी जाएगी. <em>(देखें वेब-" -"ब्राउज़िंग/कुकीज़ नियंत्रण केंद्र में)</em>." - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:245 -msgid "Cookie Details" -msgstr "कुकी विवरण" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:250 -msgid "Name:" -msgstr "नाम:" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:258 -msgid "Value:" -msgstr "मूल्यः" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:265 -msgid "Expires:" -msgstr "ख़त्म होगाः" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:272 -msgid "Path:" -msgstr "पथः" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:279 -msgid "Domain:" -msgstr "डोमेनः" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:286 -msgid "Exposure:" -msgstr "एक्सपोज़रः" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:294 -msgctxt "Next cookie" -msgid "&Next >>" -msgstr "अगला (&N) >>" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:299 -msgid "Show details of the next cookie" -msgstr "अगले कुकी का विवरण दिखाएँ" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:327 -msgid "Not specified" -msgstr "उल्लेखित नहीं" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:337 -msgid "End of Session" -msgstr "सत्र का अंत" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:342 -msgid "Secure servers only" -msgstr "सिर्फ सुरक्षित सर्वर" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:344 -msgid "Secure servers, page scripts" -msgstr "सुरक्षित सर्वर्स, पेज स्क्रिप्ट" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:348 -msgid "Servers" -msgstr "सर्वर्स" - -#: src/ioslaves/http/kcookiejar/kcookiewin.cpp:350 -msgid "Servers, page scripts" -msgstr "सर्वर्स, पेज स्क्रिप्ट" - -#: src/ioslaves/telnet/ktelnetservice.cpp:68 -#, kde-format -msgid "You do not have permission to access the %1 protocol." -msgstr "प्रोटोकॉल %1 पर पहुँच के लिए आपको अनुमति नहीं है." - -#: src/kpac/discovery.cpp:112 -msgid "Could not find a usable proxy configuration script" -msgstr "उपयोग लायक प्रॉक्सी कॉन्फ़िगरेशन स्क्रिप्ट ढूंढ नहीं पाया." - -#: src/kpac/downloader.cpp:92 -#, kde-format -msgid "" -"Could not download the proxy configuration script:\n" -"%1" -msgstr "" -"प्रॉक्सी कॉन्फ़िगरेशन स्क्रिप्ट डाउनलोड नहीं कर पाया:\n" -"%1" - -#: src/kpac/downloader.cpp:95 -msgid "Could not download the proxy configuration script" -msgstr "प्रॉक्सी कॉन्फ़िगरेशन स्क्रिप्ट डाउनलोड नहीं कर पाया" - -#: src/kpac/proxyscout.cpp:237 -#, kde-format -msgid "" -"The proxy configuration script is invalid:\n" -"%1" -msgstr "" -"प्रॉक्सी कॉन्फ़िगरेशन स्क्रिप्ट अवैध है:\n" -"%1" - -#: src/kpac/proxyscout.cpp:346 -#, kde-format -msgid "" -"The proxy configuration script returned an error:\n" -"%1" -msgstr "" -"प्रॉक्सी कॉन्फ़िगरेशन स्क्रिप्ट ने एक त्रुटि लौटाया:\n" -"%1" - -#: src/kpac/script.cpp:752 -msgid "Could not find 'FindProxyForURL' or 'FindProxyForURLEx'" -msgstr "" - -#: src/kpac/script.cpp:763 -#, kde-format -msgid "Got an invalid reply when calling %1" -msgstr "" - -#: src/widgets/accessmanager.cpp:221 -msgid "Blocked request." -msgstr "" - -#: src/widgets/accessmanager.cpp:285 -#, fuzzy -#| msgid "Unknown Error" -msgid "Unknown HTTP verb." -msgstr "अज्ञात त्रुटि" - -#. i18n: ectx: property (text), widget (QLabel, commonNameTag) -#: src/widgets/certificateparty.ui:28 -msgid "Common name:" -msgstr "सामान्य नामः" - -#. i18n: ectx: property (text), widget (QLabel, commonName) -#: src/widgets/certificateparty.ui:38 -msgid "Acme Co." -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, organizationTag) -#: src/widgets/certificateparty.ui:48 -msgid "Organization:" -msgstr "संगठन:" - -#. i18n: ectx: property (text), widget (QLabel, organization) -#: src/widgets/certificateparty.ui:58 -msgid "Acme Sundry Products Company" -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, organizationalUnitTag) -#: src/widgets/certificateparty.ui:68 -msgid "Organizational unit:" -msgstr "संगठनात्मक इकाई:" - -#. i18n: ectx: property (text), widget (QLabel, organizationalUnit) -#: src/widgets/certificateparty.ui:78 -msgid "Fraud Department" -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, countryTag) -#: src/widgets/certificateparty.ui:88 -msgid "Country:" -msgstr "देश:" - -#. i18n: ectx: property (text), widget (QLabel, country) -#: src/widgets/certificateparty.ui:98 -#, fuzzy -#| msgid "Can Read" -msgid "Canada" -msgstr "पढ़ सकते हैं" - -#. i18n: ectx: property (text), widget (QLabel, stateTag) -#: src/widgets/certificateparty.ui:108 -#, fuzzy -#| msgctxt "Federal State" -#| msgid "State:" -msgid "State:" -msgstr "स्थिति:" - -#. i18n: ectx: property (text), widget (QLabel, state) -#: src/widgets/certificateparty.ui:118 -msgid "Quebec" -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, cityTag) -#: src/widgets/certificateparty.ui:128 -#, fuzzy -#| msgid "Country:" -msgid "City:" -msgstr "देश:" - -#. i18n: ectx: property (text), widget (QLabel, city) -#: src/widgets/certificateparty.ui:138 -msgid "Lakeridge Meadows" -msgstr "" - -#: src/widgets/fileundomanager.cpp:124 -#, fuzzy -#| msgctxt "@title job" -#| msgid "Creating directory" -msgid "Creating directory" -msgstr "डिरेक्ट्री बनाया जा रहा है" - -#: src/widgets/fileundomanager.cpp:129 -#, fuzzy -#| msgctxt "@title job" -#| msgid "Moving" -msgid "Moving" -msgstr "खिसकाते हुए " - -#: src/widgets/fileundomanager.cpp:135 -#, fuzzy -#| msgctxt "@title job" -#| msgid "Deleting" -msgid "Deleting" -msgstr "मिटाया जा रहा है" - -#: src/widgets/fileundomanager.cpp:299 -msgid "Und&o" -msgstr "" - -#: src/widgets/fileundomanager.cpp:305 -msgid "Und&o: Copy" -msgstr "" - -#: src/widgets/fileundomanager.cpp:307 -msgid "Und&o: Link" -msgstr "" - -#: src/widgets/fileundomanager.cpp:309 -msgid "Und&o: Move" -msgstr "" - -#: src/widgets/fileundomanager.cpp:311 -#, fuzzy -#| msgid "&Rename" -msgid "Und&o: Rename" -msgstr "नाम बदलें (&R)" - -#: src/widgets/fileundomanager.cpp:313 -#, fuzzy -#| msgctxt "to trash" -#| msgid "&Trash" -msgid "Und&o: Trash" -msgstr "रद्दी (&T)" - -#: src/widgets/fileundomanager.cpp:315 -#, fuzzy -#| msgid "Could Not Create Folder" -msgid "Und&o: Create Folder" -msgstr "फ़ोल्डर बना नहीं सका" - -#: src/widgets/fileundomanager.cpp:317 -#, fuzzy -#| msgid "Could Not Create Folder" -msgid "Und&o: Create File" -msgstr "फ़ोल्डर बना नहीं सका" - -#: src/widgets/fileundomanager.cpp:698 -#, kde-format -msgid "" -"The file %1 was copied from %2, but since then it has apparently been " -"modified at %3.\n" -"Undoing the copy will delete the file, and all modifications will be lost.\n" -"Are you sure you want to delete %4?" -msgstr "" - -#: src/widgets/fileundomanager.cpp:701 -#, fuzzy -#| msgid "Updating System Configuration" -msgid "Undo File Copy Confirmation" -msgstr "तंत्र कॉनफिगुरेशन अद्यतन किया जा रहा है" - -#: src/widgets/jobuidelegate.cpp:233 -msgctxt "@info" -msgid "" -"Do you want to permanently delete all items from Trash? This action cannot " -"be undone." -msgstr "" - -#: src/widgets/jobuidelegate.cpp:244 -#, fuzzy, kde-format -#| msgid "Do you really want to delete this item?" -#| msgid_plural "Do you really want to delete these %1 items?" -msgid "Do you really want to move this item to the trash?" -msgid_plural "Do you really want to move these %1 items to the trash?" -msgstr[0] "क्या आप सचमुच इस वस्तु को मिटाना चाहते हैं?" -msgstr[1] "क्या आप सचमुच इन %1 वस्तुऔं को मिटाना चाहते हैं?" - -#: src/widgets/jobuidelegate.cpp:247 -#, fuzzy -#| msgctxt "to trash" -#| msgid "&Trash" -msgctxt "Verb" -msgid "&Trash" -msgstr "रद्दी (&T)" - -#: src/widgets/jobuidelegate.cpp:340 -#, fuzzy -#| msgid "The peer SSL certificate appears to be corrupt." -msgid "The peer SSL certificate chain appears to be corrupt." -msgstr "पीअर एसएसएल प्रमाणपत्र प्रतीत होता है कि खराब है." - -#: src/widgets/kacleditwidget.cpp:59 src/widgets/kacleditwidget.cpp:448 -msgid "Owner" -msgstr "मालिक" - -#: src/widgets/kacleditwidget.cpp:60 src/widgets/kacleditwidget.cpp:453 -msgid "Owning Group" -msgstr "मालिक समूह" - -#: src/widgets/kacleditwidget.cpp:61 src/widgets/kacleditwidget.cpp:458 -#: src/widgets/kpropertiesdialog.cpp:2024 -msgid "Others" -msgstr "अन्य" - -#: src/widgets/kacleditwidget.cpp:62 src/widgets/kacleditwidget.cpp:463 -msgid "Mask" -msgstr "मास्क" - -#: src/widgets/kacleditwidget.cpp:63 -msgid "Named User" -msgstr "नामित उपयोक्ता" - -#: src/widgets/kacleditwidget.cpp:64 -msgid "Named Group" -msgstr "नामित समूह" - -#: src/widgets/kacleditwidget.cpp:100 -msgid "Edit Entry..." -msgstr "प्रविष्टि संपादित करें..." - -#: src/widgets/kacleditwidget.cpp:104 -msgid "Delete Entry" -msgstr "प्रविष्टि मिटाएँ" - -#: src/widgets/kacleditwidget.cpp:308 -msgid " (Default)" -msgstr "(डिफ़ॉल्ट)" - -#: src/widgets/kacleditwidget.cpp:429 -msgid "Edit ACL Entry" -msgstr "एसीएल प्रविष्टि संपादित करें" - -#: src/widgets/kacleditwidget.cpp:433 -msgid "Entry Type" -msgstr "प्रविष्टि क़िस्म" - -#: src/widgets/kacleditwidget.cpp:439 -msgid "Default for new files in this folder" -msgstr "इस फ़ोल्डर के लिए नई फ़ाइलों के लिए डिफ़ॉल्ट" - -#: src/widgets/kacleditwidget.cpp:468 -#, fuzzy -#| msgid "Named User" -msgid "Named user" -msgstr "नामित उपयोक्ता" - -#: src/widgets/kacleditwidget.cpp:473 -#, fuzzy -#| msgid "Named Group" -msgid "Named group" -msgstr "नामित समूह" - -#: src/widgets/kacleditwidget.cpp:493 -msgid "User: " -msgstr "उपयोक्ता:" - -#: src/widgets/kacleditwidget.cpp:508 -msgid "Group: " -msgstr "समूह:" - -#: src/widgets/kacleditwidget.cpp:645 -msgid "Type" -msgstr "क़िस्म" - -#: src/widgets/kacleditwidget.cpp:646 -msgid "Name" -msgstr "नाम" - -#: src/widgets/kacleditwidget.cpp:647 -msgctxt "read permission" -msgid "r" -msgstr "प" - -#: src/widgets/kacleditwidget.cpp:648 -msgctxt "write permission" -msgid "w" -msgstr "लि" - -#: src/widgets/kacleditwidget.cpp:649 -msgctxt "execute permission" -msgid "x" -msgstr "च" - -#: src/widgets/kacleditwidget.cpp:650 -msgid "Effective" -msgstr "प्रभावी" - -#: src/widgets/kbuildsycocaprogressdialog.cpp:45 -msgid "Updating System Configuration" -msgstr "तंत्र कॉनफिगुरेशन अद्यतन किया जा रहा है" - -#: src/widgets/kbuildsycocaprogressdialog.cpp:46 -msgid "Updating system configuration." -msgstr "तंत्र कॉनफिगुरेशन अद्यतन किया जा रहा है." - -#: src/widgets/kdesktopfileactions.cpp:67 -#, kde-format -msgid "The desktop entry file %1 has no Type=... entry." -msgstr "डेस्कटॉप प्रविष्टि फ़ाइल %1 में कोई क़िस्म=... प्रविष्टि दर्ज नहीं है." - -#: src/widgets/kdesktopfileactions.cpp:84 -#, kde-format -msgid "" -"The desktop entry of type\n" -"%1\n" -"is unknown." -msgstr "" -"डेस्कटॉप प्रविष्टि क़िस्म \n" -"%1\n" -" अज्ञात है." - -#: src/widgets/kdesktopfileactions.cpp:97 -#: src/widgets/kdesktopfileactions.cpp:177 -#: src/widgets/kdesktopfileactions.cpp:310 -#, kde-format -msgid "" -"The desktop entry file\n" -"%1\n" -"is of type FSDevice but has no Dev=... entry." -msgstr "" -"डेस्कटॉप प्रविष्टि फ़ाइल \n" -"%1\n" -" एफएस-डिवाइस क़िस्म का है पर कोई Dev=... प्रविष्टि नहीं है." - -#: src/widgets/kdesktopfileactions.cpp:143 -#, kde-format -msgid "" -"The desktop entry file\n" -"%1\n" -"is of type Link but has no URL=... entry." -msgstr "" -"डेस्कटॉप प्रविष्टि फ़ाइल \n" -"%1\n" -"लिंक क़िस्म का है पर कोई URL=... प्रविष्टि नहीं है." - -#: src/widgets/kdesktopfileactions.cpp:213 -msgid "Mount" -msgstr "माउन्ट" - -#: src/widgets/kdesktopfileactions.cpp:224 -msgid "Eject" -msgstr "बाहर करें" - -#: src/widgets/kdesktopfileactions.cpp:226 -msgid "Unmount" -msgstr "अनमाउन्ट" - -#: src/widgets/kdirmodel.cpp:1056 -msgctxt "@title:column" -msgid "Name" -msgstr "नाम" - -#: src/widgets/kdirmodel.cpp:1058 -msgctxt "@title:column" -msgid "Size" -msgstr "आकार" - -#: src/widgets/kdirmodel.cpp:1060 -msgctxt "@title:column" -msgid "Date" -msgstr "तारीख़ से" - -#: src/widgets/kdirmodel.cpp:1062 -msgctxt "@title:column" -msgid "Permissions" -msgstr "अनुमतियाँ" - -#: src/widgets/kdirmodel.cpp:1064 -msgctxt "@title:column" -msgid "Owner" -msgstr "मालिक" - -#: src/widgets/kdirmodel.cpp:1066 -msgctxt "@title:column" -msgid "Group" -msgstr "समूह" - -#: src/widgets/kdirmodel.cpp:1068 -msgctxt "@title:column" -msgid "Type" -msgstr "क़िस्म" - -#: src/widgets/kfileitemactions.cpp:399 -#, fuzzy -#| msgid "Actions" -msgctxt "@title:menu" -msgid "&Actions" -msgstr "क्रियाएं" - -#: src/widgets/kfileitemactions.cpp:525 -#, fuzzy, kde-format -#| msgid "Open with:" -msgid "&Open with %1" -msgstr "के साथ खोलें:" - -#: src/widgets/kfileitemactions.cpp:551 -#, fuzzy -#| msgid "Open With" -msgctxt "@title:menu" -msgid "&Open With" -msgstr "के साथ खोलें" - -#: src/widgets/kfileitemactions.cpp:568 -#, fuzzy -#| msgid "Others" -msgctxt "@action:inmenu Open With" -msgid "&Other..." -msgstr "अन्य" - -#: src/widgets/kfileitemactions.cpp:570 src/widgets/kfileitemactions.cpp:579 -#, fuzzy -#| msgid "Open With" -msgctxt "@title:menu" -msgid "&Open With..." -msgstr "के साथ खोलें" - -#: src/widgets/kfileitemactions.cpp:683 -#, fuzzy, kde-format -#| msgid "Open with:" -msgid "Open &with %1" -msgstr "के साथ खोलें:" - -#: src/widgets/kfileitemactions.cpp:685 -#, kde-format -msgctxt "@item:inmenu Open With, %1 is application name" -msgid "%1" -msgstr "" - -#: src/widgets/kfileitemdelegate.cpp:221 -#, kde-format -msgctxt "Items in a folder" -msgid "1 item" -msgid_plural "%1 items" -msgstr[0] "१ वस्तु" -msgstr[1] "%1 वस्तुएँ" - -#: src/widgets/kfileitemdelegate.cpp:277 src/widgets/kfileitemdelegate.cpp:281 -msgctxt "@info mimetype" -msgid "Unknown" -msgstr "अज्ञात" - -#: src/widgets/kopenwithdialog.cpp:271 -msgid "Known Applications" -msgstr "ज्ञात अनुप्रयोग" - -#: src/widgets/kopenwithdialog.cpp:493 -msgid "Open With" -msgstr "के साथ खोलें" - -#: src/widgets/kopenwithdialog.cpp:497 -#, kde-format -msgid "" -"<qt>Select the program that should be used to open <b>%1</b>. If the program " -"is not listed, enter the name or click the browse button.</qt>" -msgstr "" -"<qt>प्रोग्राम चुनें जो <b>%1</b> को खोलने में उपयोग में लिया जाएगा. यदि प्रोग्राम सूचीबद्ध " -"नहीं है, नाम भरें या ब्राउज़ बटन क्लिक करें.</qt>" - -#: src/widgets/kopenwithdialog.cpp:503 -msgid "Choose the name of the program with which to open the selected files." -msgstr "प्रोग्राम का नाम चुनें जिससे चुनी गई फ़ाइल को खोलना है." - -#: src/widgets/kopenwithdialog.cpp:533 -#, kde-format -msgid "Choose Application for %1" -msgstr " %1 के लिए अनुप्रयोग चुनें" - -#: src/widgets/kopenwithdialog.cpp:534 -#, kde-format -msgid "" -"<qt>Select the program for the file type: <b>%1</b>. If the program is not " -"listed, enter the name or click the browse button.</qt>" -msgstr "" -"<qt>फ़ाइल क़िस्म : <b>%1</b> के लिए प्रोग्राम चुनें. यदि प्रोग्राम सूचीबद्ध नहीं है, तो नाम " -"भरें या ब्राउज़ बटन क्लिक करें.</qt>" - -#: src/widgets/kopenwithdialog.cpp:549 -msgid "Choose Application" -msgstr "अनुप्रयोग चुनें" - -#: src/widgets/kopenwithdialog.cpp:550 -msgid "" -"<qt>Select a program. If the program is not listed, enter the name or click " -"the browse button.</qt>" -msgstr "" -"<qt>प्रोग्राम चुनें. यदि प्रोग्राम सूचीबद्ध नहीं है, तो नाम भरें या ब्राउज़ बटन क्लिक करें.</" -"qt> " - -#: src/widgets/kopenwithdialog.cpp:609 -msgid "" -"Following the command, you can have several place holders which will be " -"replaced with the actual values when the actual program is run:\n" -"%f - a single file name\n" -"%F - a list of files; use for applications that can open several local files " -"at once\n" -"%u - a single URL\n" -"%U - a list of URLs\n" -"%d - the directory of the file to open\n" -"%D - a list of directories\n" -"%i - the icon\n" -"%m - the mini-icon\n" -"%c - the comment" -msgstr "" - -#: src/widgets/kopenwithdialog.cpp:644 -msgid "Run in &terminal" -msgstr "टर्मिनल में चलाएँ (&t)" - -#: src/widgets/kopenwithdialog.cpp:662 -msgid "&Do not close when command exits" -msgstr "जब कमांड उपलब्ध हो तो बंद नहीं करें (&D)" - -#: src/widgets/kopenwithdialog.cpp:679 -msgid "&Remember application association for this type of file" -msgstr "इस क़िस्म की फ़ाइल के फ़ाइल असोसिएशन को स्मरण में रखें (&R)" - -#: src/widgets/kopenwithdialog.cpp:827 -#, kde-format -msgid "" -"Could not extract executable name from '%1', please type a valid program " -"name." -msgstr "" - -#: src/widgets/kopenwithdialog.cpp:877 -#, kde-format -msgid "'%1' not found, please type a valid program name." -msgstr "" - -#. i18n: ectx: property (title), widget (QGroupBox, buttonGroup2) -#: src/widgets/kpropertiesdesktopadvbase.ui:11 -#, fuzzy -#| msgid "Terminal" -msgctxt "" -"@title:group Title of a group that lets the user choose options about the " -"terminal when launching a program" -msgid "Terminal" -msgstr "टर्मिनल" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, terminalCheck) -#: src/widgets/kpropertiesdesktopadvbase.ui:33 -msgid "" -"Check this option if the application you want to run is a text mode " -"application or if you want the information that is provided by the terminal " -"emulator window." -msgstr "" - -#. i18n: ectx: property (text), widget (QCheckBox, terminalCheck) -#: src/widgets/kpropertiesdesktopadvbase.ui:36 -msgid "&Run in terminal" -msgstr "टर्मिनल में चलाएँ (&R)" - -#. i18n: ectx: property (text), widget (QLabel, terminalEditLabel) -#: src/widgets/kpropertiesdesktopadvbase.ui:43 -msgid "&Terminal options:" -msgstr "टर्मिनल विकल्पः (&T)" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, terminalCloseCheck) -#: src/widgets/kpropertiesdesktopadvbase.ui:53 -msgid "" -"Check this option if the text mode application offers relevant information " -"on exit. Keeping the terminal emulator open allows you to retrieve this " -"information." -msgstr "" - -#. i18n: ectx: property (text), widget (QCheckBox, terminalCloseCheck) -#: src/widgets/kpropertiesdesktopadvbase.ui:56 -msgid "Do not &close when command exits" -msgstr "जब कमांड उपलब्ध हो तो बंद नहीं करें (&c)" - -#. i18n: ectx: property (title), widget (QGroupBox, buttonGroup2_2) -#: src/widgets/kpropertiesdesktopadvbase.ui:69 -#, fuzzy -#| msgid "User" -msgctxt "" -"@title:group Title of a group that lets the user choose which user to use " -"when launching a program" -msgid "User" -msgstr "उपयोक्ता" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, suidCheck) -#: src/widgets/kpropertiesdesktopadvbase.ui:75 -msgid "" -"Check this option if you want to run this application with a different user " -"id. Every process has a different user id associated with it. This id code " -"determines file access and other permissions. The password of the user is " -"required to use this option." -msgstr "" - -#. i18n: ectx: property (text), widget (QCheckBox, suidCheck) -#: src/widgets/kpropertiesdesktopadvbase.ui:78 -msgid "Ru&n as a different user" -msgstr "भिन्न उपयोक्ता जैसे चलाएँ (&n)" - -#. i18n: ectx: property (whatsThis), widget (QLabel, suidEditLabel) -#: src/widgets/kpropertiesdesktopadvbase.ui:101 -msgid "Enter the user name you want to run the application as." -msgstr "इस अनुप्रयोग को जिस नाम से चलाना चाहते हैं, उस उपयोक्ता का नाम भरें. " - -#. i18n: ectx: property (text), widget (QLabel, suidEditLabel) -#: src/widgets/kpropertiesdesktopadvbase.ui:104 -msgid "&Username:" -msgstr "उपयोक्ता नाम: (&U)" - -#. i18n: ectx: property (whatsThis), widget (KLineEdit, suidEdit) -#: src/widgets/kpropertiesdesktopadvbase.ui:114 -msgid "Enter the user name you want to run the application as here." -msgstr "इस अनुप्रयोग को जिस नाम से चलाना चाहते हैं, उस उपयोक्ता का नाम यहाँ भरें. " - -#. i18n: ectx: property (title), widget (QGroupBox, buttonGroup4) -#: src/widgets/kpropertiesdesktopadvbase.ui:124 -#, fuzzy -#| msgid "Startup" -msgctxt "" -"@title:group Title of a group that lets the user choose options regargin " -"program startup" -msgid "Startup" -msgstr "प्रारंभ में" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, startupInfoCheck) -#: src/widgets/kpropertiesdesktopadvbase.ui:130 -msgid "" -"Check this option if you want to make clear that your application has " -"started. This visual feedback may appear as a busy cursor or in the taskbar." -msgstr "" - -#. i18n: ectx: property (text), widget (QCheckBox, startupInfoCheck) -#: src/widgets/kpropertiesdesktopadvbase.ui:133 -msgid "Enable &launch feedback" -msgstr "लांच फ़ीडबैक सक्षम करें (&l)" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, systrayCheck) -#: src/widgets/kpropertiesdesktopadvbase.ui:140 -msgid "" -"Check this option if you want to have a system tray handle for your " -"application." -msgstr "इस विकल्प को चेक करें यदि आप चाहते हैं कि आपके अनुप्रयोग को तंत्र तश्तरी हैण्डल करे." - -#. i18n: ectx: property (text), widget (QCheckBox, systrayCheck) -#: src/widgets/kpropertiesdesktopadvbase.ui:143 -msgid "&Place in system tray" -msgstr "तंत्र तश्तरी में रखें (&P)" - -#. i18n: ectx: property (text), widget (QLabel, textLabel12) -#: src/widgets/kpropertiesdesktopadvbase.ui:150 -#, fuzzy -#| msgid "&DBUS registration:" -msgid "&D-Bus registration:" -msgstr "डीबस पंजीकरण (&D):" - -#. i18n: ectx: property (text), item, widget (KComboBox, dbusCombo) -#: src/widgets/kpropertiesdesktopadvbase.ui:161 -msgid "None" -msgstr "कुछ नहीं" - -#. i18n: ectx: property (text), item, widget (KComboBox, dbusCombo) -#: src/widgets/kpropertiesdesktopadvbase.ui:166 -msgid "Multiple Instances" -msgstr "मल्टीपल इंस्टेंसेज़" - -#. i18n: ectx: property (text), item, widget (KComboBox, dbusCombo) -#: src/widgets/kpropertiesdesktopadvbase.ui:171 -msgid "Single Instance" -msgstr "एकल इंस्टेंस" - -#. i18n: ectx: property (text), item, widget (KComboBox, dbusCombo) -#: src/widgets/kpropertiesdesktopadvbase.ui:176 -msgid "Run Until Finished" -msgstr "पूरा होते तक चलाएँ" - -#. i18n: ectx: property (whatsThis), widget (QLabel, nameLabel) -#. i18n: ectx: property (whatsThis), widget (KLineEdit, nameEdit) -#: src/widgets/kpropertiesdesktopbase.ui:14 -#: src/widgets/kpropertiesdesktopbase.ui:27 -msgid "" -"Type the name you want to give to this application here. This application " -"will appear under this name in the applications menu and in the panel." -msgstr "" -"इस अनुप्रयोग को जो नाम देना चाहते हैं, यहाँ टाइप करें. यह अनुप्रयोग इसी नाम से फलक में " -"अनुप्रयोग मेन्यू में प्रकट होगा." - -#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel2) -#. i18n: ectx: property (whatsThis), widget (KLineEdit, genNameEdit) -#: src/widgets/kpropertiesdesktopbase.ui:34 -#: src/widgets/kpropertiesdesktopbase.ui:47 -msgid "" -"Type the description of this application, based on its use, here. Examples: " -"a dial up application (KPPP) would be \"Dial up tool\"." -msgstr "" -"प्रयोग के आधार पर अनुप्रयोग का वर्णन भरें. उदाहरण: डायलअप अनुप्रयोग (केपीपीपी)ेहोगा " -"\"डायल अप औजारl\"." - -#. i18n: ectx: property (text), widget (QLabel, textLabel2) -#: src/widgets/kpropertiesdesktopbase.ui:37 -msgid "&Description:" -msgstr "वर्णनः (&D)" - -#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel3) -#. i18n: ectx: property (whatsThis), widget (KLineEdit, commentEdit) -#: src/widgets/kpropertiesdesktopbase.ui:54 -#: src/widgets/kpropertiesdesktopbase.ui:67 -msgid "Type any comment you think is useful here." -msgstr "कोई टिप्पणी जो आप समझते हैं, उपयोगी है, यहाँ टाइप करें." - -#. i18n: ectx: property (text), widget (QLabel, textLabel3) -#: src/widgets/kpropertiesdesktopbase.ui:57 -msgid "Comm&ent:" -msgstr "टिप्पणीः (&e)" - -#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel4) -#. i18n: ectx: property (whatsThis), widget (KLineEdit, commandEdit) -#: src/widgets/kpropertiesdesktopbase.ui:85 -#: src/widgets/kpropertiesdesktopbase.ui:111 -#, no-c-format -msgid "" -"Type the command to start this application here.\n" -"\n" -"Following the command, you can have several place holders which will be " -"replaced with the actual values when the actual program is run:\n" -"%f - a single file name\n" -"%F - a list of files; use for applications that can open several local files " -"at once\n" -"%u - a single URL\n" -"%U - a list of URLs\n" -"%d - the directory of the file to open\n" -"%D - a list of directories\n" -"%i - the icon\n" -"%m - the mini-icon\n" -"%c - the caption" -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, textLabel4) -#: src/widgets/kpropertiesdesktopbase.ui:88 -msgid "Co&mmand:" -msgstr "कमांडः (&m)" - -#. i18n: ectx: property (whatsThis), widget (QPushButton, browseButton) -#: src/widgets/kpropertiesdesktopbase.ui:118 -msgid "" -"Click here to browse your file system in order to find the desired " -"executable." -msgstr "" -"वांछित एक्जीक्यूटेबल को ढूंढने के लिए फ़ाइल सिस्टम को ब्राउज़ करने के लिए यहाँ क्लिक करें." - -#. i18n: ectx: property (text), widget (QPushButton, browseButton) -#: src/widgets/kpropertiesdesktopbase.ui:121 -msgid "&Browse..." -msgstr "ब्राउज... (&B)" - -#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel5) -#. i18n: ectx: property (whatsThis), widget (KUrlRequester, pathEdit) -#: src/widgets/kpropertiesdesktopbase.ui:130 -#: src/widgets/kpropertiesdesktopbase.ui:143 -msgid "Sets the working directory for your application." -msgstr "आपके अनुप्रयोग के लिए कार्यशील डिरेक्ट्री सेट करता है." - -#. i18n: ectx: property (text), widget (QLabel, textLabel5) -#: src/widgets/kpropertiesdesktopbase.ui:133 -msgid "&Work path:" -msgstr "कार्य पथः (&W)" - -#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel7) -#. i18n: ectx: property (whatsThis), widget (QTreeWidget, filetypeList) -#: src/widgets/kpropertiesdesktopbase.ui:157 -#: src/widgets/kpropertiesdesktopbase.ui:178 -msgid "" -"<qt><p>This list should show the types of file that your application can " -"handle. This list is organized by <u>mimetypes</u>.</p>\n" -"<p>MIME, Multipurpose Internet (e)Mail Extension, is a standard protocol for " -"identifying the type of data based on filename extensions and correspondent " -"<u>mimetypes</u>. Example: the \"bmp\" part that comes after the dot in " -"flower.bmp indicates that it is a specific kind of image, <u>image/x-bmp</" -"u>. To know which application should open each type of file, the system " -"should be informed about the abilities of each application to handle these " -"extensions and mimetypes.</p>\n" -"<p>If you want to associate this application with one or more mimetypes that " -"are not in this list, click on the button <b>Add</b> below. If there are one " -"or more filetypes that this application cannot handle, you may want to " -"remove them from the list clicking on the button <b>Remove</b> below.</p></" -"qt>" -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, textLabel7) -#: src/widgets/kpropertiesdesktopbase.ui:160 -msgid "&Supported file types:" -msgstr "समर्थित फ़ाइल क़िस्मः (&S)" - -#. i18n: ectx: property (text), widget (QTreeWidget, filetypeList) -#: src/widgets/kpropertiesdesktopbase.ui:191 -msgid "Mimetype" -msgstr "माइम क़िस्म" - -#. i18n: ectx: property (text), widget (QTreeWidget, filetypeList) -#: src/widgets/kpropertiesdesktopbase.ui:196 -msgid "Description" -msgstr "वर्णन" - -#. i18n: ectx: property (whatsThis), widget (QPushButton, addFiletypeButton) -#: src/widgets/kpropertiesdesktopbase.ui:206 -msgid "" -"Click on this button if you want to add a type of file (mimetype) that your " -"application can handle." -msgstr "" -"इस बटन पर क्लिक करें यदि आप फ़ाइल क़िस्म (माइम क़िस्म) जोड़ना चाहते हैं जो आपका अनुप्रयोग " -"चला सकता है." - -#. i18n: ectx: property (text), widget (QPushButton, addFiletypeButton) -#: src/widgets/kpropertiesdesktopbase.ui:209 -msgid "Add..." -msgstr "जोड़ें..." - -#. i18n: ectx: property (whatsThis), widget (QPushButton, delFiletypeButton) -#: src/widgets/kpropertiesdesktopbase.ui:216 -msgid "" -"If you want to remove a type of file (mimetype) that your application cannot " -"handle, select the mimetype in the list above and click on this button." -msgstr "" - -#. i18n: ectx: property (text), widget (QPushButton, delFiletypeButton) -#: src/widgets/kpropertiesdesktopbase.ui:219 -msgid "Remove" -msgstr "हटाएँ" - -#. i18n: ectx: property (whatsThis), widget (QPushButton, advancedButton) -#: src/widgets/kpropertiesdesktopbase.ui:242 -#, fuzzy -#| msgid "" -#| "Click here to modify the way this application will run, launch feedback, " -#| "DBUS options or to run it as a different user." -msgid "" -"Click here to modify the way this application will run, launch feedback, D-" -"Bus options or to run it as a different user." -msgstr "" -"अनुप्रयोग जिस तरह चलता है उसे परिवर्धित करने के लिए, फीड बैक चालू करने के लिए, डीबस " -"विकल्पों के लिए या इसे एक भिन्न उपयोक्ता के रूप में चलाने के लिए यहाँ क्लिक करें." - -#. i18n: ectx: property (text), widget (QPushButton, advancedButton) -#: src/widgets/kpropertiesdesktopbase.ui:245 -msgid "Ad&vanced Options" -msgstr "विस्तृत विकल्प...(&v)" - -#: src/widgets/kpropertiesdialog.cpp:203 src/widgets/kpropertiesdialog.cpp:218 -#: src/widgets/kpropertiesdialog.cpp:230 src/widgets/kpropertiesdialog.cpp:246 -#: src/widgets/kpropertiesdialog.cpp:264 -#, kde-format -msgid "Properties for %1" -msgstr " %1 के लिए गुण" - -#: src/widgets/kpropertiesdialog.cpp:228 -#, kde-format -msgid "Properties for 1 item" -msgid_plural "Properties for %1 Selected Items" -msgstr[0] "१ वस्तु के लिए गुण" -msgstr[1] "चयनित %1 वस्तुओं के लिए गुण" - -#: src/widgets/kpropertiesdialog.cpp:784 -#, fuzzy -#| msgid "&General" -msgctxt "@title:tab File properties" -msgid "&General" -msgstr "सामान्य (&G)" - -#: src/widgets/kpropertiesdialog.cpp:966 -msgid "Type:" -msgstr "क़िस्मः" - -#: src/widgets/kpropertiesdialog.cpp:985 -#, fuzzy -#| msgid "Create new file type" -msgid "Create New File Type" -msgstr "नई फ़ाइल क़िस्में बनाएँ" - -#: src/widgets/kpropertiesdialog.cpp:987 -msgid "File Type Options" -msgstr "" - -#: src/widgets/kpropertiesdialog.cpp:998 -msgid "Contents:" -msgstr "विषयसूचीः" - -#: src/widgets/kpropertiesdialog.cpp:1006 -#: src/widgets/kurlrequesterdialog.cpp:57 -msgid "Location:" -msgstr "स्थानः" - -#: src/widgets/kpropertiesdialog.cpp:1021 -msgid "Size:" -msgstr "आकारः" - -#: src/widgets/kpropertiesdialog.cpp:1037 -msgid "Calculate" -msgstr "गणना" - -#: src/widgets/kpropertiesdialog.cpp:1038 -msgid "Stop" -msgstr "रूकें" - -#: src/widgets/kpropertiesdialog.cpp:1047 -#: src/widgets/kpropertiesdialog.cpp:1248 -msgid "Refresh" -msgstr "ताज़ा करें" - -#: src/widgets/kpropertiesdialog.cpp:1055 -msgid "Points to:" -msgstr "की ओर इशाराः" - -#: src/widgets/kpropertiesdialog.cpp:1066 -msgid "Created:" -msgstr "सृजितः" - -#: src/widgets/kpropertiesdialog.cpp:1075 -msgid "Modified:" -msgstr "परिवर्धितः" - -#: src/widgets/kpropertiesdialog.cpp:1084 -msgid "Accessed:" -msgstr "पहुंचाः" - -#: src/widgets/kpropertiesdialog.cpp:1102 -msgid "Mounted on:" -msgstr "पर माउन्टेड:" - -#: src/widgets/kpropertiesdialog.cpp:1110 -#: src/widgets/kpropertiesdialog.cpp:2861 -#, fuzzy -#| msgid "Device name" -msgid "Device usage:" -msgstr "उपकरण नाम" - -#: src/widgets/kpropertiesdialog.cpp:1211 -#: src/widgets/kpropertiesdialog.cpp:2993 -#, fuzzy, kde-format -#| msgctxt "Available space out of total partition size (percent used)" -#| msgid "%1 out of %2 (%3% used)" -msgctxt "Available space out of total partition size (percent used)" -msgid "%1 free of %2 (%3% used)" -msgstr "%2 में से %1 (%3% प्रयोग में)" - -#: src/widgets/kpropertiesdialog.cpp:1225 -#, kde-format -msgid "" -"Calculating... %1 (%2)\n" -"%3, %4" -msgstr "" -"गणना में... %1 (%2)\n" -"%3, %4" - -#: src/widgets/kpropertiesdialog.cpp:1228 -#: src/widgets/kpropertiesdialog.cpp:1243 -#, kde-format -msgid "1 file" -msgid_plural "%1 files" -msgstr[0] "१ फ़ाइल" -msgstr[1] "%1 फ़ाइलें" - -#: src/widgets/kpropertiesdialog.cpp:1229 -#: src/widgets/kpropertiesdialog.cpp:1244 -#, kde-format -msgid "1 sub-folder" -msgid_plural "%1 sub-folders" -msgstr[0] "१ उप फ़ोल्डर" -msgstr[1] "%1 उप-फ़ोल्डर" - -#: src/widgets/kpropertiesdialog.cpp:1257 -msgid "Calculating..." -msgstr "गणना में... " - -#: src/widgets/kpropertiesdialog.cpp:1289 -#, kde-format -msgid "At least %1" -msgstr "कम से कम %1" - -#: src/widgets/kpropertiesdialog.cpp:1327 -msgid "The new file name is empty." -msgstr "नया फ़ाइल नाम खाली है." - -#: src/widgets/kpropertiesdialog.cpp:1510 -#: src/widgets/kpropertiesdialog.cpp:2738 -#: src/widgets/kpropertiesdialog.cpp:3038 -#: src/widgets/kpropertiesdialog.cpp:3292 -#, kde-format -msgid "" -"<qt>Could not save properties. You do not have sufficient access to write to " -"<b>%1</b>.</qt>" -msgstr "" -"<qt>गुण सहेज नहीं सकता. आपके पास उचित पहुँच <b>%1</b> </qt> पर लिखने के लिए नहीं है." - -#: src/widgets/kpropertiesdialog.cpp:1586 -#: src/widgets/kpropertiesdialog.cpp:1592 -#: src/widgets/kpropertiesdialog.cpp:1599 -msgid "Forbidden" -msgstr "निषेधित" - -#: src/widgets/kpropertiesdialog.cpp:1587 -msgid "Can Read" -msgstr "पढ़ सकते हैं" - -#: src/widgets/kpropertiesdialog.cpp:1588 -msgid "Can Read & Write" -msgstr "पढ़ व लिख सकते हैं" - -#: src/widgets/kpropertiesdialog.cpp:1593 -msgid "Can View Content" -msgstr "विषयवस्तु देख सकते हैं" - -#: src/widgets/kpropertiesdialog.cpp:1594 -msgid "Can View & Modify Content" -msgstr "विषयवस्तु देख व बदल सकते हैं" - -#: src/widgets/kpropertiesdialog.cpp:1600 -msgid "Can View Content & Read" -msgstr "विषयवस्तु देख व पढ़ सकते हैं" - -#: src/widgets/kpropertiesdialog.cpp:1601 -msgid "Can View/Read & Modify/Write" -msgstr "देख/पढ़ व बदल/लिख सकते हैं" - -#: src/widgets/kpropertiesdialog.cpp:1698 -msgid "&Permissions" -msgstr "अनुमतियाँ (&P)" - -#: src/widgets/kpropertiesdialog.cpp:1710 -#: src/widgets/kpropertiesdialog.cpp:1946 -msgid "Access Permissions" -msgstr "पहुँच अनुमतियाँ" - -#: src/widgets/kpropertiesdialog.cpp:1718 -msgid "This file is a link and does not have permissions." -msgid_plural "All files are links and do not have permissions." -msgstr[0] "यह फ़ाइल एक लिंक है और इसमें अनुमतियां नहीं हैं." -msgstr[1] "सभी फ़ाइलें लिंक हैं और इनमें अनुमतियाँ नहीं हैं" - -#: src/widgets/kpropertiesdialog.cpp:1722 -msgid "Only the owner can change permissions." -msgstr "सिर्फ स्वामी ही अनुमतियाँ बदल सकता है." - -#: src/widgets/kpropertiesdialog.cpp:1726 -msgid "O&wner:" -msgstr "स्वामीः (&w)" - -#: src/widgets/kpropertiesdialog.cpp:1732 -msgid "Specifies the actions that the owner is allowed to do." -msgstr "उल्लेखित करता है कि स्वामी के लिए कौन सी क्रियाएँ स्वीकार्य हैं." - -#: src/widgets/kpropertiesdialog.cpp:1734 -msgid "Gro&up:" -msgstr "समूहः (&u)" - -#: src/widgets/kpropertiesdialog.cpp:1740 -msgid "Specifies the actions that the members of the group are allowed to do." -msgstr "उल्लेखित करता है कि समूह के सदस्यों के लिए कौन सी क्रियाएँ स्वीकार्य हैं." - -#: src/widgets/kpropertiesdialog.cpp:1742 -msgid "O&thers:" -msgstr "अन्यः (&t)" - -#: src/widgets/kpropertiesdialog.cpp:1748 -msgid "" -"Specifies the actions that all users, who are neither owner nor in the " -"group, are allowed to do." -msgstr "" -"निर्धारित करता है कि क्रियाएँ जो सभी उपयोक्ता जो कि न तो मालिक हैं और न ही समूह में " -"हैं, कार्य हेतु स्वीकृत हैं" - -#: src/widgets/kpropertiesdialog.cpp:1753 -msgid "Only own&er can rename and delete folder content" -msgstr "सिर्फ स्वामी ही फ़ोल्डर की वस्तुओं को मिटा सकता है या नाम बदल सकता है (&e)" - -#: src/widgets/kpropertiesdialog.cpp:1754 -msgid "Is &executable" -msgstr "चलाने योग्य है (&e)" - -#: src/widgets/kpropertiesdialog.cpp:1758 -msgid "" -"Enable this option to allow only the folder's owner to delete or rename the " -"contained files and folders. Other users can only add new files, which " -"requires the 'Modify Content' permission." -msgstr "" - -#: src/widgets/kpropertiesdialog.cpp:1762 -msgid "" -"Enable this option to mark the file as executable. This only makes sense for " -"programs and scripts. It is required when you want to execute them." -msgstr "" - -#: src/widgets/kpropertiesdialog.cpp:1769 -msgid "A&dvanced Permissions" -msgstr "विस्तृत अनुमतियाँ (&d)" - -#: src/widgets/kpropertiesdialog.cpp:1777 -msgid "Ownership" -msgstr "स्वामित्व" - -#: src/widgets/kpropertiesdialog.cpp:1784 -msgid "User:" -msgstr "उपयोक्ता:" - -#: src/widgets/kpropertiesdialog.cpp:1861 -msgid "Group:" -msgstr "समूहः" - -#: src/widgets/kpropertiesdialog.cpp:1898 -msgid "Apply changes to all subfolders and their contents" -msgstr "परिवर्तनों को सभी सब-फ़ोल्डर तथा उनके वस्तुओं में लागू करें" - -#: src/widgets/kpropertiesdialog.cpp:1937 -msgid "Advanced Permissions" -msgstr "विस्तृत अनुमतियाँ" - -#: src/widgets/kpropertiesdialog.cpp:1954 -msgid "Class" -msgstr "वर्ग" - -#: src/widgets/kpropertiesdialog.cpp:1959 -msgid "" -"Show\n" -"Entries" -msgstr "" -"दिखाएँ\n" -"प्रविष्टियाँ" - -#: src/widgets/kpropertiesdialog.cpp:1961 -msgid "Read" -msgstr "पढ़ें" - -#: src/widgets/kpropertiesdialog.cpp:1967 -msgid "This flag allows viewing the content of the folder." -msgstr "यह फ्लेग फ़ोल्डर के वस्तुओं को देखने की स्वीकृति देता है." - -#: src/widgets/kpropertiesdialog.cpp:1969 -msgid "The Read flag allows viewing the content of the file." -msgstr "रीड फ्लेग फ़ाइल की वस्तुओं को देखने की स्वीकृति देता है." - -#: src/widgets/kpropertiesdialog.cpp:1974 -msgid "" -"Write\n" -"Entries" -msgstr "" -"लिखें\n" -"प्रविष्टियाँ" - -#: src/widgets/kpropertiesdialog.cpp:1976 -msgid "Write" -msgstr "लिखें" - -#: src/widgets/kpropertiesdialog.cpp:1982 -msgid "" -"This flag allows adding, renaming and deleting of files. Note that deleting " -"and renaming can be limited using the Sticky flag." -msgstr "" -"यह फ्लैग फ़ाइलों को जोड़ने, नाम बदलने तथा मिटाने देता है. टीप लें कि स्टिकी फ्लैग के प्रयोग से " -"मिटाने व नाम बदलने की प्रक्रिया सीमित हो सकती है." - -#: src/widgets/kpropertiesdialog.cpp:1985 -msgid "The Write flag allows modifying the content of the file." -msgstr "राइट फ्लेग फ़ाइल की वस्तुओं को परिवर्धित करने की अनुमति देता है." - -#: src/widgets/kpropertiesdialog.cpp:1991 -msgctxt "Enter folder" -msgid "Enter" -msgstr "प्रविष्ट करें" - -#: src/widgets/kpropertiesdialog.cpp:1992 -msgid "Enable this flag to allow entering the folder." -msgstr "फ़ोल्डर में जाने की स्वीकृति के लिए इस फ्लेग को सक्षम करें." - -#: src/widgets/kpropertiesdialog.cpp:1994 -msgid "Exec" -msgstr "चलाना" - -#: src/widgets/kpropertiesdialog.cpp:1995 -msgid "Enable this flag to allow executing the file as a program." -msgstr "फ़ाइल को प्रोग्राम की तरह चलाने की स्वीकृति के लिए इस फ्लेग को सक्षम करें." - -#: src/widgets/kpropertiesdialog.cpp:2005 -msgid "Special" -msgstr "विशेष" - -#: src/widgets/kpropertiesdialog.cpp:2009 -msgid "" -"Special flag. Valid for the whole folder, the exact meaning of the flag can " -"be seen in the right hand column." -msgstr "" -"विशेष फ्लेग. समस्त फ़ोल्डर के लिए वैध, फ्लेग का सटीक अर्थ दाएँ हाथ के स्तम्भ में देखा जा सकता " -"है." - -#: src/widgets/kpropertiesdialog.cpp:2012 -msgid "" -"Special flag. The exact meaning of the flag can be seen in the right hand " -"column." -msgstr "" -"विशेष फ्लेग. समस्त फ़ोल्डर के लिए वैध, फ्लेग का सटीक अर्थ दाएँ हाथ के स्तम्भ में देखा जा सकता " -"है." - -#: src/widgets/kpropertiesdialog.cpp:2016 -msgid "User" -msgstr "उपयोक्ता" - -#: src/widgets/kpropertiesdialog.cpp:2020 -msgid "Group" -msgstr "समूह" - -#: src/widgets/kpropertiesdialog.cpp:2028 -msgid "Set UID" -msgstr "यूआईडी सेट करें" - -#: src/widgets/kpropertiesdialog.cpp:2032 -msgid "" -"If this flag is set, the owner of this folder will be the owner of all new " -"files." -msgstr "" -"यदि यह फ्लेग नियत किया जाता है, इस फ़ोल्डर का स्वामी सभी नई फ़ाइलों का स्वामी होगा." - -#: src/widgets/kpropertiesdialog.cpp:2035 -msgid "" -"If this file is an executable and the flag is set, it will be executed with " -"the permissions of the owner." -msgstr "" -"यदि यह फ़ाइल एक्जीक्यूटेबल है और फ्लेग नियत किया जाता है, यह स्वामी की अनुमति से एक्जीक्यूट " -"होगा." - -#: src/widgets/kpropertiesdialog.cpp:2039 -msgid "Set GID" -msgstr "जीआईडी सेट करें" - -#: src/widgets/kpropertiesdialog.cpp:2043 -msgid "" -"If this flag is set, the group of this folder will be set for all new files." -msgstr "" -"यदि यह फ्लेग नियत किया जाता है, इस फ़ोल्डर के समूह को सभी नई फ़ाइलों के लिए नियत किया " -"जाएगा." - -#: src/widgets/kpropertiesdialog.cpp:2046 -msgid "" -"If this file is an executable and the flag is set, it will be executed with " -"the permissions of the group." -msgstr "" -"यदि यह फ़ाइल एक्जीक्यूटेबल है और फ्लेग नियत किया जाता है, यह समूह की अनुमति से एक्जीक्यूट " -"होगा." - -#: src/widgets/kpropertiesdialog.cpp:2050 -msgctxt "File permission" -msgid "Sticky" -msgstr "स्टिकी" - -#: src/widgets/kpropertiesdialog.cpp:2054 -msgid "" -"If the Sticky flag is set on a folder, only the owner and root can delete or " -"rename files. Otherwise everybody with write permissions can do this." -msgstr "" -"यदि फ़ोल्डर में स्टिकी फ्लैग सेट कर दिया जाएगा तो सिर्फ मालिक या रूट ही इसे मिटा या " -"इसका नाम बदल सकेगा. अन्यथा प्रत्येक, जिसके पास लिखने की अनुमति है, वो ये कर सकेंगे." - -#: src/widgets/kpropertiesdialog.cpp:2058 -msgid "" -"The Sticky flag on a file is ignored on Linux, but may be used on some " -"systems" -msgstr "" -"लिनक्स में फ़ाइल पर स्टिकी फ्लेग नज़रअंदाज़ किया जाता है, पर किसी तंत्र में उपयोग किया जाता " -"होगा" - -#: src/widgets/kpropertiesdialog.cpp:2246 -msgid "Link" -msgstr "लिंक " - -#: src/widgets/kpropertiesdialog.cpp:2265 -msgid "Varying (No Change)" -msgstr "परिवर्तनीय (कोई परिवर्तन नहीं)" - -#: src/widgets/kpropertiesdialog.cpp:2378 -msgid "This file uses advanced permissions" -msgid_plural "These files use advanced permissions." -msgstr[0] "यह फ़ाइल उन्नत अनुमतियाँ प्रयोग में लेता है" -msgstr[1] "ये फ़ाइलें उन्नत अनुमतियाँ प्रयोग में लेती हैं." - -#: src/widgets/kpropertiesdialog.cpp:2399 -msgid "This folder uses advanced permissions." -msgid_plural "These folders use advanced permissions." -msgstr[0] "यह फ़ोल्डर उन्नत अनुमतियाँ प्रयोग करता है." -msgstr[1] "ये फ़ोल्डर उन्नत अनुमतियाँ प्रयोग करते हैं." - -#: src/widgets/kpropertiesdialog.cpp:2414 -msgid "These files use advanced permissions." -msgstr "ये फ़ाइलें विस्तृत अनुमतियाँ उपयोग करती हैं." - -#: src/widgets/kpropertiesdialog.cpp:2649 -msgid "U&RL" -msgstr "यूआरएल (&R)" - -#: src/widgets/kpropertiesdialog.cpp:2656 -msgid "URL:" -msgstr "यूआरएल:" - -#: src/widgets/kpropertiesdialog.cpp:2796 -msgid "De&vice" -msgstr "उपकरण (&v)" - -#: src/widgets/kpropertiesdialog.cpp:2825 -msgid "Device (/dev/fd0):" -msgstr "उपकरण (/dev/fd0):" - -#: src/widgets/kpropertiesdialog.cpp:2826 -msgid "Device:" -msgstr "उपकरणः" - -#: src/widgets/kpropertiesdialog.cpp:2839 -msgid "Read only" -msgstr "सिर्फ पढ़ने के लिए" - -#: src/widgets/kpropertiesdialog.cpp:2843 -msgid "File system:" -msgstr "फ़ाइल सिस्टमः" - -#: src/widgets/kpropertiesdialog.cpp:2851 -msgid "Mount point (/mnt/floppy):" -msgstr "माउन्ट पाइंट (/mnt/floppy):" - -#: src/widgets/kpropertiesdialog.cpp:2852 -msgid "Mount point:" -msgstr "माउन्ट पाइंटः" - -#: src/widgets/kpropertiesdialog.cpp:3096 -msgid "&Application" -msgstr "अनुप्रयोग (&A)" - -#: src/widgets/kpropertiesdialog.cpp:3222 -#, kde-format -msgid "Add File Type for %1" -msgstr " %1 के लिए फ़ाइल क़िस्म चुनें" - -#: src/widgets/kpropertiesdialog.cpp:3223 -msgid "Select one or more file types to add:" -msgstr "एक या अधिक फ़ाइल क़िस्म जोड़ने के लिए चुनें:" - -#: src/widgets/kpropertiesdialog.cpp:3284 -#, fuzzy -#| msgid "Only executables on local file systems are supported." -msgid "" -"Could not save properties. Only entries on local file systems are supported." -msgstr "सिर्फ स्थानीय फ़ाइल सिस्टम पर एक्जीक्यूटेबल समर्थित हैं." - -#: src/widgets/kpropertiesdialog.cpp:3363 -msgid "Only executables on local file systems are supported." -msgstr "सिर्फ स्थानीय फ़ाइल सिस्टम पर एक्जीक्यूटेबल समर्थित हैं." - -#: src/widgets/kpropertiesdialog.cpp:3377 -#, kde-format -msgid "Advanced Options for %1" -msgstr "%1 के लिए विस्तृत विकल्प " - -#: src/widgets/krun.cpp:168 -#, kde-format -msgid "" -"<qt>Unable to enter <b>%1</b>.\n" -"You do not have access rights to this location.</qt>" -msgstr "" -"<qt><b>%1</b> में जाने में अक्षम.\n" -"आपके पास इस स्थान के लिए पहुँच अधिकार नहीं हैं.</qt>" - -#: src/widgets/krun.cpp:197 -#, kde-format -msgid "" -"<qt>The file <b>%1</b> is an executable program. For safety it will not be " -"started.</qt>" -msgstr "" -"<qt>फ़ाइल <b>%1</b> एक चलाने लायक प्रोग्राम है. सुरक्षा के लिए इसे चलाया नहीं जाएगा.</" -"qt>" - -#: src/widgets/krun.cpp:203 -#, kde-format -msgid "<qt>You do not have permission to run <b>%1</b>.</qt>" -msgstr "<qt>इसे चलाने के लिए आपको अनुमति नहीं है. <b>%1</b>.</qt> " - -#: src/widgets/krun.cpp:233 -msgid "You are not authorized to select an application to open this file." -msgstr "इस फ़ाइल को खोलने के लिए आप किसी अनुप्रयोग को चुनने के लिए अधिकृत नहीं हैं." - -#: src/widgets/krun.cpp:244 -msgid "Open with:" -msgstr "के साथ खोलें:" - -#: src/widgets/krun.cpp:294 -msgid "You are not authorized to execute this file." -msgstr "इस फ़ाइल को चलाने के लिए आप अधिकृत नहीं है." - -#: src/widgets/krun.cpp:317 -#, kde-format -msgid "Launching %1" -msgstr "चालू किया जा रहा है %1" - -#: src/widgets/krun.cpp:422 -#, kde-format -msgid "Error processing Exec field in %1" -msgstr "" - -#: src/widgets/krun.cpp:594 -msgid "You are not authorized to execute this service." -msgstr "इस सेवा को चलाने के लिए आप अधिकृत नहीं है." - -#: src/widgets/krun.cpp:599 -msgctxt "Warning about executing unknown .desktop file" -msgid "Warning" -msgstr "" - -#: src/widgets/krun.cpp:616 -msgctxt "program name follows in a line edit below" -msgid "This will start the program:" -msgstr "" - -#: src/widgets/krun.cpp:633 -msgid "If you do not trust this program, click Cancel" -msgstr "" - -#: src/widgets/krun.cpp:676 -#, kde-format -msgid "Unable to make the service %1 executable, aborting execution" -msgstr "" - -#: src/widgets/krun.cpp:858 -#, kde-format -msgid "" -"<qt>Unable to run the command specified. The file or folder <b>%1</b> does " -"not exist.</qt>" -msgstr "" -"<qt>उल्लेखित कमांड चलाने में अक्षम. फ़ाइल या फ़ोल्डर<b>%1</b> अस्तित्व में नहीं है.</qt>" - -#: src/widgets/krun.cpp:1445 -#, kde-format -msgid "Could not find the program '%1'" -msgstr "प्रोग्राम '%1' ढूंढ नहीं सका" - -#: src/widgets/ksslinfodialog.cpp:57 -msgid "KDE SSL Information" -msgstr "केडीई एसएसएल जानकारी" - -#: src/widgets/ksslinfodialog.cpp:69 -#, fuzzy -#| msgid "Subject line" -msgctxt "The receiver of the SSL certificate" -msgid "Subject" -msgstr "विषय पंक्ति" - -#: src/widgets/ksslinfodialog.cpp:70 -#, fuzzy -#| msgid "Issuer:" -msgctxt "The authority that issued the SSL certificate" -msgid "Issuer" -msgstr "जारीकर्ता:" - -#: src/widgets/ksslinfodialog.cpp:86 src/widgets/ksslinfodialog.cpp:126 -msgid "Current connection is secured with SSL." -msgstr "मौज़ूदा कनेक्शन एसएसएल के साथ सुरक्षित है." - -#: src/widgets/ksslinfodialog.cpp:89 src/widgets/ksslinfodialog.cpp:139 -msgid "Current connection is not secured with SSL." -msgstr "मौज़ूदा कनेक्शन एसएसएल के साथ सुरक्षित नहीं है." - -#: src/widgets/ksslinfodialog.cpp:93 -msgid "SSL support is not available in this build of KDE." -msgstr "केडीई के इस बिल्ड में एसएसएस समर्थन उपलब्ध नहीं है." - -#: src/widgets/ksslinfodialog.cpp:129 -msgid "" -"The main part of this document is secured with SSL, but some parts are not." -msgstr "इस दस्तावेज़ का मुख्य भाग एसएसएल के साथ सुरक्षित है, पर कुछ भाग नहीं." - -#: src/widgets/ksslinfodialog.cpp:135 -#, fuzzy -#| msgid "Some of this document is secured with SSL, but the main part is not." -msgid "Some of this document is secured with SSL, but the main part is not." -msgstr "इस दस्तावेज़ का कुछ भाग एसएसएल के साथ सुरक्षित है, पर मुख्य भाग नहीं." - -#: src/widgets/ksslinfodialog.cpp:186 -#, fuzzy, kde-format -#| msgctxt "Items (Folders, Files)" -#| msgid "%1 (%2, %3)" -msgctxt "%1, using %2 bits of a %3 bit key" -msgid "%1, %2 %3" -msgstr "%1 (%2, %3)" - -#: src/widgets/ksslinfodialog.cpp:188 -#, kde-format -msgctxt "Part of: %1, using %2 bits of a %3 bit key" -msgid "using %1 bit" -msgid_plural "using %1 bits" -msgstr[0] "" -msgstr[1] "" - -#: src/widgets/ksslinfodialog.cpp:190 -#, fuzzy, kde-format -#| msgid "%1 bits used of a %2 bit cipher" -msgctxt "Part of: %1, using %2 bits of a %3 bit key" -msgid "of a %1 bit key" -msgid_plural "of a %1 bit key" -msgstr[0] "%1 बिट्स उपयोग में है %2 बिट साइफर का" -msgstr[1] "%1 बिट्स उपयोग में है %2 बिट साइफर का" - -#: src/widgets/ksslinfodialog.cpp:206 -msgctxt "The certificate is not trusted" -msgid "NO, there were errors:" -msgstr "" - -#: src/widgets/ksslinfodialog.cpp:213 -msgctxt "The certificate is trusted" -msgid "Yes" -msgstr "" - -#: src/widgets/ksslinfodialog.cpp:217 -#, fuzzy, kde-format -#| msgid "%1 (%2)" -msgctxt "%1 is the effective date of the certificate, %2 is the expiry date" -msgid "%1 to %2" -msgstr "%1 (%2)" - -#: src/widgets/kurlrequester.cpp:284 -msgid "Open file dialog" -msgstr "फ़ाइल खोलने का संवाद" - -#: src/widgets/paste.cpp:82 src/widgets/paste.cpp:151 -msgid "Filename for clipboard content:" -msgstr "क्लिपबोर्ड विषयवस्तु के लिए फ़ाइल नामः" - -#: src/widgets/paste.cpp:143 -#, kde-format -msgid "%1 (%2)" -msgstr "%1 (%2)" - -#: src/widgets/paste.cpp:162 -msgid "" -"The clipboard has changed since you used 'paste': the chosen data format is " -"no longer applicable. Please copy again what you wanted to paste." -msgstr "" - -#: src/widgets/paste.cpp:290 -#, kde-format -msgid "&Paste File" -msgid_plural "&Paste %1 Files" -msgstr[0] "फ़ाइल पेस्ट करें (&P)" -msgstr[1] "%1 फ़ाइलें पेस्ट करें (&P)" - -#: src/widgets/paste.cpp:292 -#, kde-format -msgid "&Paste URL" -msgid_plural "&Paste %1 URLs" -msgstr[0] "यूआरएल पेस्ट करें (&P)" -msgstr[1] "%1 यूआरएल पेस्ट करें (&P)" - -#: src/widgets/paste.cpp:295 -msgid "&Paste Clipboard Contents" -msgstr "क्लिपबोर्ड सामग्री को चिपकाएँ (&P)" - -#: src/widgets/pastedialog.cpp:57 -msgid "Data format:" -msgstr "डाटा फ़ॉर्मेट:" - -#: src/widgets/renamedialog.cpp:134 -msgid "Appl&y to All" -msgstr "" - -#: src/widgets/renamedialog.cpp:135 -msgid "" -"When this is checked the button pressed will be applied to all subsequent " -"folder conflicts for the remainder of the current job.\n" -"Unless you press Skip you will still be prompted in case of a conflict with " -"an existing file in the directory." -msgstr "" - -#: src/widgets/renamedialog.cpp:136 -msgid "" -"When this is checked the button pressed will be applied to all subsequent " -"conflicts for the remainder of the current job." -msgstr "" - -#: src/widgets/renamedialog.cpp:141 -msgid "&Rename" -msgstr "नाम बदलें (&R)" - -#: src/widgets/renamedialog.cpp:143 -msgid "Suggest New &Name" -msgstr "नया नाम सुझाएँ (&N)" - -#: src/widgets/renamedialog.cpp:149 -msgid "&Skip" -msgstr "छोड़ें (&S)" - -#: src/widgets/renamedialog.cpp:150 -msgid "Do not copy or move this folder, skip to the next item instead" -msgstr "" - -#: src/widgets/renamedialog.cpp:151 -msgid "Do not copy or move this file, skip to the next item instead" -msgstr "" - -#: src/widgets/renamedialog.cpp:156 -#, fuzzy -#| msgid "Write" -msgctxt "Write files into an existing folder" -msgid "&Write Into" -msgstr "लिखें" - -#: src/widgets/renamedialog.cpp:156 -msgid "&Overwrite" -msgstr "मिटाकर लिखें (&O)" - -#: src/widgets/renamedialog.cpp:158 -msgid "" -"Files and folders will be copied into the existing directory, alongside its " -"existing contents.\n" -"You will be prompted again in case of a conflict with an existing file in " -"the directory." -msgstr "" - -#: src/widgets/renamedialog.cpp:163 -msgid "&Resume" -msgstr "पुनरारंभ (&R)" - -#: src/widgets/renamedialog.cpp:172 -#, kde-format -msgid "" -"This action would overwrite '%1' with itself.\n" -"Please enter a new file name:" -msgstr "" -"यह क्रिया, '%1' को अपने आपसे मिटाकर लिखेगा.\n" -"कृपया एक नया फ़ाइल नाम भरें:" - -#: src/widgets/renamedialog.cpp:176 -msgid "C&ontinue" -msgstr "जारी रखें (&o)" - -#: src/widgets/renamedialog.cpp:230 -#, fuzzy -#| msgid "" -#| "This action would overwrite '%1' with itself.\n" -#| "Please enter a new file name:" -msgid "This action will overwrite the destination." -msgstr "" -"यह क्रिया, '%1' को अपने आपसे मिटाकर लिखेगा.\n" -"कृपया एक नया फ़ाइल नाम भरें:" - -#: src/widgets/renamedialog.cpp:232 -#, fuzzy -#| msgid "Source" -msgid "Source" -msgstr "स्रोत" - -#: src/widgets/renamedialog.cpp:233 -#, fuzzy -#| msgid "Destination" -msgid "Destination" -msgstr "गंतव्य" - -#: src/widgets/renamedialog.cpp:239 -msgid "Warning, the destination is more recent." -msgstr "" - -#: src/widgets/renamedialog.cpp:270 -#, kde-format -msgid "An older item named '%1' already exists." -msgstr "एक पुरानी इकाई '%1' नाम से पहले ही मौज़ूद है. " - -#: src/widgets/renamedialog.cpp:272 -#, kde-format -msgid "A similar file named '%1' already exists." -msgstr "एक ऐसी ही फ़ाइल '%1' नाम से पहले ही मौज़ूद है. " - -#: src/widgets/renamedialog.cpp:274 -#, fuzzy, kde-format -#| msgid "An older item named '%1' already exists." -msgid "A more recent item named '%1' already exists." -msgstr "एक पुरानी इकाई '%1' नाम से पहले ही मौज़ूद है. " - -#: src/widgets/renamedialog.cpp:286 -#, fuzzy -#| msgid "&Rename" -msgid "Rename:" -msgstr "नाम बदलें (&R)" - -#: src/widgets/skipdialog.cpp:38 -msgid "Information" -msgstr "जानकारी" - -#: src/widgets/skipdialog.cpp:48 -msgid "Retry" -msgstr "" - -#: src/widgets/skipdialog.cpp:53 -msgid "Skip" -msgstr "छोड़ें " - -#: src/widgets/skipdialog.cpp:57 -msgid "AutoSkip" -msgstr "स्वचालित छोड़ें" - -#. i18n: ectx: property (text), widget (QLabel, encryptionIndicator) -#: src/widgets/sslinfo.ui:17 -msgid "[padlock]" -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, addressTag) -#: src/widgets/sslinfo.ui:34 -#, fuzzy -#| msgid "IP address:" -msgctxt "Web page address" -msgid "Address:" -msgstr "आईपी पता:" - -#. i18n: ectx: property (text), widget (QLabel, ipTag) -#: src/widgets/sslinfo.ui:54 -#, fuzzy -#| msgid "IP address:" -msgid "IP address:" -msgstr "आईपी पता:" - -#. i18n: ectx: property (text), widget (QLabel, encryptionTag) -#: src/widgets/sslinfo.ui:74 -#, fuzzy -#| msgid "&Description:" -msgid "Encryption:" -msgstr "वर्णनः (&D)" - -#. i18n: ectx: property (text), widget (QLabel, detailsTag) -#: src/widgets/sslinfo.ui:94 -msgid "Details:" -msgstr "विवरण:" - -#. i18n: ectx: property (text), widget (QLabel, sslVersionTag) -#: src/widgets/sslinfo.ui:114 -#, fuzzy -#| msgid "SSL version:" -msgid "SSL version:" -msgstr "एसएसएल संस्करण:" - -#. i18n: ectx: property (text), widget (QLabel, certSelectorTag) -#: src/widgets/sslinfo.ui:134 -#, fuzzy -#| msgid "Certificate" -msgid "Certificate chain:" -msgstr "प्रमाणपत्र" - -#. i18n: ectx: property (text), widget (QLabel, trustedTag) -#: src/widgets/sslinfo.ui:163 -#, fuzzy -#| msgid "Created:" -msgid "Trusted:" -msgstr "सृजितः" - -#. i18n: ectx: property (text), widget (QLabel, validityPeriodTag) -#: src/widgets/sslinfo.ui:183 -#, fuzzy -#| msgid "Valid from:" -msgid "Validity period:" -msgstr "तब से वैध:" - -#. i18n: ectx: property (text), widget (QLabel, serialTag) -#: src/widgets/sslinfo.ui:203 -#, fuzzy -#| msgid "Serial number:" -msgid "Serial number:" -msgstr "सरल क्रमांक:" - -#. i18n: ectx: property (text), widget (QLabel, digestTag) -#: src/widgets/sslinfo.ui:223 -#, fuzzy -#| msgid "MD5 digest:" -msgid "MD5 digest:" -msgstr "एमडी5 डाइजेस्ट:" - -#. i18n: ectx: property (text), widget (QLabel, sha1DigestTag) -#: src/widgets/sslinfo.ui:243 -#, fuzzy -#| msgid "MD5 digest:" -msgid "SHA1 digest:" -msgstr "एमडी5 डाइजेस्ट:" - -#: src/widgets/sslui.cpp:49 -msgid "" -"The remote host did not send any SSL certificates.\n" -"Aborting because the identity of the host cannot be established." -msgstr "" - -#~ msgctxt "NAME OF TRANSLATORS" -#~ msgid "Your names" -#~ msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर" - -#~ msgctxt "EMAIL OF TRANSLATORS" -#~ msgid "Your emails" -#~ msgstr "raviratlami@aol.in," - -#, fuzzy -#~| msgid "New Folder" -#~ msgctxt "folder name" -#~ msgid "New Folder" -#~ msgstr "नया फ़ोल्डर" - -#, fuzzy -#~| msgid "" -#~| "Create new folder in:\n" -#~| "%1" -#~ msgctxt "@label:textbox" -#~ msgid "" -#~ "Create new folder in:\n" -#~ "%1" -#~ msgstr "" -#~ "नया फ़ोल्डर:\n" -#~ "%1 में बनाएँ" - -#, fuzzy -#~| msgid "Select Folder" -#~ msgctxt "@title:window" -#~ msgid "Select Folder" -#~ msgstr "फ़ोल्डर चुनें" - -#, fuzzy -#~| msgid "New Folder..." -#~ msgctxt "@action:button" -#~ msgid "New Folder..." -#~ msgstr "नया फ़ोल्डर..." - -#, fuzzy -#~| msgid "New Folder..." -#~ msgctxt "@action:inmenu" -#~ msgid "New Folder..." -#~ msgstr "नया फ़ोल्डर..." - -#, fuzzy -#~| msgid "Move to Trash" -#~ msgctxt "@action:inmenu" -#~ msgid "Move to Trash" -#~ msgstr "रद्दी पर ले जाएँ" - -#, fuzzy -#~| msgid "Delete" -#~ msgctxt "@action:inmenu" -#~ msgid "Delete" -#~ msgstr "मिटाएँ" - -#, fuzzy -#~| msgid "Show Hidden Folders" -#~ msgctxt "@option:check" -#~ msgid "Show Hidden Folders" -#~ msgstr "छुपे फ़ोल्डर दिखाएँ" - -#, fuzzy -#~| msgid "Properties" -#~ msgctxt "@action:inmenu" -#~ msgid "Properties" -#~ msgstr "गुण" - -#, fuzzy -#~| msgid "Show Hidden Folders" -#~ msgid "Show Hidden Folders" -#~ msgstr "छुपे फ़ोल्डर दिखाएँ" - -#~ msgid "KDE HTTP cache maintenance tool" -#~ msgstr "केडीई एचटीटीपी कैश मेंटेनेंस औज़ार" - -#~ msgid "Empty the cache" -#~ msgstr "कैश खाली करें" - -#, fuzzy -#~| msgid "Display SSL &Information" -#~ msgid "Display information about cache file" -#~ msgstr "एसएसएल जानकारी दिखाएँ (&I)" - -#~ msgid "HTTP Cookie Daemon" -#~ msgstr "एचटीटीपी कुकी डेमन" - -#~ msgid "HTTP cookie daemon" -#~ msgstr "एचटीटीपी कुकी डेमन" - -#~ msgid "Shut down cookie jar" -#~ msgstr "कुकी जार बन्द करें" - -#~ msgid "Remove cookies for domain" -#~ msgstr "डेमन की कुकी मिटाएँ" - -#~ msgid "Remove all cookies" -#~ msgstr "सभी कुकी मिटाएँ" - -#~ msgid "Reload configuration file" -#~ msgstr "कॉन्फ़िगरेशन फ़ाइल फिर से लोड करें" - -#~ msgid "kio_metainfo" -#~ msgstr "केआईओ_मेटाइन्फ़ो" - -#~ msgid "No metainfo for %1" -#~ msgstr "%1 के लिए कोई मेटाजानकारी नहीं " - -#~ msgid "--- separator ---" -#~ msgstr "--- सेपरेटर ---" - -#, fuzzy -#~| msgid "Update" -#~ msgctxt "@action:button" -#~ msgid "Update" -#~ msgstr "अद्यतन" - -#, fuzzy -#~| msgid "Bookmark Properties" -#~ msgctxt "@title:window" -#~ msgid "Bookmark Properties" -#~ msgstr "पसंदीदा गुण" - -#, fuzzy -#~| msgid "Add" -#~ msgctxt "@action:button" -#~ msgid "Add" -#~ msgstr "जोड़ें" - -#, fuzzy -#~| msgid "Add Bookmark" -#~ msgctxt "@title:window" -#~ msgid "Add Bookmark" -#~ msgstr " पसंदीदा जोड़ें" - -#, fuzzy -#~| msgid "&New Folder..." -#~ msgctxt "@action:button" -#~ msgid "&New Folder..." -#~ msgstr "नया फ़ोल्डर...(&N)" - -#, fuzzy -#~| msgid "Add Bookmarks" -#~ msgctxt "@title:window" -#~ msgid "Add Bookmarks" -#~ msgstr "पसंदीदा जोड़ें" - -#, fuzzy -#~| msgid "Name:" -#~ msgctxt "@label:textbox" -#~ msgid "Name:" -#~ msgstr "नाम:" - -#, fuzzy -#~| msgid "Location:" -#~ msgctxt "@label:textbox" -#~ msgid "Location:" -#~ msgstr "स्थानः" - -#, fuzzy -#~| msgid "Comm&ent:" -#~ msgctxt "@label:textbox" -#~ msgid "Comment:" -#~ msgstr "टिप्पणीः (&e)" - -#, fuzzy -#~| msgid "Create New Bookmark Folder" -#~ msgctxt "@title:window" -#~ msgid "Create New Bookmark Folder" -#~ msgstr "नया पसंदीदा फ़ोल्डर बनाएँ" - -#, fuzzy -#~| msgid "Create New Bookmark Folder in %1" -#~ msgctxt "@title:window" -#~ msgid "Create New Bookmark Folder in %1" -#~ msgstr "%1 में नया पसंदीदा फ़ोल्डर बनाएँ " - -#, fuzzy -#~| msgid "New folder:" -#~ msgctxt "@label:textbox" -#~ msgid "New folder:" -#~ msgstr "नया फ़ोल्डर: " - -#, fuzzy -#~| msgid "Bookmarks" -#~ msgctxt "name of the container of all browser bookmarks" -#~ msgid "Bookmarks" -#~ msgstr " पसंदीदा " - -#~ msgid "*.html|HTML Files (*.html)" -#~ msgstr "*.html|एचटीएमएल फ़ाइलें (*.html)" - -#~ msgid "<!-- This file was generated by Konqueror -->" -#~ msgstr "<!-- यह फ़ाइल कॉन्करर द्वारा उत्पन्न की गई है -->" - -#~ msgid "*.adr|Opera Bookmark Files (*.adr)" -#~ msgstr "*.adr|ओपेरा पसंद फ़ाइलें (*.adr)" - -#~ msgid "Add Bookmark Here" -#~ msgstr "यहाँ पसंदीदा जोड़ें" - -#~ msgid "Open Folder in Bookmark Editor" -#~ msgstr "फ़ोल्डर पसंद संपादक में खोलें" - -#~ msgid "Delete Folder" -#~ msgstr "फ़ोल्डर मिटाएँ" - -#~ msgid "Copy Link Address" -#~ msgstr "लिंक पता नक़ल करें" - -#~ msgid "Delete Bookmark" -#~ msgstr " पसंदीदा मिटाएँ" - -#~ msgid "Open Folder in Tabs" -#~ msgstr "फ़ोल्डर टैब में खोलें" - -#~ msgid "Cannot add bookmark with empty URL." -#~ msgstr "रिक्त यूआरएल में पसंद नहीं जोड़ सकता." - -#~ msgid "" -#~ "Are you sure you wish to remove the bookmark folder\n" -#~ "\"%1\"?" -#~ msgstr "" -#~ "क्या आप वाक़ई इस पसंद फ़ोल्डर को मिटाना चाहते हैं\n" -#~ "\"%1\"?" - -#~ msgid "" -#~ "Are you sure you wish to remove the bookmark\n" -#~ "\"%1\"?" -#~ msgstr "" -#~ "क्या आप वाक़ई इस पसंदीदा को मिटाना चाहते हैं\n" -#~ "\"%1\"?" - -#~ msgid "Bookmark Folder Deletion" -#~ msgstr "पसंदीदा फ़ोल्डर मिटाना" - -#~ msgid "Bookmark Deletion" -#~ msgstr "पसंदीदा मिटाना" - -#~ msgid "Open all bookmarks in this folder as a new tab." -#~ msgstr "इस फ़ोल्सडर में भी पसंदीदा को एक नए टैब के रूप में दिखाएँ" - -#~ msgid "Bookmark Tabs as Folder..." -#~ msgstr "टैब्स को पसंदीदा फ़ोल्डर के रूप में बनाएँ" - -#~ msgid "Add a folder of bookmarks for all open tabs." -#~ msgstr "सभी खुले टैब्स के लिए एक पसंदीदा फ़ोल्डर जोड़ें." - -#~ msgid "Edit your bookmark collection in a separate window" -#~ msgstr "अलग विंडो में पसंदीदा संग्रह का संपादन करें" - -#~ msgid "New Bookmark Folder..." -#~ msgstr "नया पसंदीदा फ़ोल्डर..." - -#~ msgid "Create a new bookmark folder in this menu" -#~ msgstr "इस मेन्यू में एक नया पसंदीदा फ़ोल्डर बनाएँ" - -#~ msgid "Hide in toolbar" -#~ msgstr "औजार पट्टी में छुपाएँ" - -#~ msgid "Show in toolbar" -#~ msgstr "औजार पट्टी में दिखाएँ" - -#~ msgid "Open in New Window" -#~ msgstr "नए विंडो में खोलें." - -#~ msgid "Open in New Tab" -#~ msgstr "नए टैब में खोलें" - -#~ msgid "Receiving corrupt data." -#~ msgstr "खराब डाटा प्राप्त किया जा रहा है." - -#, fuzzy -#~| msgid "Add Entry..." -#~ msgctxt "@label" -#~ msgid "Add Comment..." -#~ msgstr "प्रविष्टि जोड़ें..." - -#, fuzzy -#~| msgid "Calculating..." -#~ msgctxt "@label" -#~ msgid "Change..." -#~ msgstr "गणना में... " - -#, fuzzy -#~| msgid "Comment" -#~ msgctxt "@title:window" -#~ msgid "Change Comment" -#~ msgstr "टिप्पणी" - -#, fuzzy -#~| msgid "Comment" -#~ msgctxt "@title:window" -#~ msgid "Add Comment" -#~ msgstr "टिप्पणी" - -#~ msgid "Device name" -#~ msgstr "उपकरण नाम" - -#, fuzzy -#~| msgid "*|All Files" -#~ msgid "*|All files" -#~ msgstr "*|सभी फ़ाइलें" - -#, fuzzy -#~| msgctxt "Items in a folder" -#~| msgid "1 item" -#~| msgid_plural "%1 items" -#~ msgctxt "@item:intable" -#~ msgid "%1 item" -#~ msgid_plural "%1 items" -#~ msgstr[0] "१ वस्तु" -#~ msgstr[1] "%1 वस्तुएँ" - -#, fuzzy -#~| msgid "Comment" -#~ msgctxt "@label" -#~ msgid "Comment" -#~ msgstr "टिप्पणी" - -#, fuzzy -#~| msgid "Modified:" -#~ msgctxt "@label" -#~ msgid "Modified" -#~ msgstr "परिवर्धितः" - -#, fuzzy -#~| msgid "Owner" -#~ msgctxt "@label" -#~ msgid "Owner" -#~ msgstr "मालिक" - -#, fuzzy -#~| msgctxt "@title job" -#~| msgid "Stating" -#~ msgctxt "@label" -#~ msgid "Rating" -#~ msgstr "स्टेटिंग" - -#, fuzzy -#~| msgctxt "@title:column" -#~| msgid "Size" -#~ msgctxt "@label" -#~ msgid "Size" -#~ msgstr "आकार" - -#, fuzzy -#~| msgid "Trash" -#~ msgctxt "@label" -#~ msgid "Tags" -#~ msgstr "रद्दी" - -#, fuzzy -#~| msgid "Size:" -#~ msgctxt "@label" -#~ msgid "Total Size" -#~ msgstr "आकारः" - -#, fuzzy -#~| msgid "Type" -#~ msgctxt "@label" -#~ msgid "Type" -#~ msgstr "क़िस्म" - -#~ msgid "<Error>" -#~ msgstr "<त्रुटि>" - -#~ msgid "&Share" -#~ msgstr "साझेदारी (&S)" - -#~ msgid "Only folders in your home folder can be shared." -#~ msgstr "सिर्फ आपके होम फ़ोल्डर के फ़ोल्डर्स ही साझा हो सकते हैं." - -#~ msgid "Not shared" -#~ msgstr "साझेदारी नहीं है" - -#~ msgid "Shared" -#~ msgstr "साझेदारी" - -#~ msgid "" -#~ "Sharing this folder makes it available under Linux/UNIX (NFS) and Windows " -#~ "(Samba)." -#~ msgstr "" -#~ "इस फ़ोल्डर को साझा करने पर यह लिनक्स/यूनिक्स (एनएफएस) तथा विंडोज़ (साम्बा) पर " -#~ "उपलब्ध होगा." - -#~ msgid "You can also reconfigure file sharing authorization." -#~ msgstr "आप फ़ाइल शेयरिंग अनुमोदन रिकॉन्फ़िगर कर सकते हैं." - -#~ msgid "Configure File Sharing..." -#~ msgstr "फ़ाइल साझा कॉन्फ़िगर करें..." - -#~ msgid "" -#~ "Error running 'filesharelist'. Check if installed and in $PATH or /usr/" -#~ "sbin." -#~ msgstr "" -#~ " 'filesharelist' चलाने में त्रुटि. जाँचें कि स्थापित है, तथा $PATH या /usr/sbin में " -#~ "है." - -#~ msgid "You need to be authorized to share folders." -#~ msgstr "फ़ोल्डर्स साझा करने के लिए आपको अनुमोदित होना आवश्यक है." - -#~ msgid "File sharing is disabled." -#~ msgstr "फ़ाइल साझा अक्षम है." - -#~ msgid "Sharing folder '%1' failed." -#~ msgstr "फ़ोल्डर '%1' साझा करने में असफल." - -#~ msgid "" -#~ "An error occurred while trying to share folder '%1'. Make sure that the " -#~ "Perl script 'fileshareset' is set suid root." -#~ msgstr "" -#~ "फ़ोल्डर '%1' को साझा करने की कोशिश में एक त्रुटि हुई. कृपया सुनिश्चित करें कि रूट में " -#~ "'fileshareset' सेट है." - -#~ msgid "Unsharing folder '%1' failed." -#~ msgstr "फ़ोल्डर '%1' साझा हटाने में असफल." - -#~ msgid "" -#~ "An error occurred while trying to unshare folder '%1'. Make sure that the " -#~ "Perl script 'fileshareset' is set suid root." -#~ msgstr "" -#~ "फ़ोल्डर '%1' का साझा समाप्त करने की कोशिश में एक त्रुटि हुई. कृपया सुनिश्चित करें कि " -#~ "'fileshareset' रूट में सेट है." - -#~ msgid "Select Icon" -#~ msgstr "प्रतीक चुनें" - -#~ msgid "Icon Source" -#~ msgstr "प्रतीक स्रोत" - -#~ msgid "S&ystem icons:" -#~ msgstr "तंत्र प्रतीकः (&y)" - -#~ msgid "O&ther icons:" -#~ msgstr "अन्य प्रतीकः (&t)" - -#~ msgid "&Search:" -#~ msgstr "ढूंढें: (&S)" - -#~ msgid "Search interactively for icon names (e.g. folder)." -#~ msgstr "प्रतीक नामों के लिए इंटरेक्टिव ढूंढें (उदा. फ़ोल्डर)." - -#~ msgid "Actions" -#~ msgstr "क्रियाएं" - -#~ msgid "Animations" -#~ msgstr "एनिमेशन" - -#~ msgid "Applications" -#~ msgstr "अनुप्रयोग" - -#~ msgid "Categories" -#~ msgstr "श्रेणियाँ" - -#~ msgid "Devices" -#~ msgstr "औज़ार" - -#~ msgid "Emblems" -#~ msgstr "एम्ब्लेम" - -#~ msgid "Emotes" -#~ msgstr "इमोट्स" - -#~ msgid "Filesystems" -#~ msgstr "फ़ाइलसिस्टम" - -#~ msgid "International" -#~ msgstr "अंतर्राष्ट्रीय" - -#~ msgid "Mimetypes" -#~ msgstr "माइमटाइप्स" - -#~ msgid "Places" -#~ msgstr "स्थान" - -#~ msgid "Status" -#~ msgstr "स्थिति" - -#~ msgid "*.png *.xpm *.svg *.svgz|Icon Files (*.png *.xpm *.svg *.svgz)" -#~ msgstr "*.png *.xpm *.svg *.svgz|प्रतीक फ़ाइलें (*.png *.xpm *.svg *.svgz)" - -#, fuzzy -#~| msgid "Calculating..." -#~ msgctxt "@action:button" -#~ msgid "Configure..." -#~ msgstr "गणना में... " - -#, fuzzy -#~| msgid "Information" -#~ msgctxt "@title:tab" -#~ msgid "Information" -#~ msgstr "जानकारी" - -#, fuzzy -#~| msgid "Created:" -#~ msgctxt "@label creation date" -#~ msgid "Created" -#~ msgstr "सृजितः" - -#, fuzzy -#~| msgctxt "@title:column" -#~| msgid "Size" -#~ msgctxt "@label file content size" -#~ msgid "Size" -#~ msgstr "आकार" - -#, fuzzy -#~| msgid "Description" -#~ msgctxt "@label" -#~ msgid "Description" -#~ msgstr "वर्णन" - -#, fuzzy -#~| msgid "&General" -#~ msgctxt "@label Software used to generate content" -#~ msgid "Generator" -#~ msgstr "सामान्य (&G)" - -#, fuzzy -#~| msgid "Parent Folder" -#~ msgctxt "@label parent directory" -#~ msgid "Part of" -#~ msgstr "पेरेन्ट फ़ोल्डर " - -#, fuzzy -#~| msgid "Modified:" -#~ msgctxt "@label modified date of file" -#~ msgid "Modified" -#~ msgstr "परिवर्धितः" - -#, fuzzy -#~| msgid "Mime Type" -#~ msgctxt "@label" -#~ msgid "MIME Type" -#~ msgstr "माइम क़िस्म" - -#, fuzzy -#~| msgid "Contents:" -#~ msgctxt "@label" -#~ msgid "Content" -#~ msgstr "विषयसूचीः" - -#, fuzzy -#~| msgid "created on %1" -#~ msgctxt "@label" -#~ msgid "Related To" -#~ msgstr " %1 को तैयार किया गया" - -#, fuzzy -#~| msgid "Subject line" -#~ msgctxt "@label" -#~ msgid "Subject" -#~ msgstr "विषय पंक्ति" - -#, fuzzy -#~| msgid "File" -#~ msgctxt "@label music title" -#~ msgid "Title" -#~ msgstr "फ़ाइल" - -#, fuzzy -#~| msgid "Location:" -#~ msgctxt "@label file URL" -#~ msgid "Location" -#~ msgstr "स्थानः" - -#, fuzzy -#~| msgid "Created:" -#~ msgctxt "@label" -#~ msgid "Creator" -#~ msgstr "सृजितः" - -#, fuzzy -#~| msgid "Categories" -#~ msgctxt "@label number of characters" -#~ msgid "Characters" -#~ msgstr "श्रेणियाँ" - -#, fuzzy -#~| msgid "C&onnect" -#~ msgctxt "@label" -#~ msgid "Codec" -#~ msgstr "कनेक्ट (&o)" - -#, fuzzy -#~| msgid "Destination" -#~ msgctxt "@label" -#~ msgid "Duration" -#~ msgstr "गंतव्य" - -#, fuzzy -#~| msgid "Device name" -#~ msgctxt "@label" -#~ msgid "Filename" -#~ msgstr "उपकरण नाम" - -#, fuzzy -#~| msgid "Link" -#~ msgctxt "@label number of lines" -#~ msgid "Lines" -#~ msgstr "लिंक " - -#, fuzzy -#~| msgid "Write" -#~ msgctxt "@label" -#~ msgid "Width" -#~ msgstr "लिखें" - -#, fuzzy -#~| msgid "Exposure:" -#~ msgctxt "@label EXIF" -#~ msgid "Exposure Time" -#~ msgstr "एक्सपोज़रः" - -#, fuzzy -#~| msgid "Class" -#~ msgctxt "@label EXIF" -#~ msgid "Flash" -#~ msgstr "वर्ग" - -#, fuzzy -#~| msgid "Mask" -#~ msgctxt "@label EXIF" -#~ msgid "Make" -#~ msgstr "मास्क" - -#, fuzzy -#~| msgid "Organization:" -#~ msgctxt "@label EXIF" -#~ msgid "Orientation" -#~ msgstr "संगठन:" - -#, fuzzy -#~| msgid "Directory" -#~ msgctxt "@label video director" -#~ msgid "Director" -#~ msgstr "डिरेक्ट्री" - -#, fuzzy -#~| msgid "&General" -#~ msgctxt "@label music genre" -#~ msgid "Genre" -#~ msgstr "सामान्य (&G)" - -#, fuzzy -#~| msgid "&Remove '%1'" -#~ msgctxt "@label" -#~ msgid "Release Date" -#~ msgstr "मिटाएँ '%1' (&R)" - -#, fuzzy -#~| msgid "URL Resource Invalid" -#~ msgctxt "@label resource created time" -#~ msgid "Resource Created" -#~ msgstr "यूआरएल रिसोर्स अवैध है" - -#, fuzzy -#~| msgid "Source" -#~ msgctxt "@label" -#~ msgid "Sub Resource" -#~ msgstr "स्रोत" - -#, fuzzy -#~| msgid "Modified:" -#~ msgctxt "@label resource last modified" -#~ msgid "Resource Modified" -#~ msgstr "परिवर्धितः" - -#, fuzzy -#~| msgctxt "@title job" -#~| msgid "Stating" -#~ msgctxt "@label" -#~ msgid "Numeric Rating" -#~ msgstr "स्टेटिंग" - -#, fuzzy -#~| msgid "Comment" -#~ msgctxt "@label" -#~ msgid "Usage Count" -#~ msgstr "टिप्पणी" - -#, fuzzy -#~| msgid "Open file dialog" -#~ msgctxt "@label" -#~ msgid "Unix File Owner" -#~ msgstr "फ़ाइल खोलने का संवाद" - -#, fuzzy -#~| msgid "Type" -#~ msgctxt "@label file type" -#~ msgid "Type" -#~ msgstr "क़िस्म" - -#, fuzzy -#~| msgid "Created:" -#~ msgctxt "@label Number of translated strings" -#~ msgid "Translated" -#~ msgstr "सृजितः" - -#~ msgid "P&review" -#~ msgstr "पूर्वावलोकन (&r)" - -#~ msgid "&Skip File" -#~ msgstr "फ़ाइल छोड़ें (&S)" - -#~ msgid "No service implementing %1" -#~ msgstr " %1 के कार्यान्वयन में कोई सेवा नहीं है" - -#~ msgid "Default" -#~ msgstr "डिफ़ॉल्ट" - -#~ msgid "Link to %1 (%2)" -#~ msgstr "%1 (%2) पर लिंक करें" - -#~ msgid "Owner:" -#~ msgstr "मालिक:" - -#~ msgid "Permissions:" -#~ msgstr "अनुमतियाँ:" - -#~ msgid "All Pictures" -#~ msgstr "सभी छवियाँ" - -#~ msgid "Mime Type" -#~ msgstr "माइम क़िस्म" - -#~ msgid "Comment" -#~ msgstr "टिप्पणी" - -#~ msgid "Patterns" -#~ msgstr "पैटर्न" - -#~ msgid "&Edit..." -#~ msgstr "संपादन... (&E)" - -#~ msgid "Click this button to display the familiar KDE mime type editor." -#~ msgstr "भिज्ञ केडीई माइम क़िस्म संपादक प्रदर्शित करने के लिए इस बटन को क्लिक करें." - -#~ msgid "Acquire Image" -#~ msgstr "छवि प्राप्त करें" - -#~ msgid "OCR Image" -#~ msgstr "ओसीआर छवि" - -#~ msgid "File '%1' is not readable" -#~ msgstr "फ़ाइल '%1' पढ़ने लायक नहीं है" - -#~ msgid "ERROR: Unknown protocol '%1'" -#~ msgstr "त्रुटि: अज्ञात प्रोटोकॉल '%1'" - -#~ msgid "Authorization Dialog" -#~ msgstr "अनुमोदन संवाद " - -#~ msgid "The clipboard is empty" -#~ msgstr "क्लिपबोर्ड खाली है" - -#, fuzzy -#~| msgid "Organization:" -#~ msgid "Organization / Common Name" -#~ msgstr "संगठन:" - -#, fuzzy -#~| msgid "Organizational unit:" -#~ msgid "Organizational Unit" -#~ msgstr "संगठनात्मक इकाई:" - -#, fuzzy -#~| msgid "Emblems" -#~ msgid "Enable" -#~ msgstr "एम्ब्लेम" - -#, fuzzy -#~| msgid "Send certificate" -#~ msgid "System certificates" -#~ msgstr "प्रमाणपत्र भेजें" - -#, fuzzy -#~| msgid "Send certificate" -#~ msgid "User-added certificates" -#~ msgstr "प्रमाणपत्र भेजें" - -#, fuzzy -#~| msgid "Certificate" -#~ msgid "Pick Certificates" -#~ msgstr "प्रमाणपत्र" - -#, fuzzy -#~| msgid "Security Information" -#~ msgid "<b>Subject Information</b>" -#~ msgstr "सुरक्षा जानकारी" - -#, fuzzy -#~| msgid " <b>[Cross Domain]</b>" -#~ msgid "<b>Issuer Information</b>" -#~ msgstr " <b>[क्रास डोमेन]</b>" - -#, fuzzy -#~| msgid "<b>%1</b>" -#~ msgid "<b>Other</b>" -#~ msgstr "<b>%1</b>" - -#, fuzzy -#~| msgid "Valid from:" -#~ msgid "Validity period" -#~ msgstr "तब से वैध:" - -#, fuzzy -#~| msgid "Serial number:" -#~ msgid "Serial number" -#~ msgstr "सरल क्रमांक:" - -#, fuzzy -#~| msgid "MD5 digest:" -#~ msgid "MD5 digest" -#~ msgstr "एमडी5 डाइजेस्ट:" - -#, fuzzy -#~| msgid "MD5 digest:" -#~ msgid "SHA1 digest" -#~ msgstr "एमडी5 डाइजेस्ट:" - -#, fuzzy -#~| msgid "Reload configuration file" -#~ msgid "SSL Configuration Module" -#~ msgstr "कॉन्फ़िगरेशन फ़ाइल फिर से लोड करें" - -#, fuzzy -#~| msgid "Link" -#~ msgid "SSL Signers" -#~ msgstr "लिंक " - -#~ msgid "&Repeat password:" -#~ msgstr "पासवर्ड दोहराएँ: (&R)" - -#~ msgid "&Choose password:" -#~ msgstr "पासवर्ड चुनें: (&C)" - -#~ msgid "Certificate" -#~ msgstr "प्रमाणपत्र" - -#~ msgid "Save selection for this host." -#~ msgstr "इस होस्ट के लिए चयन सहेजें" - -#~ msgid "Send certificate" -#~ msgstr "प्रमाणपत्र भेजें" - -#~ msgid "KDE SSL Certificate Dialog" -#~ msgstr "केडीई एसएसएल प्रमाणपत्र संवाद" - -#~ msgid "" -#~ "The server <b>%1</b> requests a certificate.<br /><br />Select a " -#~ "certificate to use from the list below:" -#~ msgstr "" -#~ "सर्वर <b>%1</b> ने प्रमाणपत्र के लिए निवेदन किया है.<br /><br /> नीचे दी गई सूची में " -#~ "से प्रमाणपत्र चुनें:" - -#~ msgid "Signature Algorithm: " -#~ msgstr "हस्ताक्षर एल्गोरिदम: " - -#~ msgid "Unknown" -#~ msgstr "अज्ञात" - -#~ msgid "Signature Contents:" -#~ msgstr "हस्ताक्षर विषयवस्तु: " - -#~ msgctxt "Unknown" -#~ msgid "Unknown key algorithm" -#~ msgstr "अज्ञात कुंजी अल्गोरिद्म" - -#~ msgid "Key type: RSA (%1 bit)" -#~ msgstr "कुंजी क़िस्म: आरएसए (%1 बिट)" - -#~ msgid "Modulus: " -#~ msgstr "मॉडुलस: " - -#~ msgid "Exponent: 0x" -#~ msgstr "एक्सपोनेंट: 0x" - -#~ msgid "Key type: DSA (%1 bit)" -#~ msgstr "कुंजी क़िस्म: डीएसए (%1 बिट)" - -#~ msgid "Prime: " -#~ msgstr "प्राइम: " - -#~ msgid "160 bit prime factor: " -#~ msgstr "160 बिट प्राइम फैक्टर: " - -#~ msgid "Public key: " -#~ msgstr "सार्वजनिक कुंजीः" - -#, fuzzy -#~| msgid "" -#~| "Certificate signing authority root files could not be found so the " -#~| "certificate is not verified." -#~ msgid "" -#~ "Retrieval of the CRL (Certificate Revocation List) failed. This means the " -#~ "CA's (Certificate Authority) CRL can not be found." -#~ msgstr "" -#~ "प्रमाणपत्र हस्ताक्षर करने वाली अधिकृत रूट फ़ाइल नहीं मिली अतः प्रमाणपत्र सत्यापित नहीं " -#~ "हुआ." - -#, fuzzy -#~| msgid "" -#~| "Certificate signing authority root files could not be found so the " -#~| "certificate is not verified." -#~ msgid "" -#~ "The certificate's signature is invalid. This means that the certificate " -#~ "can not be verified." -#~ msgstr "" -#~ "प्रमाणपत्र हस्ताक्षर करने वाली अधिकृत रूट फ़ाइल नहीं मिली अतः प्रमाणपत्र सत्यापित नहीं " -#~ "हुआ." - -#, fuzzy -#~| msgid "" -#~| "Certificate signing authority root files could not be found so the " -#~| "certificate is not verified." -#~ msgid "" -#~ "The CRL's (Certificate Revocation List) signature is invalid. This means " -#~ "that the CRL can not be verified." -#~ msgstr "" -#~ "प्रमाणपत्र हस्ताक्षर करने वाली अधिकृत रूट फ़ाइल नहीं मिली अतः प्रमाणपत्र सत्यापित नहीं " -#~ "हुआ." - -#, fuzzy -#~| msgid "The certificate is invalid." -#~ msgid "The certificate is not valid, yet." -#~ msgstr "प्रमाणपत्र अवैध है." - -#, fuzzy -#~| msgid "The certificate is invalid." -#~ msgid "The certificate is not valid, any more." -#~ msgstr "प्रमाणपत्र अवैध है." - -#, fuzzy -#~| msgid "The certificate is invalid." -#~ msgid "The CRL (Certificate Revocation List) is not valid, yet." -#~ msgstr "प्रमाणपत्र अवैध है." - -#, fuzzy -#~| msgid "The certificate is invalid." -#~ msgid "" -#~ "The time format of the CRL's (Certificate Revocation List) 'lastUpdate' " -#~ "field is invalid." -#~ msgstr "प्रमाणपत्र अवैध है." - -#, fuzzy -#~| msgid "The certificate is invalid." -#~ msgid "" -#~ "The time format of the CRL's (Certificate Revocation List) 'nextUpdate' " -#~ "field is invalid." -#~ msgstr "प्रमाणपत्र अवैध है." - -#, fuzzy -#~| msgid "" -#~| "The IP address of the host %1 does not match the one the certificate was " -#~| "issued to." -#~ msgid "" -#~ "The certificate's CA (Certificate Authority) does not match the CA name " -#~ "of the certificate." -#~ msgstr "होस्ट %1 का आईपी पता जो प्रमाणपत्र जारी किया गया है, उससे मेल नहीं खाता." - -#~ msgid "" -#~ "Certificate signing authority root files could not be found so the " -#~ "certificate is not verified." -#~ msgstr "" -#~ "प्रमाणपत्र हस्ताक्षर करने वाली अधिकृत रूट फ़ाइल नहीं मिली अतः प्रमाणपत्र सत्यापित नहीं " -#~ "हुआ." - -#~ msgid "SSL support was not found." -#~ msgstr "एसएसएल समर्थन नहीं मिला" - -#~ msgid "Private key test failed." -#~ msgstr "प्राइवेट कुंजी परीक्षण असफल" - -#~ msgid "This certificate is not relevant." -#~ msgstr "प्रमाणपत्र सम्बद्ध नहीं है." - -#~ msgid "KDE Certificate Request" -#~ msgstr "केडीई प्रमाणपत्र निवेदन" - -#~ msgid "KDE Certificate Request - Password" -#~ msgstr "केडीई प्रमाणपत्र निवेदन - पासवर्ड" - -#~ msgid "Unsupported key size." -#~ msgstr "असमर्थित कुंजी आकार." - -#~ msgid "KDE" -#~ msgstr "केडीई" - -#~ msgid "Please wait while the encryption keys are generated..." -#~ msgstr "कृपया इंतजार करें जबकि एनक्रिप्शन कुंजियाँ बनाई जा रही हैं..." - -#~ msgid "Do you wish to store the passphrase in your wallet file?" -#~ msgstr "क्या आप अपने वॉलेट फ़ाइल में पासफ्रेज भंडारित करना चाहते हैं?" - -#~ msgid "Store" -#~ msgstr "भंडारित करें" - -#~ msgid "Do Not Store" -#~ msgstr "भंडारित न करें" - -#~ msgid "2048 (High Grade)" -#~ msgstr "2048 (उच्च ग्रेड)" - -#~ msgid "1024 (Medium Grade)" -#~ msgstr "1024 (मध्यम ग्रेड)" - -#~ msgid "768 (Low Grade)" -#~ msgstr "768 (निम्न ग्रेड)" - -#~ msgid "512 (Low Grade)" -#~ msgstr "512 (निम्न ग्रेड)" - -#~ msgid "No SSL support." -#~ msgstr "कोई एसएसएल समर्थन नहीं." - -#~ msgid "Certificate password" -#~ msgstr "प्रमाणपत्र पासवर्ड" - -#~ msgid "GMT" -#~ msgstr "जीएमटी" - -#~ msgid "KMailService" -#~ msgstr "के-मेल-सर्विस" - -#~ msgid "Mail service" -#~ msgstr "डाक सेवा" - -#~ msgid "Error connecting to server." -#~ msgstr "सर्वर से कनेक्शन में त्रुटि" - -#~ msgid "Not connected." -#~ msgstr "कनेक्टेड नहीं है" - -#~ msgid "Time out waiting for server interaction." -#~ msgstr "सर्वर इंटरेक्शन के इंतजार में टाइम आउट" - -#~ msgid "Server said: \"%1\"" -#~ msgstr "सर्वर कथन: \"%1\"" - -#~ msgid "KSendBugMail" -#~ msgstr "के-सेंड-बग-मेल" - -#~ msgid "(c) 2000 Stephan Kulow" -#~ msgstr "(c) 2000 स्टीफन कुलोव" - -#~ msgid "Stephan Kulow" -#~ msgstr "स्टीफन कुलोव" - -#~ msgid "Author" -#~ msgstr "लेखक" - -#~ msgid "Subject line" -#~ msgstr "विषय पंक्ति" - -#~ msgid "Recipient" -#~ msgstr "प्राप्तकर्ता" - -#~ msgid "telnet service" -#~ msgstr "टेलनेट सेवा" - -#~ msgid "telnet protocol handler" -#~ msgstr "टेलनेट प्रोटोकॉल हैंडलर" - -#~ msgid "Could not read %1" -#~ msgstr " %1 पढ़ नहीं सका" - -#~ msgid "Edit file type" -#~ msgstr "फ़ाइल क़िस्म संपादन करें" - -#, fuzzy -#~| msgid "You received a cookie from" -#~| msgid_plural "You received %1 cookies from" -#~ msgctxt "@label: multiple cookies" -#~ msgid "You received %1 cookies from" -#~ msgstr "आपको यहाँ से एक कुकी मिला" - -#, fuzzy -#~| msgid "You received a cookie from" -#~| msgid_plural "You received %1 cookies from" -#~ msgctxt "@label: single cookie" -#~ msgid "You received a cookie from" -#~ msgstr "आपको यहाँ से एक कुकी मिला" - -#~ msgid "The specified folder already exists." -#~ msgstr "उल्लेखित फ़ोल्डर पहले से ही मौज़ूद है. " - -#~ msgid "Retrieving from %1..." -#~ msgstr " %1 से फिर से प्राप्ति में..." - -#~ msgid "A newer item named '%1' already exists." -#~ msgstr "एक नई इकाई '%1' नाम से पहले ही मौज़ूद है. " - -#, fuzzy -#~| msgid "&Name:" -#~ msgid "TextLabel" -#~ msgstr "नाम: (&N)" - -#~ msgid "Requesting data to send" -#~ msgstr "डाटा भेजने के लिए निवेदन" - -#, fuzzy -#~| msgid "Size:" -#~ msgctxt "@label" -#~ msgid "Size:" -#~ msgstr "आकारः" - -#, fuzzy -#~| msgid "Type:" -#~ msgctxt "@label file type" -#~ msgid "Type:" -#~ msgstr "क़िस्मः" - -#, fuzzy -#~| msgid "Modified:" -#~ msgctxt "@label" -#~ msgid "Modified:" -#~ msgstr "परिवर्धितः" - -#, fuzzy -#~| msgid "Owner:" -#~ msgctxt "@label" -#~ msgid "Owner:" -#~ msgstr "मालिक:" - -#, fuzzy -#~| msgid "Permissions:" -#~ msgctxt "@label" -#~ msgid "Permissions:" -#~ msgstr "अनुमतियाँ:" - -#, fuzzy -#~| msgid "Type" -#~ msgctxt "@item::inlistbox" -#~ msgid "Type" -#~ msgstr "क़िस्म" - -#, fuzzy -#~| msgctxt "@title:column" -#~| msgid "Size" -#~ msgctxt "@item::inlistbox" -#~ msgid "Size" -#~ msgstr "आकार" - -#, fuzzy -#~| msgid "Modified:" -#~ msgctxt "@item::inlistbox" -#~ msgid "Modified" -#~ msgstr "परिवर्धितः" - -#, fuzzy -#~| msgid "Owner" -#~ msgctxt "@item::inlistbox" -#~ msgid "Owner" -#~ msgstr "मालिक" - -#, fuzzy -#~| msgctxt "@title:column" -#~| msgid "Permissions" -#~ msgctxt "@item::inlistbox" -#~ msgid "Permissions" -#~ msgstr "अनुमतियाँ" - -#~ msgid "Unmounted Icon" -#~ msgstr "अनमाउन्टेड प्रतीक" - -#, fuzzy -#~| msgid "" -#~| "This action would overwrite '%1' with itself.\n" -#~| "Please enter a new file name:" -#~ msgid "This action will overwrite '%1' with a newer file '%2'." -#~ msgstr "" -#~ "यह क्रिया, '%1' को अपने आपसे मिटाकर लिखेगा.\n" -#~ "कृपया एक नया फ़ाइल नाम भरें:" - -#, fuzzy -#~| msgid "" -#~| "This action would overwrite '%1' with itself.\n" -#~| "Please enter a new file name:" -#~ msgid "This action will overwrite '%1' with a file of the same age '%2'." -#~ msgstr "" -#~ "यह क्रिया, '%1' को अपने आपसे मिटाकर लिखेगा.\n" -#~ "कृपया एक नया फ़ाइल नाम भरें:" - -#~ msgctxt "Available space out of total partition size (percent used)" -#~ msgid "%1 out of %2 (%3% used)" -#~ msgstr "%2 में से %1 (%3% प्रयोग में)" - -#, fuzzy -#~| msgid "No Folders" -#~ msgctxt "@label" -#~ msgid "Folder" -#~ msgstr "कोई फ़ोल्डर नहीं." - -#, fuzzy -#~| msgid "%1 (%2)" -#~ msgid "size %1 (%2)" -#~ msgstr "%1 (%2)" - -#~ msgid "modified on %1" -#~ msgstr " %1 को परिवर्धित किया गया" - -#~ msgid "The source file is '%1'" -#~ msgstr "स्रोत फ़ाइल है- '%1'" - -#, fuzzy -#~| msgid "Move to Trash" -#~ msgctxt "@action:inmenu" -#~ msgid "Move to trash" -#~ msgstr "रद्दी पर ले जाएँ" - -#, fuzzy -#~| msgid "Do you really want to delete this item?" -#~| msgid_plural "Do you really want to delete these %1 items?" -#~ msgctxt "@info" -#~ msgid "Do you really want to empty the trash? All items will be deleted." -#~ msgstr "क्या आप सचमुच इस वस्तु को मिटाना चाहते हैं?" - -#, fuzzy -#~| msgid "Add..." -#~ msgctxt "@label" -#~ msgid "Add Tags..." -#~ msgstr "जोड़ें..." - -#, fuzzy -#~| msgid "Delete" -#~ msgctxt "@info" -#~ msgid "Delete tag" -#~ msgstr "मिटाएँ" - -#, fuzzy -#~| msgid "Delete" -#~ msgctxt "@title" -#~ msgid "Delete tag" -#~ msgstr "मिटाएँ" - -#, fuzzy -#~| msgid "Delete" -#~ msgctxt "@action:button" -#~ msgid "Delete" -#~ msgstr "मिटाएँ" - -#~ msgid "&Meta Info" -#~ msgstr "मेटा जानकारी (&M)" - -#~ msgid "&Auto Skip" -#~ msgstr "स्वचलित छोड़ें (&A)" - -#, fuzzy -#~| msgid "O&verwrite All" -#~ msgctxt "Write files into any existing directory" -#~ msgid "&Write Into All" -#~ msgstr "सभी मिटाकर लिखें (&v)" - -#, fuzzy -#~| msgid "O&verwrite All" -#~ msgid "&Overwrite All" -#~ msgstr "सभी मिटाकर लिखें (&v)" - -#~ msgid "R&esume All" -#~ msgstr "सभी पुनरारंभ (&e)" - -#~ msgid "Sends a short bug report to submit@bugs.kde.org" -#~ msgstr "submit@bugs.kde.org को एक छोटा बग रपट भेजता है" - -#~ msgid "&Edit '%1'..." -#~ msgstr "'%1' का संपादन करें...(&E)" - -#~ msgid "Unexpected end of data, some information may be lost." -#~ msgstr "डाटा का अप्रत्याशित अंत, कुछ जानकारियाँ गुम हो सकती हैं." - -#~ msgid "size %1" -#~ msgstr "आकार %1" - -#, fuzzy -#~| msgid "No Items" -#~ msgid "0 Items" -#~ msgstr "कोई वस्तु नहीं" - -#~ msgid "Add Bookmark" -#~ msgstr " पसंदीदा जोड़ें" - -#, fuzzy -#~| msgid " Do you want to retry?" -#~ msgid " Do you want to retry?" -#~ msgstr "क्या आप फिर से कोशिश करना चाहेंगे? " - -#~ msgid "Authentication" -#~ msgstr "प्रमाणीकरण" - -#~ msgid "Authentication needed for %1 but authentication is disabled." -#~ msgstr " %1 के लिए अनुमोदन आवश्यक है, पर अनुमोदन अक्षम किया हुआ है." - -#~ msgid "" -#~ "Unsupported method: authentication will fail. Please submit a bug report." -#~ msgstr "असमर्थित विधिः अनुमोदन सफल नहीं होगा. कृपया बग रपट भेजें." - -#~ msgid "One Item" -#~ msgid_plural "%1 Items" -#~ msgstr[0] "एक वस्तु" -#~ msgstr[1] "%1 वस्तुएँ" - -#~ msgid "No Files" -#~ msgstr "कोई फ़ाइलें नहीं" - -#~ msgid "One File" -#~ msgid_plural "%1 Files" -#~ msgstr[0] "एक फ़ाइल" -#~ msgstr[1] "%1 फ़ाइलें" - -#~ msgid "One Folder" -#~ msgid_plural "%1 Folders" -#~ msgstr[0] "एक फ़ोल्डर" -#~ msgstr[1] "%1 फ़ोल्डर" - -#~ msgid "(%1 Total)" -#~ msgstr "(%1 कुल)" - -#~ msgctxt "Items (Folders, Files), Size" -#~ msgid "%1 (%2, %3), %4" -#~ msgstr "%1 (%2, %3), %4" - -#, fuzzy -#~| msgid "Icon Source" -#~ msgid "Icon Size" -#~ msgstr "प्रतीक स्रोत" - -#~ msgid "" -#~ "%1\n" -#~ "does not appear to be a valid URL.\n" -#~ msgstr "" -#~ "%1\n" -#~ "प्रतीत होता है कि वैध यूआरएल नहीं है.\n" - -#~ msgid "Invalid URL" -#~ msgstr "अवैध यूआरएल" - -#~ msgid "" -#~ "The requested filenames\n" -#~ "%1\n" -#~ "do not appear to be valid;\n" -#~ "make sure every filename is enclosed in double quotes." -#~ msgstr "" -#~ "निवेदित फ़ाइल नाम\n" -#~ "%1\n" -#~ " वैध प्रतीत नहीं होते.\n" -#~ " सुनिश्चित हों कि प्रत्येक फ़ाइल नाम डबल कोट से बन्द हो." - -#~ msgid "Filename Error" -#~ msgstr "फ़ाइल नाम त्रुटि" - -#~ msgid "KDE Wallet Service" -#~ msgstr "केडीई बटुआ सेवा" - -#~ msgid "" -#~ "<qt>KDE has requested to open the wallet '<b>%1</b>'. Please enter the " -#~ "password for this wallet below.</qt>" -#~ msgstr "" -#~ "<qt>केडीई ने वॉलेट '<b>%1</b>' को खोलने के लिए निवेदन किया है. कृपया इस वॉलेट के " -#~ "लिए पासवर्ड भरें.</qt>" - -#~ msgid "" -#~ "<qt>The application '<b>%1</b>' has requested to open the wallet '<b>%2</" -#~ "b>'. Please enter the password for this wallet below.</qt>" -#~ msgstr "" -#~ "<qt>अनुप्रयोग '<b>%1</b>' ने वॉलेट '<b>%2</b>' को खोलने के लिए आवेदन किया है. इस " -#~ "वॉलेट के लिए नीचे पासवर्ड भरें.</qt>" - -#~ msgid "" -#~ "<qt>Error opening the wallet '<b>%1</b>'. Please try again.<br />(Error " -#~ "code %2: %3)</qt>" -#~ msgstr "" -#~ "<qt>वॉलेट '<b>%1</b>' को खोलने में त्रुटि. कृपया फिर कोशिश करें.<br />(त्रुटि कोड " -#~ "%2: %3)</qt>" - -#~ msgid "" -#~ "<qt>KDE has requested to create a new wallet named '<b>%1</b>'. Please " -#~ "choose a password for this wallet, or cancel to deny the application's " -#~ "request.</qt>" -#~ msgstr "" -#~ "<qt>केडीई ने '<b>%1</b>' नाम से एक नए वॉलेट बनाने के लिए निवेदन किया है. कृपया इस " -#~ "वॉलेट के लिए पासवर्ड चुनें या अनुप्रयोग के निवेदन को ठुकराने के लिए रद्द करें.</qt>" - -#~ msgid "" -#~ "<qt>The application '<b>%1</b>' has requested to create a new wallet " -#~ "named '<b>%2</b>'. Please choose a password for this wallet, or cancel to " -#~ "deny the application's request.</qt>" -#~ msgstr "" -#~ "<qt>अनुप्रयोग '<b>%1</b>' ने '<b>%2</b>' नाम से एक नया वॉलेट के लिए निवेदन किया " -#~ "है. कृपया इस वॉलेट के लिए पासवर्ड चुनें या अनुप्रयोग के निवेदन को नकारने के लिए रद्द करें." -#~ "</qt>" - -#~ msgid "<qt>KDE has requested access to the open wallet '<b>%1</b>'.</qt>" -#~ msgstr "<qt>केडीई ने वॉलेट '<b>%1</b>' को खोलने के लिए निवेदन किया है.</qt>" - -#~ msgid "" -#~ "<qt>The application '<b>%1</b>' has requested access to the open wallet " -#~ "'<b>%2</b>'.</qt>" -#~ msgstr "" -#~ "<qt>अनुप्रयोग '<b>%1</b>' ने वॉलेट '<b>%2</b>' को खोलने के लिए निवेदन किया है.</" -#~ "qt>" - -#~ msgid "" -#~ "Unable to open wallet. The wallet must be opened in order to change the " -#~ "password." -#~ msgstr "बटुआ खोलने में असफल. पासवर्ड बदलने के लिए बटुआ खोला जाना आवश्यक है." - -#~ msgid "<qt>Please choose a new password for the wallet '<b>%1</b>'.</qt>" -#~ msgstr "<qt>वॉलेट '<b>%1</b>' के लिए कृपया नया पासवर्ड चुनें.</qt>" - -#~ msgid "Error re-encrypting the wallet. Password was not changed." -#~ msgstr "बटुआ को फिर से एनक्रिप्ट करने में त्रुटि. पासवर्ड बदला नहीं गया." - -#~ msgid "Error reopening the wallet. Data may be lost." -#~ msgstr "बटुआ को फिर से खोलने में त्रुटि. डाटा गुम हो सकता है." - -#~ msgid "" -#~ "There have been repeated failed attempts to gain access to a wallet. An " -#~ "application may be misbehaving." -#~ msgstr "" -#~ "वहाँ पर वॉलेट पर पहुँचने की बारंबार असफल कोशिश की गई. कोई अनुप्रयोग खराब व्यवहार " -#~ "कर रहा होगा." - -#~ msgid "<qt>Password is empty. <b>(WARNING: Insecure)</b></qt>" -#~ msgstr "<qt>पासवर्ड रिक्त है. <b>(चेतावनी: असुरक्षित)</b></qt>" - -#~ msgid "Passwords match." -#~ msgstr "पासवर्ड के जोड़ मिलते हैं." - -#~ msgid "Passwords do not match." -#~ msgstr "पासवर्ड के जोड़ नहीं मिलते." - -#~ msgid "<u>KWallet</u> - The KDE Wallet System" -#~ msgstr "<u>केवॉलेट</u> - केडीई बटुआ तंत्र" - -#~ msgid "&Basic setup (recommended)" -#~ msgstr "मूल व्यवस्था (अनुशंसित) (&B)" - -#~ msgid "&Advanced setup" -#~ msgstr "विस्तृत व्यवस्था (&A)" - -#~ msgid "Yes, I wish to use the KDE wallet to store my personal information." -#~ msgstr "" -#~ "हाँ, मैं केडीई वॉलेट को मेरी निजी जानकारी भंडारित करने के लिए उपयोग करना चाहता हूँ." - -#~ msgid "Enter a new password:" -#~ msgstr "एक नया पासवर्ड भरें:" - -#~ msgid "Verify password:" -#~ msgstr "पासवर्ड सत्यापित करें:" - -#~ msgid "Automatically close idle wallets" -#~ msgstr "निष्क्रिय बटुआ स्वचलित बन्द करें" - -#~ msgid "Store network passwords and local passwords in separate wallet files" -#~ msgstr "नेटवर्क पासवर्ड्स तथा स्थानीय पासवर्ड्स अलग बटुआ फ़ाइल में भंडारित करें" - -#~ msgid "Allow &Once" -#~ msgstr "एक बार स्वीकारें (&O)" - -#~ msgid "Allow &Always" -#~ msgstr "हमेशा स्वीकारें (&A)" - -#~ msgid "&Deny" -#~ msgstr "नकारें (&D)" - -#~ msgid "Deny &Forever" -#~ msgstr "नकारें सर्वदा (&F)" - -#~ msgid "Locality:" -#~ msgstr "जगह:" - -#~ msgctxt "Federal State" -#~ msgid "State:" -#~ msgstr "स्थिति:" - -#~ msgid "Email:" -#~ msgstr "ईमेलः" - -#, fuzzy -#~| msgctxt "%1: code, %2: request type" -#~| msgid "An unexpected error (%1) occurred while attempting to %2." -#~ msgctxt "%1: code, %2: request type" -#~ msgid "An unexpected error (%1) occurredwhile attempting to %2." -#~ msgstr " एक त्रुटि %1 हुई, %2 की कोशिश में" - -#, fuzzy -#~| msgid "Parent Folder" -#~ msgctxt "@info:tooltip" -#~ msgid "Parent Folder" -#~ msgstr "पेरेन्ट फ़ोल्डर " - -#~ msgid "Free disk space:" -#~ msgstr "डिस्क में खाली जगहः" - -#~ msgid "Add a bookmark for the current document" -#~ msgstr "मौज़ूदा दस्तावेज़ में एक पसंदीदा जोड़ें" - -#~ msgctxt "Items in a folder" -#~ msgid "? items" -#~ msgstr "? वस्तुएँ" - -#~ msgid "Please specify the filename to save to." -#~ msgstr "सहेजने के लिए कृपया फ़ाइल नाम उल्लेखित करें." - -#~ msgid "Please select the file to open." -#~ msgstr "फ़ाइल खोलने के लिए कृपया चुनें." - -#~ msgid "Certificate signing authority is unknown or invalid." -#~ msgstr "प्रमाणपत्र हस्ताक्षर करने वाला अधिकारी अज्ञात है या अवैध है." - -#~ msgid "Certificate is self-signed and thus may not be trustworthy." -#~ msgstr "प्रमाणपत्र स्व-हस्ताक्षरित है अतः शायद विश्वासयोग्य न हो." - -#~ msgid "Signature is untrusted." -#~ msgstr "हस्ताक्षर अविश्वसनीय है." - -#~ msgid "Signature test failed." -#~ msgstr "हस्ताक्षर परीक्षण असफल" - -#~ msgid "Rejected, possibly due to an invalid purpose." -#~ msgstr "अस्वीकृत, संभवतः अवैध प्रयोजन के कारण." - -#, fuzzy -#~| msgid "Common name:" -#~ msgid "Common Name:" -#~ msgstr "सामान्य नामः" - -#~ msgid "A&ssociation" -#~ msgstr "सम्बद्धता (&s)" - -#~ msgid "Pattern ( example: *.html;*.htm )" -#~ msgstr "पैटर्न ( उदाहरण: *.html;*.htm )" - -#~ msgid "Left click previews" -#~ msgstr "बायाँ क्लिक पूर्वावलोकन" - -#~ msgid "Co&nnect" -#~ msgstr "कनेक्ट (&n)" - -#~ msgid "C&ryptography Configuration..." -#~ msgstr "क्रिप्टोग्राफी कॉन्फ़िगरेशन (&r)" - -#~ msgid "Chain:" -#~ msgstr "कड़ियाँ:" - -#~ msgid "0 - Site Certificate" -#~ msgstr "0 - साइट प्रमाण पत्र" - -#~ msgid "Peer certificate:" -#~ msgstr "पीअर प्रमाणपत्र:" - -#~ msgid "Certificate state:" -#~ msgstr "प्रमाणपत्र स्थितिः" - -#~ msgid "Valid until:" -#~ msgstr "तब तक वैध:" - -#~ msgid "Cipher in use:" -#~ msgstr "साइफर उपयोग में:" - -#~ msgid "Cipher strength:" -#~ msgstr "साइफर सामर्थ्य:" - -#~ msgid "Connecting to %1..." -#~ msgstr " %1 से जुड़ रहे..." - -#~ msgid "Proxy %1 at port %2" -#~ msgstr "प्रॉक्सी%1 पोर्ट %2 पर" - -#~ msgid "%1 (port %2)" -#~ msgstr "%1 (पोर्ट %2)" - -#~ msgid "Ok" -#~ msgstr "ठीक" - -#~ msgid "Unknown View" -#~ msgstr "अज्ञात दृश्य" diff -Nru kde-l10n-hi-4.12.97/messages/frameworks/kio_help4.po kde-l10n-hi-4.13.0/messages/frameworks/kio_help4.po --- kde-l10n-hi-4.12.97/messages/frameworks/kio_help4.po 2014-02-14 06:09:21.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/frameworks/kio_help4.po 1970-01-01 00:00:00.000000000 +0000 @@ -1,112 +0,0 @@ -# translation of kio_help4.po to Hindi -# Copyright (C) YEAR This_file_is_part_of_KDE -# This file is distributed under the same license as the PACKAGE package. -# -# Ravishankar Shrivastava <raviratlami@aol.in>, 2008. -msgid "" -msgstr "" -"Project-Id-Version: kio_help4\n" -"Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-02-14 03:22+0000\n" -"PO-Revision-Date: 2008-07-09 10:53+0530\n" -"Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" -"Language-Team: Hindi <Indlinux-hindi@lists.sourceforge.net>\n" -"Language: hi\n" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" -"X-Generator: KBabel 1.11.4\n" -"Plural-Forms: nplurals=2; plural=(n!=1);\n" - -#: xslt.cpp:140 -msgid "Parsing stylesheet" -msgstr "स्टाइलशीट पार्स किया जा रहा है" - -#: xslt.cpp:164 -msgid "Parsing document" -msgstr "दस्तावेज़ पार्स किया जा रहा है" - -#: xslt.cpp:174 -msgid "Applying stylesheet" -msgstr "स्टाइलशीट लागू किया जा रहा है" - -#: xslt.cpp:182 -msgid "Writing document" -msgstr "दस्तावेज़ को लिखा जा रहा है" - -#~ msgctxt "NAME OF TRANSLATORS" -#~ msgid "Your names" -#~ msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर" - -#~ msgctxt "EMAIL OF TRANSLATORS" -#~ msgid "Your emails" -#~ msgstr "raviratlami@aol.in," - -#~ msgid "Output file" -#~ msgstr "आउटपुट फ़ाइल" - -#~ msgid "genshortcutents" -#~ msgstr "जेनशॉर्टकटएन्ट्स" - -#~ msgid "Generates DocBook entities for key shortcuts of standard actions" -#~ msgstr "मानक क्रियाओं के कुंजी शॉर्टकट के लिए डॉकबुक एंटिटीज बनाता है" - -#~ msgid "There is no documentation available for %1." -#~ msgstr "%1 के लिए कोई दस्तावेज़ उपलब्ध नहीं हैं." - -#~ msgid "Looking up correct file" -#~ msgstr "सही फ़ाइल को देखा जा रहा है" - -#~ msgid "Preparing document" -#~ msgstr "दस्तावेज़ बनाया जा रहा है" - -#~ msgid "The requested help file could not be parsed:<br />%1" -#~ msgstr "निवेदित मदद फ़ाइल को समझा नहीं जा सका:<br />%1" - -#~ msgid "Saving to cache" -#~ msgstr "कैच पर सहेजा जा रहा है" - -#~ msgid "Using cached version" -#~ msgstr "कैच्ड संस्करण इस्तेमाल किया जा रहा है" - -#~ msgid "Looking up section" -#~ msgstr "सेक्शन को देखा जा रहा है" - -#~ msgid "Could not find filename %1 in %2." -#~ msgstr "फ़ाइलनाम %1 को %2 में ढूंढ नहीं पाया." - -#~ msgid "Stylesheet to use" -#~ msgstr "इस्तेमाल में स्टाइलशीट" - -#~ msgid "Output whole document to stdout" -#~ msgstr "सम्पूर्ण दस्तावेज़ स्टडआउट में आउटपुट करें" - -#~ msgid "Output whole document to file" -#~ msgstr "सम्पूर्ण दस्तावेज़ फ़ाइल में आउटपुट करें" - -#~ msgid "Create a ht://dig compatible index" -#~ msgstr "ht://dig कम्पेटिबल अनुक्रमणिका बनाएँ" - -#~ msgid "Check the document for validity" -#~ msgstr "दस्तावेज़ को वेलिडिटी के लिए जाँचें" - -#~ msgid "Create a cache file for the document" -#~ msgstr "दस्तावेज़ के लिए एक कैच फ़ाइल बनाएँ" - -#~ msgid "Set the srcdir, for kdelibs" -#~ msgstr "केडीईलिब्स के लिए srcdir सेट करें" - -#~ msgid "Parameters to pass to the stylesheet" -#~ msgstr "स्टाइल शीट को पास किए जाने वाले पैरामीटर" - -#~ msgid "The file to transform" -#~ msgstr "रूपांतरण हेतु फ़ाइल" - -#~ msgid "XML-Translator" -#~ msgstr "एक्सएमएल-अनुवादक" - -#~ msgid "KDE Translator for XML" -#~ msgstr "एक्सएमएल के लिए केडीई अनुवादक" - -#~ msgid "Could not write to cache file %1." -#~ msgstr "कैच फ़ाइल %1 पर लिख नहीं सका." diff -Nru kde-l10n-hi-4.12.97/messages/frameworks/ktexteditor5.po kde-l10n-hi-4.13.0/messages/frameworks/ktexteditor5.po --- kde-l10n-hi-4.12.97/messages/frameworks/ktexteditor5.po 2014-03-26 03:45:43.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/frameworks/ktexteditor5.po 1970-01-01 00:00:00.000000000 +0000 @@ -1,10685 +0,0 @@ -# translation of katepart.po to Hindi -# Copyright (C) 2004 Free Software Foundation, Inc. -# G Karunakar <karunakar@freedomink.org>, 2004. -# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2004. -# Ravishankar Shrivastava <raviratlami@gmail.com>, 2004. -# -msgid "" -msgstr "" -"Project-Id-Version: katepart\n" -"Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-26 01:43+0000\n" -"PO-Revision-Date: 2007-09-13 11:39+0530\n" -"Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" -"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" -"Language: hi\n" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" -"X-Generator: KBabel 1.3.1\n" -"Plural-Forms: nplurals=2; plural=(n!=1);\n" - -#: completion/katecompletionconfig.cpp:42 -msgid "Code Completion Configuration" -msgstr "कोड पूर्णता कॉन्फ़िगुरेशन" - -#: completion/katecompletionconfig.cpp:116 -#: completion/katecompletionconfig.cpp:145 -msgid "Always" -msgstr "हमेशा" - -#: completion/katecompletionmodel.cpp:172 -msgid "Argument-hints" -msgstr "आर्गुमेंट-हिंट्स" - -#: completion/katecompletionmodel.cpp:173 -msgid "Best matches" -msgstr "सर्वोत्तम मिलान" - -#: completion/katecompletionmodel.cpp:812 -msgid "Namespaces" -msgstr "नेम-स्पेसेज़" - -#: completion/katecompletionmodel.cpp:814 -msgid "Classes" -msgstr "वर्ग" - -#: completion/katecompletionmodel.cpp:816 -msgid "Structs" -msgstr "सट्रक्ट" - -#: completion/katecompletionmodel.cpp:818 -msgid "Unions" -msgstr "संघ" - -#: completion/katecompletionmodel.cpp:820 -msgid "Functions" -msgstr "फंक्शन्स" - -#: completion/katecompletionmodel.cpp:822 -msgid "Variables" -msgstr "वेरिएबल्स" - -#: completion/katecompletionmodel.cpp:824 -msgid "Enumerations" -msgstr "एनुमरेशन" - -#: completion/katecompletionmodel.cpp:1328 -msgid "Prefix" -msgstr "उपसर्ग" - -#: completion/katecompletionmodel.cpp:1330 -msgid "Icon" -msgstr "प्रतीक" - -#: completion/katecompletionmodel.cpp:1332 -msgid "Scope" -msgstr "स्कोप" - -#. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) -#: completion/katecompletionmodel.cpp:1334 -#: dialogs/commandmenuconfigwidget.ui:22 dialogs/katedialogs.cpp:1076 -msgid "Name" -msgstr "नाम " - -#: completion/katecompletionmodel.cpp:1336 -msgid "Arguments" -msgstr "आर्गुमेंट्स" - -#: completion/katecompletionmodel.cpp:1338 -msgid "Postfix" -msgstr "पोस्टफिक्स" - -#: completion/katecompletionmodel.cpp:2043 -msgid "Public" -msgstr "सार्वजनिक" - -#: completion/katecompletionmodel.cpp:2046 -msgid "Protected" -msgstr "सुरक्षित" - -#: completion/katecompletionmodel.cpp:2049 -msgid "Private" -msgstr "निजी " - -#: completion/katecompletionmodel.cpp:2052 -msgid "Static" -msgstr "स्थैतिक" - -#: completion/katecompletionmodel.cpp:2055 -msgid "Constant" -msgstr "स्थिर" - -#: completion/katecompletionmodel.cpp:2058 -msgid "Namespace" -msgstr "नेमस्पेस" - -#: completion/katecompletionmodel.cpp:2061 -msgid "Class" -msgstr "वर्ग" - -#: completion/katecompletionmodel.cpp:2064 -msgid "Struct" -msgstr "सट्रक्ट" - -#: completion/katecompletionmodel.cpp:2067 -msgid "Union" -msgstr "संघ" - -#: completion/katecompletionmodel.cpp:2070 -msgid "Function" -msgstr "फंक्शन" - -#: completion/katecompletionmodel.cpp:2073 -msgid "Variable" -msgstr "परिवर्तनीय" - -#: completion/katecompletionmodel.cpp:2076 -msgid "Enumeration" -msgstr "एनुमरेशन" - -#: completion/katecompletionmodel.cpp:2079 -msgid "Template" -msgstr "टैम्प्लेट" - -#: completion/katecompletionmodel.cpp:2082 -msgid "Virtual" -msgstr "आभासी" - -#: completion/katecompletionmodel.cpp:2085 -msgid "Override" -msgstr "ओवरराइड" - -#: completion/katecompletionmodel.cpp:2088 -msgid "Inline" -msgstr "इनलाइन" - -#: completion/katecompletionmodel.cpp:2091 -msgid "Friend" -msgstr "मित्र" - -#: completion/katecompletionmodel.cpp:2094 -msgid "Signal" -msgstr "सिग्नल" - -#: completion/katecompletionmodel.cpp:2097 -msgid "Slot" -msgstr "स्लॉट" - -#: completion/katecompletionmodel.cpp:2100 -msgid "Local Scope" -msgstr "स्थानीय स्कोप" - -#: completion/katecompletionmodel.cpp:2103 -msgid "Namespace Scope" -msgstr "नेमस्पेस स्कोप" - -#: completion/katecompletionmodel.cpp:2106 -msgid "Global Scope" -msgstr "वैश्विक स्कोप" - -#: completion/katecompletionmodel.cpp:2109 -msgid "Unknown Property" -msgstr "अज्ञात प्रापर्टी" - -#. i18n: ectx: property (title), widget (QGroupBox, gbWordCompletion) -#: completion/katewordcompletion.cpp:91 dialogs/completionconfigtab.ui:28 -#, fuzzy -#| msgid "Word Completion" -msgid "Auto Word Completion" -msgstr "शब्द पूर्णता" - -#: completion/katewordcompletion.cpp:340 -#, fuzzy -msgid "Shell Completion" -msgstr "चयन" - -#: completion/katewordcompletion.cpp:345 -#, fuzzy -msgid "Reuse Word Above" -msgstr "रीयूज़ वर्ड अहेड" - -#: completion/katewordcompletion.cpp:350 -#, fuzzy -msgid "Reuse Word Below" -msgstr "रीयूज़ वर्ड बिहाइन्ड" - -#. i18n: ectx: Menu (file) -#: data/katepartui.rc:4 -msgid "&File" -msgstr "फ़ाइल (&F)" - -#. i18n: ectx: Menu (edit) -#: data/katepartui.rc:16 -msgid "&Edit" -msgstr "संपादन (&E)" - -#. i18n: ectx: Menu (edit_find_menu) -#: data/katepartui.rc:35 -msgid "Find Variants" -msgstr "" - -#. i18n: ectx: Menu (edit_goto) -#: data/katepartui.rc:43 -msgid "Go To" -msgstr "" - -#. i18n: ectx: Menu (view) -#: data/katepartui.rc:54 -msgid "&View" -msgstr "दृश्य (&V)" - -#. i18n: ectx: Menu (codefolding) -#: data/katepartui.rc:72 -msgid "&Code Folding" -msgstr "कोड फोल्डिंग (&C)" - -#. i18n: ectx: Menu (tools) -#: data/katepartui.rc:95 -msgid "&Tools" -msgstr "औज़ार (&T)" - -#. i18n: ectx: Menu (wordcompletion) -#: data/katepartui.rc:108 -msgid "Word Completion" -msgstr "शब्द पूर्णता" - -#. i18n: ectx: Menu (spelling) -#: data/katepartui.rc:114 spellcheck/spellingmenu.cpp:97 -msgid "Spelling" -msgstr "वर्तनी" - -#. i18n: ectx: Menu (settings) -#: data/katepartui.rc:137 -msgid "&Settings" -msgstr "विन्यास (&S)" - -#. i18n: ectx: ToolBar (mainToolBar) -#: data/katepartui.rc:159 -msgid "Main Toolbar" -msgstr "मुख्य औज़ार पट्टी" - -#. i18n: ectx: property (title), widget (QGroupBox, gbBorders) -#: dialogs/bordersappearanceconfigwidget.ui:9 dialogs/katedialogs.cpp:652 -msgid "Borders" -msgstr "किनारा" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkShowFoldingMarkers) -#: dialogs/bordersappearanceconfigwidget.ui:15 -#, fuzzy -#| msgid "" -#| "If this option is checked, every new view will display marks for code " -#| "folding, if code folding is available." -msgid "" -"If this option is checked, every new view will display marks for folding." -msgstr "" -"यदि यह विकल्प चुना जाता है, हर नया दृश्य कोड फोल्डिंग के मार्क्स दिखाएगा, यदि कोड " -"फोल्डिंग उपलब्ध है." - -#. i18n: ectx: property (text), widget (QCheckBox, chkShowFoldingMarkers) -#: dialogs/bordersappearanceconfigwidget.ui:18 -#, fuzzy -#| msgid "Show Folding &Markers" -msgid "Show &folding markers" -msgstr "फोल्डिंग निशान दिखाएँ (यदि लागू हो) (&M)" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkIconBorder) -#: dialogs/bordersappearanceconfigwidget.ui:25 -#, fuzzy -msgid "" -"<p>If this option is checked, every new view will display an icon border on " -"the left hand side.</p><p>The icon border shows bookmark signs, for instance." -"</p>" -msgstr "" -"यदि यह विकल्प चुना जाता है, हर नया दृश्य बाएं हाथ की ओर एक प्रतीक किनारा दिखाएगा." -"<br><br>उदारहण के लिए, प्रतीक किनारा पसंद निशान दिखाता है" - -#. i18n: ectx: property (text), widget (QCheckBox, chkIconBorder) -#: dialogs/bordersappearanceconfigwidget.ui:28 -msgid "Show &icon border" -msgstr "प्रतीक किनारा दिखाएँ (&i)" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkLineNumbers) -#: dialogs/bordersappearanceconfigwidget.ui:35 -msgid "" -"If this option is checked, every new view will display line numbers on the " -"left hand side." -msgstr "यदि यह विकल्प चुना जाता है, हर नया दृश्य बाएँ हाथ तरफ पंक्ति क्रमांक दिखाएगा." - -#. i18n: ectx: property (text), widget (QCheckBox, chkLineNumbers) -#: dialogs/bordersappearanceconfigwidget.ui:38 -msgid "Show &line numbers" -msgstr "पंक्ति क्रमांक दिखाएँ (&l)" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkShowLineModification) -#: dialogs/bordersappearanceconfigwidget.ui:45 -#, fuzzy -#| msgid "" -#| "If this option is checked, every new view will display line numbers on " -#| "the left hand side." -msgid "" -"If this option is checked, a small indicator for modified and saved lines is " -"shown on the left hand side." -msgstr "यदि यह विकल्प चुना जाता है, हर नया दृश्य बाएँ हाथ तरफ पंक्ति क्रमांक दिखाएगा." - -#. i18n: ectx: property (text), widget (QCheckBox, chkShowLineModification) -#: dialogs/bordersappearanceconfigwidget.ui:48 -#, fuzzy -#| msgid "Show Folding &Markers" -msgid "Show line modification markers" -msgstr "फोल्डिंग निशान दिखाएँ (यदि लागू हो) (&M)" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkScrollbarMarks) -#: dialogs/bordersappearanceconfigwidget.ui:55 -#, fuzzy -msgid "" -"<p>If this option is checked, every new view will show marks on the vertical " -"scrollbar.</p><p>These marks will show bookmarks, for instance.</p>" -msgstr "" -"यदि यह विकल्प चुना जाता है, हर नया दृश्य बाएं हाथ की ओर एक प्रतीक किनारा दिखाएगा." -"<br><br>उदारहण के लिए, प्रतीक किनारा पसंद निशान दिखाता है" - -#. i18n: ectx: property (text), widget (QCheckBox, chkScrollbarMarks) -#: dialogs/bordersappearanceconfigwidget.ui:58 -msgid "Show &scrollbar marks" -msgstr "स्क्रॉल पट्टी चिह्न दिखाएँ (&s)" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkScrollbarMiniMap) -#: dialogs/bordersappearanceconfigwidget.ui:65 -#, fuzzy -#| msgid "" -#| "If this option is checked, every new view will display line numbers on " -#| "the left hand side." -msgid "" -"If this option is checked, every new view will show a mini map on the " -"vertical scrollbar." -msgstr "यदि यह विकल्प चुना जाता है, हर नया दृश्य बाएँ हाथ तरफ पंक्ति क्रमांक दिखाएगा." - -#. i18n: ectx: property (text), widget (QCheckBox, chkScrollbarMiniMap) -#: dialogs/bordersappearanceconfigwidget.ui:68 -#, fuzzy -#| msgid "Show &scrollbar marks" -msgid "Show scrollbar mini-map" -msgstr "स्क्रॉल पट्टी चिह्न दिखाएँ (&s)" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkScrollbarMiniMapAll) -#: dialogs/bordersappearanceconfigwidget.ui:84 -#, fuzzy -#| msgid "" -#| "If this option is checked, every new view will display line numbers on " -#| "the left hand side." -msgid "" -"If this option is checked, every new view will show a mini map of the whole " -"document on the vertical scrollbar." -msgstr "यदि यह विकल्प चुना जाता है, हर नया दृश्य बाएँ हाथ तरफ पंक्ति क्रमांक दिखाएगा." - -#. i18n: ectx: property (text), widget (QCheckBox, chkScrollbarMiniMapAll) -#: dialogs/bordersappearanceconfigwidget.ui:87 -#, fuzzy -#| msgid "Save the current document" -msgid "Map the whole document" -msgstr "मौज़ूदा दस्तावेज़ सहेजें" - -#. i18n: ectx: property (text), widget (QLabel, labelMiniMapWidth) -#: dialogs/bordersappearanceconfigwidget.ui:97 -#, fuzzy -#| msgid "&Minimal matching" -msgid "Minimap Width" -msgstr "न्यूनतम जोड़ मिलाएँ (&M)" - -#. i18n: ectx: property (text), widget (QLabel, lblShowScrollbars) -#: dialogs/bordersappearanceconfigwidget.ui:157 -msgid "Scrollbars visibility:" -msgstr "" - -#. i18n: ectx: property (text), item, widget (QComboBox, cmbShowScrollbars) -#: dialogs/bordersappearanceconfigwidget.ui:168 dialogs/katedialogs.cpp:656 -msgid "Always On" -msgstr "हमेशा चालू" - -#. i18n: ectx: property (text), item, widget (QComboBox, cmbShowScrollbars) -#: dialogs/bordersappearanceconfigwidget.ui:173 -msgid "Show When Needed" -msgstr "" - -#. i18n: ectx: property (text), item, widget (QComboBox, cmbShowScrollbars) -#: dialogs/bordersappearanceconfigwidget.ui:178 -#, fuzzy -#| msgid "Always" -msgid "Always Off" -msgstr "हमेशा" - -#. i18n: ectx: property (whatsThis), widget (QGroupBox, gbSortBookmarks) -#: dialogs/bordersappearanceconfigwidget.ui:191 -msgid "" -"Choose how the bookmarks should be ordered in the <b>Bookmarks</b> menu." -msgstr "चुनें कि पसंदीदा किस क्रम में <b> पसंदीदा </b> मेन्यू में हों." - -#. i18n: ectx: property (title), widget (QGroupBox, gbSortBookmarks) -#: dialogs/bordersappearanceconfigwidget.ui:194 -msgid "Sort Bookmarks Menu" -msgstr " पसंदीदा मेन्यू क्रमबद्ध करें" - -#. i18n: ectx: property (whatsThis), widget (QRadioButton, rbSortBookmarksByCreation) -#: dialogs/bordersappearanceconfigwidget.ui:200 -msgid "" -"Each new bookmark will be added to the bottom, independently from where it " -"is placed in the document." -msgstr "" -"हर नए पसंदीदा तल पर जोड़े जाएंगे, इस बात से स्वतन्त्र कि वे दस्तावेज़ में कहाँ पर रखे जा रहे " -"हैं." - -#. i18n: ectx: property (text), widget (QRadioButton, rbSortBookmarksByCreation) -#: dialogs/bordersappearanceconfigwidget.ui:203 -msgid "By c&reation" -msgstr "रचना द्वारा (&r)" - -#. i18n: ectx: property (whatsThis), widget (QRadioButton, rbSortBookmarksByPosition) -#: dialogs/bordersappearanceconfigwidget.ui:210 -msgid "The bookmarks will be ordered by the line numbers they are placed at." -msgstr "पंक्ति क्रमांक के अनुसार जैसे रखे गए हैं, पसंदीदा उस क्रम में होंगे." - -#. i18n: ectx: property (text), widget (QRadioButton, rbSortBookmarksByPosition) -#: dialogs/bordersappearanceconfigwidget.ui:213 -msgid "By &position" -msgstr "स्थिति द्वारा (&p)" - -#. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) -#. i18n: ectx: property (text), widget (QTableWidget, tblNormalModeMappings) -#. i18n: ectx: property (text), widget (QTableWidget, tblInsertModeMappings) -#. i18n: ectx: property (text), widget (QTableWidget, tblVisualModeMappings) -#: dialogs/commandmenuconfigwidget.ui:27 vimode/viinputmodeconfigwidget.ui:95 -#: vimode/viinputmodeconfigwidget.ui:133 vimode/viinputmodeconfigwidget.ui:171 -msgid "Command" -msgstr "कमांड" - -#. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) -#: dialogs/commandmenuconfigwidget.ui:32 -msgid "Description" -msgstr "वर्णन" - -#. i18n: ectx: property (text), widget (QPushButton, btnEditEntry) -#: dialogs/commandmenuconfigwidget.ui:48 -#, fuzzy -#| msgid "Edit entry..." -msgid "Edit Entry..." -msgstr "प्रविष्टि का संपादन करें..." - -#. i18n: ectx: property (text), widget (QPushButton, btnRemoveEntry) -#: dialogs/commandmenuconfigwidget.ui:58 -#, fuzzy -#| msgid "Remove entry" -msgid "Remove Entry" -msgstr "प्रविष्टि मिटाएँ" - -#. i18n: ectx: property (text), widget (QPushButton, btnAddEntry) -#: dialogs/commandmenuconfigwidget.ui:78 -#, fuzzy -#| msgid "Add entry..." -msgid "Add Entry..." -msgstr "प्रविष्टि जोड़ें..." - -#. i18n: ectx: property (title), widget (QGroupBox, gbNotes) -#: dialogs/commandmenuconfigwidget.ui:93 -msgid "Further Notes" -msgstr "आगे की टिप्पणियाँ" - -#. i18n: ectx: property (text), widget (QLabel, lblNotes) -#: dialogs/commandmenuconfigwidget.ui:108 -msgid "" -"<p>The entries are accessible through the submenu <b>Commands</b> in the " -"<b>Tools</b> menu. For faster access it is possible to assign <b>shortcuts</" -"b> in the shortcut configuration page after applying the changes.</p>" -msgstr "" - -#. i18n: ectx: property (title), widget (QGroupBox, gbEdit) -#: dialogs/commandmenueditwidget.ui:12 -msgid "Edit Command" -msgstr "कमांड का संपादन करें" - -#. i18n: ectx: property (text), widget (QLabel, lblCommand) -#: dialogs/commandmenueditwidget.ui:26 -msgid "&Associated command:" -msgstr "सम्बद्ध कमांडः (&A)" - -#. i18n: ectx: property (text), widget (QLabel, lblName) -#: dialogs/commandmenueditwidget.ui:69 dialogs/filetypeconfigwidget.ui:72 -msgid "&Name:" -msgstr "नाम: (&N)" - -#. i18n: ectx: property (toolTip), widget (KIconButton, btnIcon) -#: dialogs/commandmenueditwidget.ui:87 -msgid "Choose an icon." -msgstr "एक प्रतीक चुनें." - -#. i18n: ectx: property (whatsThis), widget (KIconButton, btnIcon) -#: dialogs/commandmenueditwidget.ui:90 -#, fuzzy -msgid "<p>This icon will be displayed in the menu and toolbar.</p>" -msgstr "" -"डेस्कटॉप मेनू और उपकरण-पटिया प्रेफरेंसेज़ के हिसाब से उपकरण-पटिया के बटन स्टाइल ल सेट कर लेव" - -#. i18n: ectx: property (text), widget (QLabel, lblDescription) -#: dialogs/commandmenueditwidget.ui:102 -msgid "&Description:" -msgstr "वर्णनः (&D)" - -#. i18n: ectx: property (text), widget (QLabel, lblCategory) -#: dialogs/commandmenueditwidget.ui:115 -msgid "&Category:" -msgstr "वर्ग: (&C)" - -#. i18n: ectx: property (title), widget (QGroupBox, gbGeneral) -#. i18n: ectx: property (title), widget (QGroupBox, gbViInputMode) -#: dialogs/completionconfigtab.ui:12 dialogs/katedialogs.cpp:518 -#: dialogs/katedialogs.cpp:648 dialogs/katedialogs.cpp:835 -#: vimode/viinputmodeconfigwidget.ui:29 -msgid "General" -msgstr "सामान्य" - -#. i18n: ectx: property (text), widget (QCheckBox, chkAutoCompletionEnabled) -#: dialogs/completionconfigtab.ui:18 -#, fuzzy -#| msgid "Word Completion" -msgid "Enable &auto completion" -msgstr "शब्द पूर्णता" - -#. i18n: ectx: property (text), widget (QLabel, label) -#: dialogs/completionconfigtab.ui:42 -msgid "Minimal word length to complete:" -msgstr "" - -#. i18n: ectx: property (toolTip), widget (QCheckBox, removeTail) -#: dialogs/completionconfigtab.ui:67 -msgid "Remove tail of a previous word when completion item chosen from a list" -msgstr "" - -#. i18n: ectx: property (text), widget (QCheckBox, removeTail) -#: dialogs/completionconfigtab.ui:70 -#, fuzzy -#| msgid "Re&move trailing spaces" -msgid "Remove tail on complete" -msgstr "ट्रेलिंग स्पेसेस हटाएँ (&m)" - -#. i18n: ectx: property (title), widget (QGroupBox, sorting) -#: dialogs/completionconfigwidget.ui:17 -msgid "Sorting" -msgstr "क्रमबद्ध करने में" - -#. i18n: ectx: property (text), widget (QCheckBox, sortingAlphabetical) -#: dialogs/completionconfigwidget.ui:37 -msgid "Alphabetical" -msgstr "अकारादि" - -#. i18n: ectx: property (text), widget (QCheckBox, sortingReverse) -#: dialogs/completionconfigwidget.ui:44 -msgid "Reverse" -msgstr "विपरीत" - -#. i18n: ectx: property (text), widget (QCheckBox, sortingCaseSensitive) -#: dialogs/completionconfigwidget.ui:51 -#, fuzzy -#| msgid "Case &sensitive" -msgid "Case sensitive" -msgstr "केस सेंसिटिव (&s)" - -#. i18n: ectx: property (text), widget (QCheckBox, sortingInheritanceDepth) -#: dialogs/completionconfigwidget.ui:58 -#, fuzzy -#| msgid "Inheritance Depth" -msgid "Inheritance depth" -msgstr "इनहेरिटेंस गहराई" - -#. i18n: ectx: property (text), widget (QLabel, label_2) -#: dialogs/completionconfigwidget.ui:85 -#, fuzzy -msgid "Order of Groupings (select a grouping method to configure):" -msgstr "मल्टीडिस्क उपकरणों को कॉन्फ़िगर करने हेतु प्रस्तावित क्रियाओं में से एक चुनें." - -#. i18n: ectx: property (text), widget (QToolButton, groupingOrderUp) -#. i18n: ectx: property (text), widget (QToolButton, groupingUp) -#. i18n: ectx: property (text), widget (QToolButton, columnUp) -#: dialogs/completionconfigwidget.ui:105 dialogs/completionconfigwidget.ui:242 -#: dialogs/completionconfigwidget.ui:414 -msgid "^" -msgstr "^" - -#. i18n: ectx: property (text), widget (QToolButton, groupingOrderDown) -#. i18n: ectx: property (text), widget (QToolButton, groupingDown) -#. i18n: ectx: property (text), widget (QToolButton, columnDown) -#: dialogs/completionconfigwidget.ui:112 dialogs/completionconfigwidget.ui:249 -#: dialogs/completionconfigwidget.ui:421 -msgid "\\/" -msgstr "\\/" - -#. i18n: ectx: property (title), widget (QGroupBox, filtering) -#: dialogs/completionconfigwidget.ui:128 -msgid "Filtering" -msgstr "फ़िल्टर किया जा रहा है" - -#. i18n: ectx: property (text), widget (QCheckBox, filteringContextMatchOnly) -#: dialogs/completionconfigwidget.ui:143 -msgid "Suitable context matches only" -msgstr "सिर्फ उपयुक्त संदर्भित मिलान" - -#. i18n: ectx: property (text), widget (QCheckBox, filteringHideAttributes) -#: dialogs/completionconfigwidget.ui:150 -msgid "Hide completions with the following attributes:" -msgstr "पूर्णता को निम्न गुणों के साथ छुपाएँ:" - -#. i18n: ectx: property (text), widget (QLabel, label6) -#: dialogs/completionconfigwidget.ui:162 -#, fuzzy -#| msgid "Maximum inheritance depth" -msgid "Maximum inheritance depth:" -msgstr "अधिकतम इनहैरिटेंस गहराई" - -#. i18n: ectx: property (specialValueText), widget (QSpinBox, filteringMaximumInheritanceDepth) -#: dialogs/completionconfigwidget.ui:172 -msgid "Infinity" -msgstr "अनंत" - -#. i18n: ectx: property (title), widget (QGroupBox, grouping) -#: dialogs/completionconfigwidget.ui:190 -msgid "Grouping" -msgstr "समूहबद्धता" - -#. i18n: ectx: property (text), widget (QTreeWidget, groupingMethods) -#: dialogs/completionconfigwidget.ui:209 -#, fuzzy -#| msgid "Grouping method" -msgid "Grouping Method" -msgstr "समूहीकरण विधि" - -#. i18n: ectx: property (text), item, widget (QTreeWidget, groupingMethods) -#: dialogs/completionconfigwidget.ui:214 -msgid "Scope type (local, namespace, global)" -msgstr "स्कोप किस्म (स्थानीय, नेमस्पेस, वैश्विक)" - -#. i18n: ectx: property (text), item, widget (QTreeWidget, groupingMethods) -#: dialogs/completionconfigwidget.ui:219 -msgid "Scope (eg. per class)" -msgstr "स्कोप (उदा. प्रति क्लास)" - -#. i18n: ectx: property (text), item, widget (QTreeWidget, groupingMethods) -#: dialogs/completionconfigwidget.ui:224 -msgid "Access type (public etc.)" -msgstr "पहुंच किस्म (सार्वजनिक इत्यादि)" - -#. i18n: ectx: property (text), item, widget (QTreeWidget, groupingMethods) -#: dialogs/completionconfigwidget.ui:229 -msgid "Item type (function etc.)" -msgstr "वस्तु किस्म (फ़ंक्शन इत्यादि)" - -#. i18n: ectx: property (text), widget (QLabel, label) -#: dialogs/completionconfigwidget.ui:279 -#, fuzzy -#| msgid "Footer Properties" -msgid "Access Grouping Properties" -msgstr "पाद-सूचना गुण" - -#. i18n: ectx: property (text), widget (QCheckBox, accessConst) -#: dialogs/completionconfigwidget.ui:286 -msgid "Include const in grouping" -msgstr "कॉस्टैंट को में शामिल करें" - -#. i18n: ectx: property (text), widget (QCheckBox, accessStatic) -#: dialogs/completionconfigwidget.ui:293 -msgid "Include static in grouping" -msgstr "स्टैटिक को समूह में शामिल करें" - -#. i18n: ectx: property (text), widget (QCheckBox, accessSignalSlot) -#: dialogs/completionconfigwidget.ui:300 -msgid "Include signals and slots in grouping" -msgstr "सिगनल तथा स्लॉट को समूह में शामिल करें" - -#. i18n: ectx: property (text), widget (QLabel, label_3) -#: dialogs/completionconfigwidget.ui:330 -#, fuzzy -#| msgid "Footer Properties" -msgid "Item Grouping properties" -msgstr "पाद-सूचना गुण" - -#. i18n: ectx: property (text), widget (QCheckBox, itemTemplate) -#: dialogs/completionconfigwidget.ui:337 -msgid "Include templates in grouping" -msgstr "टैम्प्लेट को समूह में शामिल करें" - -#. i18n: ectx: property (title), widget (QGroupBox, columnMerging) -#: dialogs/completionconfigwidget.ui:366 -msgid "Column Merging" -msgstr "स्तम्भ मिलाना" - -#. i18n: ectx: property (text), widget (QTreeWidget, columnMergeTree) -#: dialogs/completionconfigwidget.ui:391 -msgid "Columns" -msgstr "स्तम्भ" - -#. i18n: ectx: property (text), widget (QTreeWidget, columnMergeTree) -#: dialogs/completionconfigwidget.ui:396 -msgid "Merged" -msgstr "मिलाया" - -#. i18n: ectx: property (text), widget (QTreeWidget, columnMergeTree) -#: dialogs/completionconfigwidget.ui:401 -msgid "Shown" -msgstr "दिखाया" - -#. i18n: ectx: property (title), widget (QGroupBox, gbStaticWordWrap) -#: dialogs/editconfigwidget.ui:12 -msgid "Static Word Wrap" -msgstr "स्थिर शब्द रैप" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkStaticWordWrap) -#: dialogs/editconfigwidget.ui:18 -msgid "" -"<p>Automatically start a new line of text when the current line exceeds the " -"length specified by the <b>Wrap words at:</b> option.</p><p>This option does " -"not wrap existing lines of text - use the <b>Apply Static Word Wrap</b> " -"option in the <b>Tools</b> menu for that purpose.</p><p>If you want lines to " -"be <i>visually wrapped</i> instead, according to the width of the view, " -"enable <b>Dynamic Word Wrap</b> in the <b>Appearance</b> config page.</p>" -msgstr "" - -#. i18n: ectx: property (text), widget (QCheckBox, chkStaticWordWrap) -#: dialogs/editconfigwidget.ui:21 -msgid "Enable static &word wrap" -msgstr "स्थिर शब्द रैप सक्षम करें (&w)" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkShowStaticWordWrapMarker) -#: dialogs/editconfigwidget.ui:28 -msgid "" -"<p>If this option is checked, a vertical line will be drawn at the word wrap " -"column as defined in the <strong>Editing</strong> properties.</p><p>Note " -"that the word wrap marker is only drawn if you use a fixed pitch font.</p>" -msgstr "" - -#. i18n: ectx: property (text), widget (QCheckBox, chkShowStaticWordWrapMarker) -#: dialogs/editconfigwidget.ui:31 -#, fuzzy -msgid "Show static word wra&p marker (if applicable)" -msgstr "स्थिर वर्ड रैप मार्कर दिखाएँ (यदि लागू हो)" - -#. i18n: ectx: property (text), widget (QLabel, lblWordWrap) -#: dialogs/editconfigwidget.ui:43 -msgid "W&rap words at:" -msgstr "पर शब्द लपेटें: (&r)" - -#. i18n: ectx: property (whatsThis), widget (QSpinBox, sbWordWrap) -#: dialogs/editconfigwidget.ui:53 -msgid "" -"If the Word Wrap option is selected this entry determines the length (in " -"characters) at which the editor will automatically start a new line." -msgstr "" -"यदि वर्ड रैप विकल्प चुना गया है यह प्रविष्टि निर्धारित करती है (अक्षरों में) कि संपादक किस " -"लंबाई पर स्वयं एक नई पंक्ति प्रारंभ करेगा." - -#. i18n: ectx: property (title), widget (QGroupBox, gbInputMode) -#: dialogs/editconfigwidget.ui:87 -msgid "InputMode" -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, lblInputMode) -#: dialogs/editconfigwidget.ui:93 -#, fuzzy -#| msgid "Default indentation mode:" -msgid "Default input mode" -msgstr "डिफ़ॉल्ट इंडेटेशन मोड:" - -#. i18n: ectx: property (title), widget (QGroupBox, gbMisc) -#. i18n: ectx: property (title), widget (QGroupBox, cbNavigationMisc) -#: dialogs/editconfigwidget.ui:119 dialogs/navigationconfigwidget.ui:84 -msgid "Misc" -msgstr "विविध" - -#. i18n: ectx: property (text), widget (QCheckBox, chkSmartCopyCut) -#: dialogs/editconfigwidget.ui:125 -msgid "Copy/Cut the current line if no selection" -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, lblFiletype) -#: dialogs/filetypeconfigwidget.ui:14 -msgid "&Filetype:" -msgstr "फ़ाइल-क़िस्म: (&F)" - -#. i18n: ectx: property (whatsThis), widget (KComboBox, cmbFiletypes) -#: dialogs/filetypeconfigwidget.ui:24 -msgid "Select the filetype you want to change." -msgstr "फ़ाइल क़िस्म जिसे आप बदलना चाहते हैं उसे चुनें." - -#. i18n: ectx: property (whatsThis), widget (QPushButton, btnNew) -#: dialogs/filetypeconfigwidget.ui:31 -msgid "Create a new file type." -msgstr "नया फ़ाइल क़िस्म तैयार करें" - -#. i18n: ectx: property (text), widget (QPushButton, btnNew) -#: dialogs/filetypeconfigwidget.ui:34 -msgid "&New" -msgstr "नया (&N)" - -#. i18n: ectx: property (whatsThis), widget (QPushButton, btnDelete) -#: dialogs/filetypeconfigwidget.ui:41 -msgid "Delete the current file type." -msgstr "वर्तमान फ़ाइल क़िस्म मिटाएँ." - -#. i18n: ectx: property (text), widget (QPushButton, btnDelete) -#: dialogs/filetypeconfigwidget.ui:44 schema/kateschemaconfig.cpp:930 -msgid "&Delete" -msgstr "मिटाएँ (&D)" - -#. i18n: ectx: property (title), widget (QGroupBox, gbProperties) -#: dialogs/filetypeconfigwidget.ui:66 mode/katemodeconfigpage.cpp:268 -msgid "Properties" -msgstr "गुण" - -#. i18n: ectx: property (whatsThis), widget (KLineEdit, edtName) -#: dialogs/filetypeconfigwidget.ui:82 -#, fuzzy -msgid "" -"The name of the filetype will be the text of the corresponding menu item." -msgstr "चंद्रमा" - -#. i18n: ectx: property (text), widget (QLabel, lblSection) -#: dialogs/filetypeconfigwidget.ui:89 -msgid "&Section:" -msgstr "खण्ड: (&S)" - -#. i18n: ectx: property (whatsThis), widget (KLineEdit, edtSection) -#: dialogs/filetypeconfigwidget.ui:99 -#, fuzzy -msgid "The section name is used to organize the file types in menus." -msgstr "" -"फ़ाइल को चुनें. \\<emph\\>फ़ाइल क़िस्म\\</emph\\> बक्से में आप कुछ विशिष्ट क़िस्म की फ़ाइलों " -"का चयन सीमित कर सकते हैं." - -#. i18n: ectx: property (text), widget (QLabel, lblVariables) -#: dialogs/filetypeconfigwidget.ui:106 -msgid "&Variables:" -msgstr "चर: (&V)" - -#. i18n: ectx: property (whatsThis), widget (VariableLineEdit, edtVariables) -#: dialogs/filetypeconfigwidget.ui:116 -msgid "" -"<p>This string allows to configure Kate's settings for the files selected by " -"this mimetype using Kate variables. Almost any configuration option can be " -"set, such as highlight, indent-mode, encoding, etc.</p><p>For a full list of " -"known variables, see the manual.</p>" -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, lblHl) -#: dialogs/filetypeconfigwidget.ui:123 -msgid "&Highlighting:" -msgstr "उभारना: (&H)" - -#. i18n: ectx: property (text), widget (QLabel, lblIndenter) -#: dialogs/filetypeconfigwidget.ui:136 -#, fuzzy -#| msgid "&Indentation mode:" -msgid "&Indentation Mode:" -msgstr "जगह छोड़ने का मोड: (&I)" - -#. i18n: ectx: property (text), widget (QLabel, lblExtensions) -#: dialogs/filetypeconfigwidget.ui:149 -msgid "File e&xtensions:" -msgstr "फ़ाइल एक्सटेंशन्स: (&x)" - -#. i18n: ectx: property (whatsThis), widget (KLineEdit, edtFileExtensions) -#: dialogs/filetypeconfigwidget.ui:159 -msgid "" -"The wildcards mask allows to select files by filename. A typical mask uses " -"an asterisk and the file extension, for example <code>*.txt; *.text</code>. " -"The string is a semicolon-separated list of masks." -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, lblMimeTypes) -#: dialogs/filetypeconfigwidget.ui:166 -msgid "MIME &types:" -msgstr "माइम क़िस्म: (&t)" - -#. i18n: ectx: property (whatsThis), widget (KLineEdit, edtMimeTypes) -#: dialogs/filetypeconfigwidget.ui:181 -msgid "" -"The mime type mask allows to select files by mimetype. The string is a " -"semicolon-separated list of mimetypes, for example <code>text/plain; text/" -"english</code>." -msgstr "" - -#. i18n: ectx: property (whatsThis), widget (QToolButton, btnMimeTypes) -#: dialogs/filetypeconfigwidget.ui:188 -#, fuzzy -msgid "Displays a wizard that helps you easily select mimetypes." -msgstr "" -"\\<switchinline select=\\\"sys\\\"\\>\\<caseinline select=\\\"WIN\\\"\\>जिस " -"प्रिंटर को आपने चुना है उसकी क़िस्म प्रदर्शित करता है. \\</caseinline\\>\\</" -"switchinline\\>" - -#. i18n: ectx: property (text), widget (QLabel, lblPriority) -#: dialogs/filetypeconfigwidget.ui:197 -msgid "P&riority:" -msgstr "प्राथमिकता: (&r)" - -#. i18n: ectx: property (whatsThis), widget (QSpinBox, sbPriority) -#: dialogs/filetypeconfigwidget.ui:207 -msgid "" -"Sets priority for this file type. If more than one file type selects the " -"same file, the one with the highest priority will be used." -msgstr "" - -#. i18n: ectx: property (text), widget (QPushButton, btnDownload) -#: dialogs/filetypeconfigwidget.ui:232 -msgid "Download Highlighting Files..." -msgstr "उभारे गए फ़ाइलों को डाउनलोड किया जा रहा है..." - -#. i18n: ectx: property (text), widget (QLabel, lblMode) -#: dialogs/indentationconfigwidget.ui:17 -msgid "Default indentation mode:" -msgstr "डिफ़ॉल्ट इंडेटेशन मोड:" - -#. i18n: ectx: property (whatsThis), widget (KComboBox, cmbMode) -#: dialogs/indentationconfigwidget.ui:27 -msgid "" -"This is a list of available indentation modes. The specified indentation " -"mode will be used for all new documents. Be aware that it is also possible " -"to set the indentation mode with document variables, modes or a .kateconfig " -"file." -msgstr "" - -#. i18n: ectx: property (title), widget (QGroupBox, gbIndentationMode) -#: dialogs/indentationconfigwidget.ui:49 -#, fuzzy -#| msgid "Indentation" -msgid "Indent using" -msgstr "जगह छोड़ना" - -#. i18n: ectx: property (text), widget (QRadioButton, rbIndentWithTabs) -#: dialogs/indentationconfigwidget.ui:55 -#, fuzzy -#| msgid "Tabulators" -msgid "&Tabulators" -msgstr "टेबुलेटर्स" - -#. i18n: ectx: property (text), widget (QRadioButton, rbIndentWithSpaces) -#: dialogs/indentationconfigwidget.ui:62 -#, fuzzy -#| msgid "&Replace" -msgid "&Spaces" -msgstr "बदलें (&R)" - -#. i18n: ectx: property (text), widget (QLabel, lblIndentWidth) -#: dialogs/indentationconfigwidget.ui:69 -#, fuzzy -msgid "&Indentation width:" -msgstr "अनुकूलतम चौड़ाई (~O)" - -#. i18n: ectx: property (text), widget (QRadioButton, rbIndentMixed) -#: dialogs/indentationconfigwidget.ui:79 -#, fuzzy -#| msgid "Tabulators" -msgid "Tabulators &and Spaces" -msgstr "टेबुलेटर्स" - -#. i18n: ectx: property (text), widget (QLabel, lblTabWidth) -#: dialogs/indentationconfigwidget.ui:99 -msgid "Tab wi&dth:" -msgstr "टैब चौड़ाई: (&d)" - -#. i18n: ectx: property (whatsThis), widget (QSpinBox, sbIndentWidth) -#: dialogs/indentationconfigwidget.ui:125 -msgid "" -"The indentation width is the number of spaces which is used to indent a " -"line. If the option <b>Insert spaces instead of tabulators</b> in the " -"section <b>Editing</b> is disabled, a <b>Tab</b> character is inserted if " -"the indentation is divisible by the tab width." -msgstr "" - -#. i18n: ectx: property (title), widget (QGroupBox, gbProperties) -#: dialogs/indentationconfigwidget.ui:144 -#, fuzzy -msgid "Indentation Properties" -msgstr "दस्तावेज गुण" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkKeepExtraSpaces) -#: dialogs/indentationconfigwidget.ui:150 -msgid "" -"If this option is disabled, changing the indentation level aligns a line to " -"a multiple of the width specified in <b>Indentation width</b>." -msgstr "" - -#. i18n: ectx: property (text), widget (QCheckBox, chkKeepExtraSpaces) -#: dialogs/indentationconfigwidget.ui:153 -#, fuzzy -#| msgid "Keep extra spaces" -msgid "&Keep extra spaces" -msgstr "अतिरिक्त जगह रखें" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkIndentPaste) -#: dialogs/indentationconfigwidget.ui:160 -msgid "" -"If this option is selected, pasted code from the clipboard is indented. " -"Triggering the <b>undo</b>-action removes the indentation." -msgstr "" - -#. i18n: ectx: property (text), widget (QCheckBox, chkIndentPaste) -#: dialogs/indentationconfigwidget.ui:163 -#, fuzzy -msgid "Adjust indentation of code &pasted from the clipboard" -msgstr "क्लिपबोर्ड की विषय को नहीं चिपका सकते है ." - -#. i18n: ectx: property (title), widget (QGroupBox, gbKeys) -#: dialogs/indentationconfigwidget.ui:173 -#, fuzzy -msgid "Indentation Actions" -msgstr "क्रिया चलाएँ (_E)" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkBackspaceUnindents) -#: dialogs/indentationconfigwidget.ui:179 -msgid "" -"If this option is selected, the <b>Backspace</b> key decreases the " -"indentation level if the cursor is located in the leading blank space of a " -"line." -msgstr "" - -#. i18n: ectx: property (text), widget (QCheckBox, chkBackspaceUnindents) -#: dialogs/indentationconfigwidget.ui:182 -#, fuzzy -msgid "&Backspace key in leading blank space unindents" -msgstr "पैराग्राफ में व्रैप पंक्तियों के बीच रिक्त स्थानों के पिक्सल" - -#. i18n: ectx: property (text), widget (QLabel, label) -#: dialogs/indentationconfigwidget.ui:192 -msgid "" -"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css" -"\">\n" -"p, li { white-space: pre-wrap; }\n" -"</style></head><body>\n" -"<p>Tab key action (if no selection exists) <a href=\"If you want <b>Tab</b> " -"to align the current line in the current code block like in emacs, make " -"<b>Tab</b> a shortcut to the action <b>Align</b>.\"><span>More ...</span></" -"a></p></body></html>" -msgstr "" - -#. i18n: ectx: property (whatsThis), widget (QRadioButton, rbTabAdvances) -#: dialogs/indentationconfigwidget.ui:225 -msgid "" -"If this option is selected, the <b>Tab</b> key always inserts white space so " -"that the next tab position is reached. If the option <b>Insert spaces " -"instead of tabulators</b> in the section <b>Editing</b> is enabled, spaces " -"are inserted; otherwise, a single tabulator is inserted." -msgstr "" - -#. i18n: ectx: property (text), widget (QRadioButton, rbTabAdvances) -#: dialogs/indentationconfigwidget.ui:228 -#, fuzzy -msgid "Always advance to the &next tab position" -msgstr "अगले टैब पर स्विच करने हेतु कुंजीपटल शॉर्टकट" - -#. i18n: ectx: property (whatsThis), widget (QRadioButton, rbTabIndents) -#: dialogs/indentationconfigwidget.ui:235 -msgid "" -"If this option is selected, the <b>Tab</b> key always indents the current " -"line by the number of character positions specified in <b>Indentation width</" -"b>." -msgstr "" - -#. i18n: ectx: property (text), widget (QRadioButton, rbTabIndents) -#: dialogs/indentationconfigwidget.ui:238 -#, fuzzy -msgid "Always increase indentation &level" -msgstr "यह <b>टैब</b>कुंजी के द्वारा हाशिए का स्तर बढ़ाने देता है." - -#. i18n: ectx: property (whatsThis), widget (QRadioButton, rbTabSmart) -#: dialogs/indentationconfigwidget.ui:245 -msgid "" -"If this option is selected, the <b>Tab</b> key either indents the current " -"line or advances to the next tab position.<p> If the insertion point is at " -"or before the first non-space character in the line, or if there is a " -"selection, the current line is indented by the number of character positions " -"specified in <b>Indentation width</b>.<p> If the insertion point is located " -"after the first non-space character in the line and there is no selection, " -"white space is inserted so that the next tab position is reached: if the " -"option <b>Insert spaces instead of tabulators</b> in the section <b>Editing</" -"b> is enabled, spaces are inserted; otherwise, a single tabulator is " -"inserted." -msgstr "" - -#. i18n: ectx: property (text), widget (QRadioButton, rbTabSmart) -#: dialogs/indentationconfigwidget.ui:248 -#, fuzzy -msgid "Increase indentation level if in l&eading blank space" -msgstr "पैराग्राफ में व्रैप पंक्तियों के बीच रिक्त स्थानों के पिक्सल" - -#: dialogs/katedialogs.cpp:200 dialogs/katedialogs.cpp:203 -#, fuzzy -#| msgid " characters" -msgctxt "spinbox special value for 1" -msgid "1 character" -msgstr "अक्षर" - -#: dialogs/katedialogs.cpp:201 dialogs/katedialogs.cpp:204 -#, fuzzy -#| msgid " characters" -msgctxt "suffix for spinbox >1" -msgid " characters" -msgstr "अक्षर" - -#: dialogs/katedialogs.cpp:231 -msgid "Indentation" -msgstr "जगह छोड़ना" - -#: dialogs/katedialogs.cpp:301 -#, fuzzy -#| msgid "Word Completion" -msgid "Auto Completion" -msgstr "शब्द पूर्णता" - -#: dialogs/katedialogs.cpp:365 -msgid "Spellcheck" -msgstr "वर्तनी जाँच" - -#: dialogs/katedialogs.cpp:441 -#, fuzzy -#| msgid "Configuration" -msgid "Text Navigation" -msgstr "कॉन्फ़िगरेशन" - -#: dialogs/katedialogs.cpp:508 -#, fuzzy -#| msgid " characters" -msgctxt "suffix for spinbox >1 wrap words at (value is at 20 or larger)" -msgid " characters" -msgstr "अक्षर" - -#: dialogs/katedialogs.cpp:620 script/data/commands/utils.js:330 -msgid "Editing" -msgstr "संपादन" - -#: dialogs/katedialogs.cpp:625 -msgid "Editing Options" -msgstr "संपादन विकल्प" - -#: dialogs/katedialogs.cpp:654 -msgid "Off" -msgstr "बन्द" - -#: dialogs/katedialogs.cpp:655 -msgid "Follow Line Numbers" -msgstr "पंक्ति क्रमांक अनुसरण करें" - -#: dialogs/katedialogs.cpp:765 dialogs/katedialogs.cpp:770 -msgid "Appearance" -msgstr "रूप" - -#. i18n: ectx: property (title), widget (QGroupBox, groupBox) -#: dialogs/katedialogs.cpp:836 dialogs/textareaappearanceconfigwidget.ui:102 -msgid "Advanced" -msgstr "" - -#: dialogs/katedialogs.cpp:891 -msgid "" -"You did not provide a backup suffix or prefix. Using default suffix: '~'" -msgstr "" -"आपने कोई बैकअप प्रत्यय या उपसर्ग नहीं दिया है. डिफ़ॉल्ट उपसर्ग इस्तेमाल किया जा रहा है: " -"'~'" - -#: dialogs/katedialogs.cpp:892 -msgid "No Backup Suffix or Prefix" -msgstr "कोई बैकअप प्रत्यय या उपसर्ग नहीं" - -#: dialogs/katedialogs.cpp:903 -msgid "" -"Selected directory for swap file storage does not exist. Do you want to " -"create it?" -msgstr "" - -#: dialogs/katedialogs.cpp:904 -msgid "Missing Swap File Directory" -msgstr "" - -#: dialogs/katedialogs.cpp:961 -msgid "KDE Default" -msgstr "केडीई डिफ़ॉल्ट" - -#: dialogs/katedialogs.cpp:1045 -msgid "Open/Save" -msgstr "खोलें/सहेजें" - -#: dialogs/katedialogs.cpp:1050 -msgid "File Opening & Saving" -msgstr "फ़ाइल खोलना व सहेजना" - -#: dialogs/katedialogs.cpp:1064 -msgid "Highlight Download" -msgstr "डाउनलोड उभारें" - -#: dialogs/katedialogs.cpp:1071 -msgid "Select the syntax highlighting files you want to update:" -msgstr "जिसे आप अद्यतन करना चाहते हैं उस सिंटेक्स हाइलाइटिंग फ़ाइल को चुनें:" - -#: dialogs/katedialogs.cpp:1076 -msgid "Installed" -msgstr "स्थापित " - -#: dialogs/katedialogs.cpp:1076 -msgid "Latest" -msgstr "नवीनतम" - -#: dialogs/katedialogs.cpp:1083 -msgid "<b>Note:</b> New versions are selected automatically." -msgstr "<b>टीप:</b> नए संस्करण स्वचालित चुने जाएंगे." - -#: dialogs/katedialogs.cpp:1090 -msgid "&Install" -msgstr "संस्थापित करें (&I)" - -#: dialogs/katedialogs.cpp:1133 -msgid "" -"The list of highlightings could not be found on / retrieved from the server" -msgstr "" - -#: dialogs/katedialogs.cpp:1241 -msgid "&Go to line:" -msgstr "पंक्ति पर जाएँ: (&G)" - -#: dialogs/katedialogs.cpp:1247 -msgid "Go" -msgstr "जाएँ" - -#: dialogs/katedialogs.cpp:1309 -#, fuzzy -#| msgid "&Section:" -msgid "Dictionary:" -msgstr "खण्ड: (&S)" - -#: dialogs/katedialogs.cpp:1357 -msgid "File Was Deleted on Disk" -msgstr "फ़ाइल को डिस्क में से मिटाया गया" - -#: dialogs/katedialogs.cpp:1358 -msgid "&Save File As..." -msgstr "फ़ाइल ऐसे सहेजें... (&S)" - -#: dialogs/katedialogs.cpp:1360 -#, fuzzy -msgid "Lets you select a location and save the file again." -msgstr "" -"फ़ाइल \"%s\" नहीं मिलीस.\n" -"\n" -" ये देख लेव कि आप मन ने जगह सही टाइप करे हव तहाँ ले फिर से कोशिश कर लेव." - -#: dialogs/katedialogs.cpp:1362 -msgid "File Changed on Disk" -msgstr "डिस्क में फ़ाइल को बदल दिया गया है" - -#: dialogs/katedialogs.cpp:1363 document/katedocument.cpp:3940 -msgid "&Reload File" -msgstr "फ़ाइल फिर से लोड करें (&R)" - -#: dialogs/katedialogs.cpp:1365 -#, fuzzy -msgid "" -"Reload the file from disk. If you have unsaved changes, they will be lost." -msgstr "" -"क्या आप इस दस्तावेज़ \"%s\"में किए गए परिवर्तनों को सहेजना चाहते हैं? \n" -"\n" -"यदि आप सहेजते नहीं हैं तो किए गए परिवर्तनों को आप खो देंगे." - -#: dialogs/katedialogs.cpp:1379 document/katedocument.cpp:3938 -msgid "What do you want to do?" -msgstr "आप क्या करना चाहते हैं?" - -#: dialogs/katedialogs.cpp:1390 document/katedocument.cpp:3941 -msgid "&Ignore Changes" -msgstr "परिवर्तनों को नज़र अंदाज़ करें (&I)" - -#: dialogs/katedialogs.cpp:1391 -#, fuzzy -msgid "Ignore the changes. You will not be prompted again." -msgstr "आपकी द्वारा बनायी गई तालिका नहीं खोली जा सकी." - -#: dialogs/katedialogs.cpp:1397 -msgid "" -"Do nothing. Next time you focus the file, or try to save it or close it, you " -"will be prompted again." -msgstr "" - -#: dialogs/katedialogs.cpp:1406 -#, fuzzy -msgid "Overwrite the disk file with the editor content." -msgstr "" -"\\<switchinline select=\\\"appl\\\"\\>\\<caseinline select=\\\"CALC\\" -"\"\\>फ़ाइल में सामग्री युक्त कक्षों की संख्या. \\</caseinline\\>\\</switchinline\\>" - -#: dialogs/katedialogs.cpp:1480 swapfile/kateswapdiffcreator.cpp:137 -#, fuzzy -msgid "" -"The diff command failed. Please make sure that diff(1) is installed and in " -"your PATH." -msgstr "" -"आईस्पेल चालू नहीं किया जा सका. कृपया सुनिश्चित हों कि आईस्पेल उचित प्रकार कॉन्फ़िगर्ड है " -"तथा आपके पथ में है." - -#: dialogs/katedialogs.cpp:1482 swapfile/kateswapdiffcreator.cpp:139 -msgid "Error Creating Diff" -msgstr "डिफ बनाने में त्रुटि" - -#: dialogs/katedialogs.cpp:1491 swapfile/kateswapdiffcreator.cpp:147 -msgid "The files are identical." -msgstr "" - -#: dialogs/katedialogs.cpp:1492 dialogs/katedialogs.cpp:1496 -#: swapfile/kateswapdiffcreator.cpp:148 -msgid "Diff Output" -msgstr "डिफ आउटपुट" - -#: dialogs/katedialogs.cpp:1495 -#, fuzzy -msgid "Ignoring amount of white space changed, the files are identical." -msgstr "" -"फाइलें एक जैसी हैं\n" -"(या द्विचर फाइलें जो अलग हो भी सकती हैं और नहीं भी)" - -#: dialogs/katedialogs.cpp:1520 -msgid "" -"Ignoring means that you will not be warned again (unless the disk file " -"changes once more): if you save the document, you will overwrite the file on " -"disk; if you do not save then the disk file (if present) is what you have." -msgstr "" - -#: dialogs/katedialogs.cpp:1524 -msgid "You Are on Your Own" -msgstr "आप अपने रास्ते पर हैं" - -#. i18n: ectx: property (text), widget (QCheckBox, chkIgnoreWhiteSpaces) -#: dialogs/modonhdwidget.ui:23 -msgid "Ignore white space changes" -msgstr "श्वेतस्थान में परिवर्तनों को नज़र अंदाज़ करें" - -#. i18n: ectx: property (whatsThis), widget (QPushButton, btnDiff) -#: dialogs/modonhdwidget.ui:30 -#, fuzzy -msgid "" -"Calculates the difference between the editor contents and the disk file " -"using diff(1)." -msgstr "" -"<b>सहेजे फ़ाइलों में भिन्नता</b><p>संपादक तथा डिस्क में सहेजे गए फ़ाइलों की विषयवस्तु में " -"भिन्नता को दिखाता है." - -#. i18n: ectx: property (text), widget (QPushButton, btnDiff) -#: dialogs/modonhdwidget.ui:33 -msgid "&View Difference" -msgstr "भिन्नता देखें (&V)" - -#. i18n: ectx: property (title), widget (QGroupBox, gbCursorMovement) -#: dialogs/navigationconfigwidget.ui:12 -msgid "Text Cursor Movement" -msgstr "पाठ संकेतक गतिविधि" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkSmartHome) -#: dialogs/navigationconfigwidget.ui:18 -#, fuzzy -msgid "" -"When selected, pressing the home key will cause the cursor to skip " -"whitespace and go to the start of a line's text. The same applies for the " -"end key." -msgstr "" -"जब चुना जाएगा, होम कुंजी दबाने पर संकेतक व्हाइट स्पेस छोड़कर पाठ पंक्ति के प्रारंभ में चला " -"जाएगा." - -#. i18n: ectx: property (text), widget (QCheckBox, chkSmartHome) -#: dialogs/navigationconfigwidget.ui:21 -#, fuzzy -msgid "Smart ho&me and smart end" -msgstr "~~ और ` की पंक्ति के अंत में उपेक्षा करें (~n)" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkPagingMovesCursor) -#: dialogs/navigationconfigwidget.ui:28 -msgid "" -"Selects whether the PageUp and PageDown keys should alter the vertical " -"position of the cursor relative to the top of the view." -msgstr "" -"चुनता है कि पेजअप तथा पेजडाउप कुंजियाँ संकेतक की खड़ी स्थिति को शीर्ष दृश्य के सापेक्ष बदल दे." - -#. i18n: ectx: property (text), widget (QCheckBox, chkPagingMovesCursor) -#: dialogs/navigationconfigwidget.ui:31 -msgid "&PageUp/PageDown moves cursor" -msgstr "पेज-अप/पेज-डाउन माउस संकेतक को खिसकाए (&P)" - -#. i18n: ectx: property (text), widget (QLabel, lblAutoCenterCursor) -#: dialogs/navigationconfigwidget.ui:43 -#, fuzzy -#| msgid "&Autocenter cursor (lines):" -msgid "&Autocenter cursor:" -msgstr "आटोसेंटर संकेतक (पंक्तियाँ): (&A)" - -#. i18n: ectx: property (whatsThis), widget (QSpinBox, sbAutoCenterCursor) -#: dialogs/navigationconfigwidget.ui:53 -msgid "" -"Sets the number of lines to maintain visible above and below the cursor when " -"possible." -msgstr "जहां संभव हो, नियत करता है कि संकेतक के ऊपर तथा नीचे कितनी पंक्तियाँ दिखती रहें." - -#. i18n: ectx: property (specialValueText), widget (QSpinBox, sbAutoCenterCursor) -#. i18n: ectx: property (specialValueText), widget (QSpinBox, spbSwapFileSync) -#. i18n: ectx: property (specialValueText), widget (QSpinBox, sbDynamicWordWrapDepth) -#: dialogs/navigationconfigwidget.ui:56 dialogs/opensaveconfigadvwidget.ui:199 -#: dialogs/textareaappearanceconfigwidget.ui:57 -msgid "Disabled" -msgstr "अक्षम" - -#. i18n: ectx: property (suffix), widget (QSpinBox, sbAutoCenterCursor) -#: dialogs/navigationconfigwidget.ui:59 -#, fuzzy -#| msgid "Inline" -msgid " lines" -msgstr "इनलाइन" - -#. i18n: ectx: property (text), widget (QLabel, lblTextSelectionMode) -#: dialogs/navigationconfigwidget.ui:92 -#, fuzzy -#| msgid "Text Selection Mode" -msgid "Text selection mode:" -msgstr "पाठ चयन मोड" - -#. i18n: ectx: property (text), item, widget (QComboBox, cbTextSelectionMode) -#: dialogs/navigationconfigwidget.ui:103 inputmode/katenormalinputmode.cpp:82 -#, fuzzy -#| msgid "Normal" -msgid "Normal" -msgstr "सामान्य" - -#. i18n: ectx: property (text), item, widget (QComboBox, cbTextSelectionMode) -#: dialogs/navigationconfigwidget.ui:108 -#, fuzzy -#| msgid "&Persistent" -msgid "Persistent" -msgstr "परसिस्टेंट (&P)" - -#. i18n: ectx: property (text), widget (QCheckBox, chkScrollPastEnd) -#: dialogs/navigationconfigwidget.ui:131 -msgid "Allow scrolling past the end of the document" -msgstr "" - -#. i18n: ectx: property (title), widget (QGroupBox, gbConfigFile) -#: dialogs/opensaveconfigadvwidget.ui:17 -msgid "Folder Config File" -msgstr "फ़ोल्डर कॉन्फ़िग फ़ाइल" - -#. i18n: ectx: property (text), widget (QLabel, label) -#: dialogs/opensaveconfigadvwidget.ui:28 -#, fuzzy -msgid "Search &depth for config file:" -msgstr "ICO फ़ाइल हेतु असमर्थित डेफ़्थ: %d" - -#. i18n: ectx: property (whatsThis), widget (QGroupBox, gbBackup) -#: dialogs/opensaveconfigadvwidget.ui:56 -#, fuzzy -msgid "" -"<p>Backing up on save will cause Kate to copy the disk file to '<" -"prefix><filename><suffix>' before saving changes.<p>The " -"suffix defaults to <strong>~</strong> and prefix is empty by default." -msgstr "" -"<p>सहेजने से वापस आने पर के-एटीई डिस्क फ़ाइल को '<filename><suffix>' पर " -"नक़ल करेगा, परिवर्तन को सहेजने से पहले.<p>प्रत्यय डिफ़ॉल्ट्स है <strong>~</strong>तथा " -"उपसर्ग डिफ़ॉल्ट से रिक्त है" - -#. i18n: ectx: property (title), widget (QGroupBox, gbBackup) -#: dialogs/opensaveconfigadvwidget.ui:59 -msgid "Backup on Save" -msgstr "सहेजने पर बैकअप लें" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkBackupLocalFiles) -#: dialogs/opensaveconfigadvwidget.ui:68 -#, fuzzy -msgid "" -"If this option is enabled, backups for local files will be created when " -"saving." -msgstr "" -"यदि इस विकल्प को सक्षम किया जाता है (डिफ़ॉल्ट से), तो ढूंढने का कार्य केस सेंसिटिव होगा." - -#. i18n: ectx: property (text), widget (QCheckBox, chkBackupLocalFiles) -#: dialogs/opensaveconfigadvwidget.ui:71 -msgid "&Local files" -msgstr "स्थानीय फ़ाइलें (&L)" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkBackupRemoteFiles) -#: dialogs/opensaveconfigadvwidget.ui:78 -#, fuzzy -msgid "" -"If this option is enabled, backups for remote files will be created when " -"saving." -msgstr "" -"यदि इस विकल्प को सक्षम किया जाता है (डिफ़ॉल्ट से), तो ढूंढने का कार्य केस सेंसिटिव होगा." - -#. i18n: ectx: property (text), widget (QCheckBox, chkBackupRemoteFiles) -#: dialogs/opensaveconfigadvwidget.ui:81 -msgid "&Remote files" -msgstr "रिमोट फ़ाइलें (&R)" - -#. i18n: ectx: property (text), widget (QLabel, label_5) -#: dialogs/opensaveconfigadvwidget.ui:88 -msgid "&Prefix:" -msgstr "उपसर्गः (&P)" - -#. i18n: ectx: property (whatsThis), widget (KLineEdit, edtBackupPrefix) -#: dialogs/opensaveconfigadvwidget.ui:98 -msgid "Enter the prefix to prepend to the backup file names." -msgstr "बैकअप फ़ाइल नाम में पहले जोड़ने के लिए प्रत्यय भरें" - -#. i18n: ectx: property (text), widget (QLabel, label_6) -#: dialogs/opensaveconfigadvwidget.ui:105 -msgid "&Suffix:" -msgstr "सफिक्स (&S)" - -#. i18n: ectx: property (whatsThis), widget (KLineEdit, edtBackupSuffix) -#: dialogs/opensaveconfigadvwidget.ui:115 -msgid "Enter the suffix to append to the backup file names." -msgstr "बैकअप फ़ाइल नाम में बाद में जोड़ने के लिए प्रत्यय भरें" - -#. i18n: ectx: property (title), widget (QGroupBox, gpSwapFileOptions) -#: dialogs/opensaveconfigadvwidget.ui:131 -#, fuzzy -#| msgid "Search Options" -msgid "Swap File Options" -msgstr "खोज विकल्प" - -#. i18n: ectx: property (text), widget (QLabel, lblSwapFileMode) -#: dialogs/opensaveconfigadvwidget.ui:137 -#, fuzzy -#| msgid "New Filetype" -msgid "Swap file:" -msgstr "नया फ़ाइल क़िस्म" - -#. i18n: ectx: property (text), item, widget (QComboBox, cmbSwapFileMode) -#: dialogs/opensaveconfigadvwidget.ui:148 -#, fuzzy -#| msgid "Disabled" -msgid "Disable" -msgstr "अक्षम" - -#. i18n: ectx: property (text), item, widget (QComboBox, cmbSwapFileMode) -#: dialogs/opensaveconfigadvwidget.ui:153 -msgid "Enable" -msgstr "" - -#. i18n: ectx: property (text), item, widget (QComboBox, cmbSwapFileMode) -#: dialogs/opensaveconfigadvwidget.ui:158 -msgid "Alternative Directory" -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, lblSwapDirectory) -#: dialogs/opensaveconfigadvwidget.ui:166 -msgid "Directory" -msgstr "" - -#. i18n: ectx: property (placeholderText), widget (KUrlRequester, kurlSwapDirectory) -#: dialogs/opensaveconfigadvwidget.ui:182 -msgid "Directory for swp files" -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, lblSwapFileSync) -#: dialogs/opensaveconfigadvwidget.ui:189 -msgid "Sync every:" -msgstr "" - -#. i18n: ectx: property (suffix), widget (QSpinBox, spbSwapFileSync) -#: dialogs/opensaveconfigadvwidget.ui:202 -#, fuzzy -#| msgid "as" -msgid "s" -msgstr "जैसे" - -#. i18n: ectx: property (text), widget (QLabel, label_2) -#: dialogs/opensaveconfigadvwidget.ui:221 -msgid "" -"Be aware, that disabling the swap file synchronization may lead to data loss " -"in case of a system crash." -msgstr "" - -#. i18n: ectx: property (title), widget (QGroupBox, gbFileFormat) -#: dialogs/opensaveconfigwidget.ui:12 -msgid "File Format" -msgstr "फ़ाइल फार्मेट" - -#. i18n: ectx: property (text), widget (QLabel, lblEncoding) -#: dialogs/opensaveconfigwidget.ui:23 -msgid "&Encoding:" -msgstr "एनकोडिंग: (&E)" - -#. i18n: ectx: property (whatsThis), widget (KComboBox, cmbEncoding) -#: dialogs/opensaveconfigwidget.ui:33 -msgid "" -"This defines the standard encoding to use to open/save files, if not changed " -"in the open/save dialog or by using a command line option." -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, lblEncodingDetection) -#: dialogs/opensaveconfigwidget.ui:40 -#, fuzzy -#| msgid "Encoding auto&detection:" -msgid "&Encoding Detection:" -msgstr "एनकोडिंग स्वचालित पता लगाएँ: (&d)" - -#. i18n: ectx: property (whatsThis), widget (KComboBox, cmbEncodingDetection) -#: dialogs/opensaveconfigwidget.ui:50 -msgid "" -"if neither the encoding chosen as standard above, nor the encoding specified " -"in the open/save dialog, nor the encoding specified on command line match " -"the content of the file, this detection will be run." -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, lblEncodingDetection2) -#: dialogs/opensaveconfigwidget.ui:57 -#, fuzzy -#| msgid "&Encoding:" -msgid "&Fallback Encoding:" -msgstr "एनकोडिंग: (&E)" - -#. i18n: ectx: property (whatsThis), widget (KComboBox, cmbEncodingFallback) -#: dialogs/opensaveconfigwidget.ui:67 -msgid "" -"This defines the fallback encoding to try for opening files if neither the " -"encoding chosen as standard above, nor the encoding specified in the open/" -"save dialog, nor the encoding specified on command line match the content of " -"the file. Before this is used, an attempt will be made to determine the " -"encoding to use by looking for a byte order marker at start of file: if one " -"is found, the right unicode encoding will be chosen; otherwise encoding " -"detection will run, if both fail fallback encoding will be tried." -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, lblEOL) -#: dialogs/opensaveconfigwidget.ui:74 -msgid "E&nd of line:" -msgstr "पंक्ति का अंत: (&n)" - -#. i18n: ectx: property (text), item, widget (KComboBox, cmbEOL) -#: dialogs/opensaveconfigwidget.ui:85 -msgid "UNIX" -msgstr "युनिक्स" - -#. i18n: ectx: property (text), item, widget (KComboBox, cmbEOL) -#: dialogs/opensaveconfigwidget.ui:90 -msgid "DOS/Windows" -msgstr "डॉस/विंडोज़" - -#. i18n: ectx: property (text), item, widget (KComboBox, cmbEOL) -#: dialogs/opensaveconfigwidget.ui:95 -msgid "Macintosh" -msgstr "मैकिंटोश" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkDetectEOL) -#: dialogs/opensaveconfigwidget.ui:105 -msgid "" -"If this option is enabled the editor will autodetect the end of line type. " -"The first found end of line type will be used for the whole file." -msgstr "" - -#. i18n: ectx: property (text), widget (QCheckBox, chkDetectEOL) -#: dialogs/opensaveconfigwidget.ui:108 -#, fuzzy -msgid "A&utomatic end of line detection" -msgstr "रेखा के अंत में अक्षरें" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkEnableBOM) -#: dialogs/opensaveconfigwidget.ui:115 -msgid "" -"The byte order mark is a special sequence at the beginning of unicode " -"encoded documents. It helps editors to open text documents with the correct " -"unicode encoding. The byte order mark is not visible in the displayed " -"document." -msgstr "" - -#. i18n: ectx: property (text), widget (QCheckBox, chkEnableBOM) -#: dialogs/opensaveconfigwidget.ui:118 -msgid "Enable byte order marker" -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, label) -#: dialogs/opensaveconfigwidget.ui:125 -msgid "Line Length Limit:" -msgstr "" - -#. i18n: ectx: property (specialValueText), widget (QSpinBox, lineLengthLimit) -#: dialogs/opensaveconfigwidget.ui:135 -msgid "Unlimited" -msgstr "असीमित" - -#. i18n: ectx: property (title), widget (QGroupBox, gbCleanups) -#: dialogs/opensaveconfigwidget.ui:151 -#, fuzzy -msgid "Automatic Cleanups on Save" -msgstr "फ़ाइल लोड करने/सहेजने में अक्षम!" - -#. i18n: ectx: property (whatsThis), widget (QLabel, lblRemoveTrailingSpaces) -#. i18n: ectx: property (whatsThis), widget (QComboBox, cbRemoveTrailingSpaces) -#: dialogs/opensaveconfigwidget.ui:159 dialogs/opensaveconfigwidget.ui:172 -msgid "" -"Depending on the choice, trailing spaces are removed when saving a document, " -"either in the entire document or only of modified lines." -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, lblRemoveTrailingSpaces) -#: dialogs/opensaveconfigwidget.ui:162 -#, fuzzy -#| msgid "Re&move trailing spaces" -msgid "Re&move trailing spaces:" -msgstr "ट्रेलिंग स्पेसेस हटाएँ (&m)" - -#. i18n: ectx: property (text), item, widget (QComboBox, cbRemoveTrailingSpaces) -#: dialogs/opensaveconfigwidget.ui:176 -#, fuzzy -#| msgid "Reverse" -msgid "Never" -msgstr "विपरीत" - -#. i18n: ectx: property (text), item, widget (QComboBox, cbRemoveTrailingSpaces) -#: dialogs/opensaveconfigwidget.ui:181 -#, fuzzy -#| msgid "Scroll Line Up" -msgid "On Modified Lines" -msgstr "पंक्ति ऊपर स्क्रॉल करें" - -#. i18n: ectx: property (text), item, widget (QComboBox, cbRemoveTrailingSpaces) -#: dialogs/opensaveconfigwidget.ui:186 -#, fuzzy -#| msgid "&Word Wrap Document" -msgid "In Entire Document" -msgstr "वर्ड रैप दस्तावेज़ (&W)" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkNewLineAtEof) -#: dialogs/opensaveconfigwidget.ui:209 -msgid "" -"On save, a line break is appended to the document if not already present. " -"The line break is visible after reloading the file." -msgstr "" - -#. i18n: ectx: property (text), widget (QCheckBox, chkNewLineAtEof) -#: dialogs/opensaveconfigwidget.ui:212 -msgid "Append newline at end of file on save" -msgstr "" - -#. i18n: ectx: property (whatsThis), widget (QGroupBox, gbWordWrap) -#: dialogs/textareaappearanceconfigwidget.ui:9 view/kateview.cpp:521 -msgid "" -"If this option is checked, the text lines will be wrapped at the view border " -"on the screen." -msgstr "यदि यह विकल्प चुना जाता है, पाठ पंक्तियाँ स्क्रीन के दृश्य किनारे पर रैप होंगी." - -#. i18n: ectx: property (title), widget (QGroupBox, gbWordWrap) -#: dialogs/textareaappearanceconfigwidget.ui:12 view/kateview.cpp:518 -msgid "&Dynamic Word Wrap" -msgstr "गतिशील वर्ड रैप (&D)" - -#. i18n: ectx: property (text), widget (QLabel, lblDynamicWordWrapIndicators) -#: dialogs/textareaappearanceconfigwidget.ui:21 -msgid "Dynamic &word wrap indicators (if applicable):" -msgstr "गतिशील पाठ लपेट सूचक (यदि लागू हो): (&w)" - -#. i18n: ectx: property (whatsThis), widget (KComboBox, cmbDynamicWordWrapIndicator) -#: dialogs/textareaappearanceconfigwidget.ui:31 -msgid "Choose when the Dynamic Word Wrap Indicators should be displayed." -msgstr "चुनें कि कब गतिशील पाठ लपेट सूचक दिखें" - -#. i18n: ectx: property (text), widget (QLabel, lblDynamicWordWrapIndicators_2) -#: dialogs/textareaappearanceconfigwidget.ui:38 -#, fuzzy -msgid "Align dynamically wrapped lines to indentation depth:" -msgstr "विज़ेट के सिरों पर क्या पंक्तियों को व्रैप करना है" - -#. i18n: ectx: property (whatsThis), widget (QSpinBox, sbDynamicWordWrapDepth) -#: dialogs/textareaappearanceconfigwidget.ui:54 -#, no-c-format -msgid "" -"<p>Enables the start of dynamically wrapped lines to be aligned vertically " -"to the indentation level of the first line. This can help to make code and " -"markup more readable.</p><p>Additionally, this allows you to set a maximum " -"width of the screen, as a percentage, after which dynamically wrapped lines " -"will no longer be vertically aligned. For example, at 50%, lines whose " -"indentation levels are deeper than 50% of the width of the screen will not " -"have vertical alignment applied to subsequent wrapped lines.</p>" -msgstr "" - -#. i18n: ectx: property (suffix), widget (QSpinBox, sbDynamicWordWrapDepth) -#: dialogs/textareaappearanceconfigwidget.ui:60 -#, fuzzy, no-c-format -msgid "% of View Width" -msgstr "दृश्य चौड़ाई का % o" - -#. i18n: ectx: property (title), widget (QGroupBox, gbWhitespaceHighlighting) -#: dialogs/textareaappearanceconfigwidget.ui:76 -#, fuzzy -#| msgid "Highlighting" -msgid "Whitespace Highlighting" -msgstr "उभार रहे" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkShowTabs) -#: dialogs/textareaappearanceconfigwidget.ui:82 -msgid "" -"The editor will display a symbol to indicate the presence of a tab in the " -"text." -msgstr "संपादक एक चिह्न दिखाएगा कि पाठ में टैब उपस्थित है" - -#. i18n: ectx: property (text), widget (QCheckBox, chkShowTabs) -#: dialogs/textareaappearanceconfigwidget.ui:85 -msgid "&Highlight tabulators" -msgstr "टेबुलेटर उभारें (&H)" - -#. i18n: ectx: property (text), widget (QCheckBox, chkShowSpaces) -#: dialogs/textareaappearanceconfigwidget.ui:92 -msgid "Highlight trailing &spaces" -msgstr "ट्रेलिंग स्थान उभारें (&s)" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkShowIndentationLines) -#: dialogs/textareaappearanceconfigwidget.ui:108 -#, fuzzy -msgid "" -"If this is enabled, the editor will display vertical lines to help identify " -"indent lines." -msgstr "यदि यह विकल्प चुना जाता है, हर नया दृश्य बाएँ हाथ तरफ पंक्ति क्रमांक दिखाएगा." - -#. i18n: ectx: property (text), widget (QCheckBox, chkShowIndentationLines) -#: dialogs/textareaappearanceconfigwidget.ui:111 -#, fuzzy -msgid "Show i&ndentation lines" -msgstr "स्नेप लकीरें दिखाएँ" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkShowWholeBracketExpression) -#: dialogs/textareaappearanceconfigwidget.ui:118 -msgid "" -"If this is enabled, the range between the selected matching brackets will be " -"highlighted." -msgstr "" - -#. i18n: ectx: property (text), widget (QCheckBox, chkShowWholeBracketExpression) -#: dialogs/textareaappearanceconfigwidget.ui:121 -msgid "Highlight range between selected brackets" -msgstr "" - -#. i18n: ectx: property (toolTip), widget (QCheckBox, chkAnimateBracketMatching) -#: dialogs/textareaappearanceconfigwidget.ui:128 -#, fuzzy -#| msgid "Select to Matching Bracket" -msgid "Flash matching brackets" -msgstr "मैचिंग ब्रेकेट चुनें" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkAnimateBracketMatching) -#: dialogs/textareaappearanceconfigwidget.ui:131 -msgid "" -"If this is enabled, matching brackets are animated for better visibility." -msgstr "" - -#. i18n: ectx: property (text), widget (QCheckBox, chkAnimateBracketMatching) -#: dialogs/textareaappearanceconfigwidget.ui:134 -msgid "Animate bracket matching" -msgstr "" - -#: document/katebuffer.cpp:182 -#, fuzzy -#| msgid "New Filetype" -msgctxt "short translation, user created new file" -msgid "New file" -msgstr "नया फ़ाइल क़िस्म" - -#: document/katebuffer.cpp:190 -#, kde-format -msgid "The file %1 does not exist." -msgstr "" - -#: document/katedocument.cpp:2064 -#, fuzzy, kde-format -#| msgid "" -#| "The file %1 could not be loaded, as it was not possible to read from it.\n" -#| "\n" -#| "Check if you have read access to this file." -msgid "" -"The file %1 could not be loaded, as it was not possible to read from it.<br /" -">Check if you have read access to this file." -msgstr "" -"फ़ाइल %1 लोड नहीं किया जा सका, चूंकि इसे पढ़ा जाना संभव नहीं है!\n" -"\n" -"जांच करें कि आपके पास इस फ़ाइल को पढ़ने की अनुमति है." - -#: document/katedocument.cpp:2067 -msgctxt "translators: you can also translate 'Try Again' with 'Reload'" -msgid "Try Again" -msgstr "" - -#: document/katedocument.cpp:2070 document/katedocument.cpp:5615 -msgid "&Close" -msgstr "" - -#: document/katedocument.cpp:2071 document/katedocument.cpp:5616 -msgid "Close message" -msgstr "" - -#: document/katedocument.cpp:2082 -#, kde-format -msgid "" -"The file %1 could not be loaded, as it was not possible to read from it.\n" -"\n" -"Check if you have read access to this file." -msgstr "" -"फ़ाइल %1 लोड नहीं किया जा सका, चूंकि इसे पढ़ा जाना संभव नहीं है!\n" -"\n" -"जांच करें कि आपके पास इस फ़ाइल को पढ़ने की अनुमति है." - -#: document/katedocument.cpp:2202 -#, kde-format -msgid "" -"The file %1 was opened with %2 encoding but contained invalid characters." -"<br />It is set to read-only mode, as saving might destroy its content.<br /" -">Either reopen the file with the correct encoding chosen or enable the read-" -"write mode again in the menu to be able to edit it." -msgstr "" - -#: document/katedocument.cpp:2212 -#, kde-format -msgid "" -"The file %1 was opened with %2 encoding but contained invalid characters. It " -"is set to read-only mode, as saving might destroy its content. Either reopen " -"the file with the correct encoding chosen or enable the read-write mode " -"again in the menu to be able to edit it." -msgstr "" - -#: document/katedocument.cpp:2223 -#, kde-format -msgid "" -"The file %1 was opened and contained lines longer than the configured Line " -"Length Limit (%2 characters).<br />The longest of those lines was %3 " -"characters long<br/>Those lines were wrapped and the document is set to read-" -"only mode, as saving will modify its content." -msgstr "" - -#: document/katedocument.cpp:2228 -msgid "Temporarily raise limit and reload file" -msgstr "" - -#: document/katedocument.cpp:2231 -msgid "Close" -msgstr "" - -#: document/katedocument.cpp:2237 -#, kde-format -msgid "" -"The file %1 was opened and contained lines longer than the configured Line " -"Length Limit (%2 characters).<br/>The longest of those lines was %3 " -"characters long<br/>Those lines were wrapped and the document is set to read-" -"only mode, as saving will modify its content." -msgstr "" - -#: document/katedocument.cpp:2259 -msgid "" -"Do you really want to save this unmodified file? You could overwrite changed " -"data in the file on disk." -msgstr "" -"क्या आप वास्तव में इस अपरिवर्धित फ़ाइल को सहेजना चाहेंगे? डिस्क में फ़ाइल के बदले गए डाटा को " -"मिटाकर आप लिख देंगे" - -#: document/katedocument.cpp:2259 -msgid "Trying to Save Unmodified File" -msgstr "अपरिवर्धित फ़ाइल को सहेजने की कोशिश की जा रही है" - -#: document/katedocument.cpp:2259 document/katedocument.cpp:2264 -#: document/katedocument.cpp:2276 -msgid "Save Nevertheless" -msgstr "जैसे भी हो, सहेजें" - -#: document/katedocument.cpp:2264 -msgid "" -"Do you really want to save this file? Both your open file and the file on " -"disk were changed. There could be some data lost." -msgstr "" -"क्या आप वास्तव में इस फ़ाइल को सहेजना चाहते हैं? आपकी खुली फ़ाइल तथा डिस्क की फ़ाइल दोनों " -"बदलेंगी. वहां कुछ डाटा नुकसान हो सकता है." - -#: document/katedocument.cpp:2264 document/katedocument.cpp:2276 -#: document/katedocument.cpp:2518 -msgid "Possible Data Loss" -msgstr "संभावित डाटा नुकसान" - -#: document/katedocument.cpp:2276 -msgid "" -"The selected encoding cannot encode every unicode character in this " -"document. Do you really want to save it? There could be some data lost." -msgstr "" -"चयनित एनकोडिंग इस दस्तावेज़ के प्रत्येक यूनिकोड अक्षर को एनकोड नहीं कर सकता. क्या आप " -"वाकई इसे सहेजना चाहते हैं? यहाँ कुछ डाटा नुकसान हो सकता है." - -#: document/katedocument.cpp:2343 -#, kde-format -msgid "" -"For file %1 no backup copy could be created before saving. If an error " -"occurs while saving, you might lose the data of this file. A reason could be " -"that the media you write to is full or the directory of the file is read-" -"only for you." -msgstr "" - -#: document/katedocument.cpp:2346 -msgid "Failed to create backup copy." -msgstr "बैकअप प्रतिलिपि बनाने में असफल." - -#: document/katedocument.cpp:2347 -msgid "Try to Save Nevertheless" -msgstr "जो भी हो, सहेजने की कोशिश करें" - -#: document/katedocument.cpp:2386 document/katedocument.cpp:4063 -#, kde-format -msgid "" -"The document could not be saved, as it was not possible to write to %1.\n" -"\n" -"Check that you have write access to this file or that enough disk space is " -"available." -msgstr "" -"दस्तावेज़ सहेजा नहीं जा सका, चूंकि %1 पर लिखा नहीं जा सका.\n" -"\n" -" जाँचें कि इस फ़ाइल पर आपके पास लिखने की अनुमति है तथा डिस्क में पर्याप्त जगह उपलब्ध है." - -#: document/katedocument.cpp:2517 -msgid "Do you really want to continue to close this file? Data loss may occur." -msgstr "क्या आप वास्तव में इस फ़ाइल को बंद करना चाहेंगे? डाटा नुकसान हो सकता है." - -#: document/katedocument.cpp:2518 -msgid "Close Nevertheless" -msgstr "जो भी हो, बन्द करें" - -#: document/katedocument.cpp:3830 -msgid "Untitled" -msgstr "शीर्षकहीन" - -#: document/katedocument.cpp:3866 document/katedocument.cpp:4031 -#: document/katedocument.cpp:4684 -msgid "Save File" -msgstr "फ़ाइल सहेजें" - -#: document/katedocument.cpp:3873 -msgid "Save failed" -msgstr "सहेजना असफल" - -#: document/katedocument.cpp:3939 -msgid "File Was Changed on Disk" -msgstr "फ़ाइल को डिस्क में बदल दिया गया है" - -#: document/katedocument.cpp:4047 -#, fuzzy -#| msgid "Save File" -msgid "Save Copy of File" -msgstr "फ़ाइल सहेजें" - -#: document/katedocument.cpp:4278 -msgid "" -"Using deprecated modeline 'remove-trailing-space'. Please replace with " -"'remove-trailing-spaces modified;', see http://docs.kde.org/stable/en/kde-" -"baseapps/kate/config-variables.html#variable-remove-trailing-spaces" -msgstr "" - -#: document/katedocument.cpp:4283 -msgid "" -"Using deprecated modeline 'replace-trailing-space-save'. Please replace with " -"'remove-trailing-spaces all;', see http://docs.kde.org/stable/en/kde-" -"baseapps/kate/config-variables.html#variable-remove-trailing-spaces" -msgstr "" - -#: document/katedocument.cpp:4559 -#, kde-format -msgid "The file '%1' was modified by another program." -msgstr "फ़ाइल '%1' डिस्क में अन्य प्रोग्राम द्वारा परिवर्धित किया गया है." - -#: document/katedocument.cpp:4562 -#, kde-format -msgid "The file '%1' was created by another program." -msgstr "फ़ाइल '%1' डिस्क में अन्य प्रोग्राम द्वारा बनाया गया है." - -#: document/katedocument.cpp:4565 -#, kde-format -msgid "The file '%1' was deleted by another program." -msgstr "फ़ाइल '%1' डिस्क में अन्य प्रोग्राम द्वारा मिटाया गया है." - -#: document/katedocument.cpp:4712 -#, kde-format -msgid "" -"A file named \"%1\" already exists. Are you sure you want to overwrite it?" -msgstr "" -"फ़ाइल नाम \"%1\" पहले से ही अस्तित्व में है. क्या आप इसके ऊपर ही मिटाकर लिखना चाहेंगे?" - -#: document/katedocument.cpp:4714 -msgid "Overwrite File?" -msgstr "फ़ाइल के ऊपर लिखें?" - -#: document/katedocument.cpp:4922 -#, kde-format -msgid "" -"The document \"%1\" has been modified.\n" -"Do you want to save your changes or discard them?" -msgstr "" - -#: document/katedocument.cpp:4924 -#, fuzzy -#| msgid "&Word Wrap Document" -msgid "Close Document" -msgstr "वर्ड रैप दस्तावेज़ (&W)" - -#: document/katedocument.cpp:5057 -#, kde-format -msgid "The file <a href=\"%1\">%2</a> is still loading." -msgstr "" - -#: document/katedocument.cpp:5064 -msgid "&Abort Loading" -msgstr "" - -#: export/exporter.cpp:63 -msgid "Export File as HTML" -msgstr "फ़ाइल को एचटीएमएल के रूप में निर्यात करें" - -#: inputmode/katenormalinputmode.cpp:92 -msgid "OVERWRITE" -msgstr "" - -#: inputmode/katenormalinputmode.cpp:92 -msgid "INSERT" -msgstr "" - -#: inputmode/katenormalinputmodefactory.cpp:52 -#, fuzzy -#| msgid "Normal Text" -msgid "Normal Mode" -msgstr "सामान्य पाठ" - -#: inputmode/kateviinputmode.cpp:116 -msgid "vi-mode" -msgstr "" - -#: inputmode/kateviinputmode.cpp:129 -#, fuzzy -#| msgid "E&ncoding" -msgid "recording" -msgstr "एनकोडिंग (&n)" - -#: inputmode/kateviinputmodefactory.cpp:54 utils/kateglobal.cpp:106 -#: vimode/kateviinputmodeconfigtab.cpp:231 -msgid "Vi Input Mode" -msgstr "" - -#: mode/katemodeconfigpage.cpp:60 -msgid "<Unchanged>" -msgstr "<अपरिवर्तित>" - -#: mode/katemodeconfigpage.cpp:71 -#, fuzzy -#| msgid "Use Default Style" -msgid "Use Default" -msgstr "डिफ़ॉल्ट शैली इस्तेमाल करें" - -#: mode/katemodeconfigpage.cpp:184 -msgid "New Filetype" -msgstr "नया फ़ाइल क़िस्म" - -#: mode/katemodeconfigpage.cpp:238 -#, kde-format -msgid "Properties of %1" -msgstr " %1 के गुण" - -#: mode/katemodeconfigpage.cpp:288 -msgid "" -"Select the MimeTypes you want for this file type.\n" -"Please note that this will automatically edit the associated file extensions " -"as well." -msgstr "" -"माइम क़िस्म चुनें जो आप इस फ़ाइल क़िस्म के लिए चाहते हैं.\n" -"कृपया टीप लें कि यह स्वचलित ही सम्बद्ध फ़ाइल एक्सटेंशन का संपादन भी कर देगा." - -#: mode/katemodeconfigpage.cpp:290 -msgid "Select Mime Types" -msgstr "माइम क़िस्म चुनें" - -#: mode/katemodeconfigpage.cpp:307 -#, fuzzy -#| msgid "Modes & Filetypes" -msgid "Modes && Filetypes" -msgstr "मोड व फ़ाइल-क़िस्में" - -#: printing/printconfigwidgets.cpp:49 -msgid "Te&xt Settings" -msgstr "पाठ विन्यास (&x)" - -#: printing/printconfigwidgets.cpp:53 -#, fuzzy -#| msgid "Print &line numbers" -msgid "Print line &numbers" -msgstr "पंक्ति क्रमांक छापें (&l)" - -#: printing/printconfigwidgets.cpp:56 -#, fuzzy -#| msgid "Print &line numbers" -msgid "Print &legend" -msgstr "पंक्ति क्रमांक छापें (&l)" - -#: printing/printconfigwidgets.cpp:65 -msgid "" -"<p>If enabled, line numbers will be printed on the left side of the page(s)." -"</p>" -msgstr "<p>यदि सक्षम किया जाता है, पंक्ति क्रमांक पृष्ठों के बाएँ बाज़ू में मुद्रित होंगे.</p>" - -#: printing/printconfigwidgets.cpp:67 -msgid "" -"<p>Print a box displaying typographical conventions for the document type, " -"as defined by the syntax highlighting being used.</p>" -msgstr "" - -#: printing/printconfigwidgets.cpp:119 -msgid "Hea&der && Footer" -msgstr "शीर्ष-सूचना व पाद-सूचना " - -#: printing/printconfigwidgets.cpp:126 -msgid "Pr&int header" -msgstr "शीर्ष-सूचना छापें (&i)" - -#: printing/printconfigwidgets.cpp:128 -msgid "Pri&nt footer" -msgstr "पाद-सूचना छापें (&n)" - -#: printing/printconfigwidgets.cpp:134 -msgid "Header/footer font:" -msgstr "शीर्ष-सूचना/पाद-सूचना फ़ॉन्ट:" - -#: printing/printconfigwidgets.cpp:139 -msgid "Choo&se Font..." -msgstr "फ़ॉन्ट चुनें... (&s)" - -#: printing/printconfigwidgets.cpp:145 -msgid "Header Properties" -msgstr "शीर्ष-सूचना गुण" - -#: printing/printconfigwidgets.cpp:149 -msgid "&Format:" -msgstr "फॉर्मेट: (&F)" - -#: printing/printconfigwidgets.cpp:171 printing/printconfigwidgets.cpp:217 -msgid "Colors:" -msgstr "रंग:" - -#: printing/printconfigwidgets.cpp:178 printing/printconfigwidgets.cpp:224 -msgid "Foreground:" -msgstr "अग्रभूमि:" - -#: printing/printconfigwidgets.cpp:183 -msgid "Bac&kground" -msgstr "पृष्ठभूमि (&k)" - -#: printing/printconfigwidgets.cpp:189 -msgid "Footer Properties" -msgstr "पाद-सूचना गुण" - -#: printing/printconfigwidgets.cpp:194 -msgid "For&mat:" -msgstr "फॉर्मेट: (&m)" - -#: printing/printconfigwidgets.cpp:229 -msgid "&Background" -msgstr "पृष्ठभूमि (&B)" - -#: printing/printconfigwidgets.cpp:258 -msgid "<p>Format of the page header. The following tags are supported:</p>" -msgstr "<p>पृष्ठ शीर्ष-सूचना का फार्मेट. निम्न टैग्स समर्थित हैं:</p>" - -#: printing/printconfigwidgets.cpp:260 -msgid "" -"<ul><li><tt>%u</tt>: current user name</li><li><tt>%d</tt>: complete date/" -"time in short format</li><li><tt>%D</tt>: complete date/time in long format</" -"li><li><tt>%h</tt>: current time</li><li><tt>%y</tt>: current date in short " -"format</li><li><tt>%Y</tt>: current date in long format</li><li><tt>%f</tt>: " -"file name</li><li><tt>%U</tt>: full URL of the document</li><li><tt>%p</tt>: " -"page number</li><li><tt>%P</tt>: total amount of pages</li></ul><br />" -msgstr "" - -#: printing/printconfigwidgets.cpp:274 -msgid "<p>Format of the page footer. The following tags are supported:</p>" -msgstr "<p>पृष्ठ पाद-सूचना का फार्मेट. निम्न टैग्स समर्थित हैं:</p>" - -#: printing/printconfigwidgets.cpp:353 -#, kde-format -msgid "%1, %2pt" -msgstr "" - -#: printing/printconfigwidgets.cpp:372 -#, fuzzy -#| msgid "Use Placeholders" -msgid "Add Placeholder..." -msgstr "प्लेसहोल्डर्स का प्रयोग करें" - -#: printing/printconfigwidgets.cpp:374 -#, fuzzy -#| msgid "Current line:" -msgid "Current User Name" -msgstr "मौज़ूदा पंक्ति:" - -#: printing/printconfigwidgets.cpp:376 -msgid "Complete Date/Time (short format)" -msgstr "" - -#: printing/printconfigwidgets.cpp:378 -msgid "Complete Date/Time (long format)" -msgstr "" - -#: printing/printconfigwidgets.cpp:380 -#, fuzzy -#| msgid "Current line:" -msgid "Current Time" -msgstr "मौज़ूदा पंक्ति:" - -#: printing/printconfigwidgets.cpp:382 -msgid "Current Date (short format)" -msgstr "" - -#: printing/printconfigwidgets.cpp:384 -msgid "Current Date (long format)" -msgstr "" - -#: printing/printconfigwidgets.cpp:386 -#, fuzzy -#| msgid "File Masks" -msgid "File Name" -msgstr "फ़ाइल मास्क्स" - -#: printing/printconfigwidgets.cpp:388 -msgid "Full document URL" -msgstr "" - -#: printing/printconfigwidgets.cpp:390 -msgid "Page Number" -msgstr "" - -#: printing/printconfigwidgets.cpp:392 -msgid "Total Amount of Pages" -msgstr "" - -#: printing/printconfigwidgets.cpp:501 -msgid "L&ayout" -msgstr "विन्यास (&a)" - -#: printing/printconfigwidgets.cpp:507 schema/kateschemaconfig.cpp:917 -msgid "&Schema:" -msgstr "योजना: (&S)" - -#: printing/printconfigwidgets.cpp:514 -msgid "Draw bac&kground color" -msgstr "पृष्ठभूमि रंग बनाएँ (&k)" - -#: printing/printconfigwidgets.cpp:517 -msgid "Draw &boxes" -msgstr "बक्से बनाएँ (&b)" - -#: printing/printconfigwidgets.cpp:521 -msgid "Box Properties" -msgstr "बक्सा गुण" - -#: printing/printconfigwidgets.cpp:525 -msgid "W&idth:" -msgstr "चौड़ाई: (&i)" - -#: printing/printconfigwidgets.cpp:533 -msgid "&Margin:" -msgstr "हाशिया: (&M)" - -#: printing/printconfigwidgets.cpp:541 -msgid "Co&lor:" -msgstr "रंग: (&l)" - -#: printing/printconfigwidgets.cpp:563 -msgid "Select the color scheme to use for the print." -msgstr "" - -#: printing/printconfigwidgets.cpp:565 -msgid "" -"<p>If enabled, the background color of the editor will be used.</p><p>This " -"may be useful if your color scheme is designed for a dark background.</p>" -msgstr "" -"<p>यदि सक्षम किया जाता है, संपादक का पृष्ठ भूमि रंग उपयोग किया जाएगा.</p><p>यदि " -"आपकी रंग योजना गहरी पृष्ठभूमि के लिए डिजाइन्ड है, तो यह उपयोगी होगा.</p>" - -#: printing/printconfigwidgets.cpp:568 -msgid "" -"<p>If enabled, a box as defined in the properties below will be drawn around " -"the contents of each page. The Header and Footer will be separated from the " -"contents with a line as well.</p>" -msgstr "" -"<p>यदि सक्षम किया जाता है, एक बाक्स जैसा कि नीचे गुण में पारिभाषित है हर पृष्ठ के " -"विषयवस्तु में बना दिया जाएगा. शीर्ष-सूचना तथा पाद-सूचना भी विषयवस्तु से एक पंक्ति से अलग " -"किए हुए होंगे</p>" - -#: printing/printconfigwidgets.cpp:572 -msgid "The width of the box outline" -msgstr "आउटलाइन बक्से की चौड़ाई" - -#: printing/printconfigwidgets.cpp:574 -msgid "The margin inside boxes, in pixels" -msgstr "बक्सों के भीतर हाशिए, पिक्सेल्स में" - -#: printing/printconfigwidgets.cpp:576 -msgid "The line color to use for boxes" -msgstr "बक्सों के लिए उपयोग में पंक्ति रंग" - -#: printing/printpainter.cpp:274 -msgid "(Selection of) " -msgstr "(का चयन)" - -#: printing/printpainter.cpp:530 -#, kde-format -msgid "Typographical Conventions for %1" -msgstr "%1 के लिए टाइपोग्राफिकल कन्वर्सन" - -#: printing/printpainter.cpp:561 -#, fuzzy -#| msgid "Next" -msgid "text" -msgstr "अगला" - -#. i18n: ectx: property (text), widget (QLabel, label) -#: schema/howtoimportschema.ui:17 -#, fuzzy -#| msgid "What do you want to do?" -msgid "How do you want to import the schema?" -msgstr "आप क्या करना चाहते हैं?" - -#. i18n: ectx: property (text), widget (QRadioButton, radioReplaceCurrent) -#: schema/howtoimportschema.ui:24 -#, fuzzy -#| msgid "Replace next match" -msgid "Replace current schema?" -msgstr "अगला मिलान बदलें" - -#. i18n: ectx: property (text), widget (QRadioButton, radioReplaceExisting) -#: schema/howtoimportschema.ui:34 schema/kateschemaconfig.cpp:1075 -#, fuzzy, no-c-format, kde-format -#| msgid "Replace next match" -msgid "Replace existing schema %1" -msgstr "अगला मिलान बदलें" - -#. i18n: ectx: property (text), widget (QRadioButton, radioAsNew) -#: schema/howtoimportschema.ui:43 -#, fuzzy -#| msgid "Name for New Schema" -msgid "Import as new schema:" -msgstr "नई योजना का नाम" - -#: schema/katecolortreewidget.cpp:53 schema/katecolortreewidget.cpp:80 -msgid "Use default color from the KDE color scheme" -msgstr "" - -#: schema/kateschemaconfig.cpp:59 -#, fuzzy -#| msgid "Font & Color Schemas" -msgid "Use KDE Color Scheme" -msgstr "फ़ॉन्ट व रंग प्रसंग" - -#: schema/kateschemaconfig.cpp:85 -#, fuzzy -#| msgid "Unset Background Color" -msgid "Editor Background Colors" -msgstr "पृष्ठभूमि का रंग अनसेट करें" - -#: schema/kateschemaconfig.cpp:87 -#, fuzzy -#| msgid "Text Area Background" -msgid "Text Area" -msgstr "पाठ क्षेत्र पृष्ठभूमि" - -#: schema/kateschemaconfig.cpp:89 -msgid "<p>Sets the background color of the editing area.</p>" -msgstr "<p>संपादन क्षेत्र के पृष्ठभूमि रंग नियत करे.</p>" - -#: schema/kateschemaconfig.cpp:93 -#, fuzzy -#| msgid "Selected text:" -msgid "Selected Text" -msgstr "चुना गया पाठ:" - -#: schema/kateschemaconfig.cpp:95 -#, fuzzy -#| msgid "" -#| "<p>Sets the background color of the selection.</p><p>To set the text " -#| "color for selected text, use the \"<b>Configure Highlighting</b>\" dialog." -#| "</p>" -msgid "" -"<p>Sets the background color of the selection.</p><p>To set the text color " -"for selected text, use the "<b>Configure Highlighting</b>" dialog." -"</p>" -msgstr "" -"<p>चुने गए का पृष्ठभूमि रंग नियत करता है.</p><p>चुने गए पाठ का पाठ रंग नियत करने के लिए " -"इस्तेमाल करें \"<b>कॉन्फ़िगर उभारें</b>\" संवाद.</p>" - -#: schema/kateschemaconfig.cpp:99 -#, fuzzy -#| msgid "Current line:" -msgid "Current Line" -msgstr "मौज़ूदा पंक्ति:" - -#: schema/kateschemaconfig.cpp:101 -msgid "" -"<p>Sets the background color of the currently active line, which means the " -"line where your cursor is positioned.</p>" -msgstr "" -"<p>मौज़ूदा सक्रिय पंक्ति की पृष्ठभूमि रंग नियत करे, इसका अर्थ है, वह पंक्ति जहाँ आपका संकेतक " -"स्थित है.</p>" - -#: schema/kateschemaconfig.cpp:105 -#, fuzzy -#| msgid "Highlighting" -msgid "Search Highlight" -msgstr "उभार रहे" - -#: schema/kateschemaconfig.cpp:107 -#, fuzzy -#| msgid "<p>Sets the background color of the editing area.</p>" -msgid "<p>Sets the background color of search results.</p>" -msgstr "<p>संपादन क्षेत्र के पृष्ठभूमि रंग नियत करे.</p>" - -#: schema/kateschemaconfig.cpp:111 -#, fuzzy -#| msgid "Highlighting" -msgid "Replace Highlight" -msgstr "उभार रहे" - -#: schema/kateschemaconfig.cpp:113 -#, fuzzy -#| msgid "<p>Sets the background color of the editing area.</p>" -msgid "<p>Sets the background color of replaced text.</p>" -msgstr "<p>संपादन क्षेत्र के पृष्ठभूमि रंग नियत करे.</p>" - -#: schema/kateschemaconfig.cpp:120 -#, fuzzy -#| msgid "Show &Icon Border" -msgid "Icon Border" -msgstr "प्रतीक किनारा दिखाएँ (&I)" - -#: schema/kateschemaconfig.cpp:122 -#, fuzzy -#| msgid "Background" -msgid "Background Area" -msgstr "पृष्ठभूमि" - -#: schema/kateschemaconfig.cpp:124 -#, fuzzy -#| msgid "<p>Sets the background color of the editing area.</p>" -msgid "<p>Sets the background color of the icon border.</p>" -msgstr "<p>संपादन क्षेत्र के पृष्ठभूमि रंग नियत करे.</p>" - -#: schema/kateschemaconfig.cpp:128 -#, fuzzy -#| msgid "Line numbers:" -msgid "Line Numbers" -msgstr "पंक्ति क्रमांक:" - -#: schema/kateschemaconfig.cpp:130 -#, fuzzy -msgid "<p>This color will be used to draw the line numbers (if enabled).</p>" -msgstr "" -"डेस्कटॉप मेनू और उपकरण-पटिया प्रेफरेंसेज़ के हिसाब से उपकरण-पटिया के बटन स्टाइल ल सेट कर लेव" - -#: schema/kateschemaconfig.cpp:134 -msgid "Separator" -msgstr "" - -#: schema/kateschemaconfig.cpp:136 -msgid "" -"<p>This color will be used to draw the line between line numbers and the " -"icon borders, if both are enabled.</p>" -msgstr "" - -#: schema/kateschemaconfig.cpp:140 -#, fuzzy -#| msgid "Word wrap markers:" -msgid "Word Wrap Marker" -msgstr "वर्ड रैप निशान:" - -#: schema/kateschemaconfig.cpp:142 -msgid "" -"<p>Sets the color of Word Wrap-related markers:</p><dl><dt>Static Word Wrap</" -"dt><dd>A vertical line which shows the column where text is going to be " -"wrapped</dd><dt>Dynamic Word Wrap</dt><dd>An arrow shown to the left of " -"visually-wrapped lines</dd></dl>" -msgstr "" -"<p>वर्ड रैप रिलेटेड निशान के रंग नियत करे:</p><dl><dt>स्थिर वर्ड रैप</dt><dd>एक खड़ी " -"पंक्ति दर्शाती है कि स्तम्भ जहाँ पाठ रैप होने हैं</dd><dt>गतिशील वर्ड रैप</dt><dd>विज़ुअली " -"रैप्ड पंक्तियों के बाएँ एक तीर दिखाई देगा</dd></dl>" - -#: schema/kateschemaconfig.cpp:146 -msgid "Code Folding" -msgstr "कोड फोल्डिंग" - -#: schema/kateschemaconfig.cpp:148 -#, fuzzy -#| msgid "<p>Sets the background color of the editing area.</p>" -msgid "<p>Sets the color of the code folding bar.</p>" -msgstr "<p>संपादन क्षेत्र के पृष्ठभूमि रंग नियत करे.</p>" - -#: schema/kateschemaconfig.cpp:152 -#, fuzzy -#| msgid "Scroll Line Up" -msgid "Modified Lines" -msgstr "पंक्ति ऊपर स्क्रॉल करें" - -#: schema/kateschemaconfig.cpp:154 -#, fuzzy -msgid "" -"<p>Sets the color of the line modification marker for modified lines.</p>" -msgstr "<p>टेबुलेटर मार्क्स के रंग को नियत करता है:</p>" - -#: schema/kateschemaconfig.cpp:158 -#, fuzzy -#| msgid "Save File" -msgid "Saved Lines" -msgstr "फ़ाइल सहेजें" - -#: schema/kateschemaconfig.cpp:160 -#, fuzzy -msgid "<p>Sets the color of the line modification marker for saved lines.</p>" -msgstr "<p>टेबुलेटर मार्क्स के रंग को नियत करता है:</p>" - -#: schema/kateschemaconfig.cpp:167 -#, fuzzy -#| msgid "Text Selection Mode" -msgid "Text Decorations" -msgstr "पाठ चयन मोड" - -#: schema/kateschemaconfig.cpp:169 -msgid "Spelling Mistake Line" -msgstr "" - -#: schema/kateschemaconfig.cpp:171 -#, fuzzy -msgid "" -"<p>Sets the color of the line that is used to indicate spelling mistakes.</p>" -msgstr "<p>टेबुलेटर मार्क्स के रंग को नियत करता है:</p>" - -#: schema/kateschemaconfig.cpp:175 -#, fuzzy -#| msgid "Tab and space markers:" -msgid "Tab and Space Markers" -msgstr "टैब तथा स्पेस चिह्नक:" - -#: schema/kateschemaconfig.cpp:177 -#, fuzzy -msgid "<p>Sets the color of the tabulator marks.</p>" -msgstr "<p>टेबुलेटर मार्क्स के रंग को नियत करता है:</p>" - -#: schema/kateschemaconfig.cpp:181 -#, fuzzy -#| msgid "Indentation" -msgid "Indentation Line" -msgstr "जगह छोड़ना" - -#: schema/kateschemaconfig.cpp:183 -#, fuzzy -msgid "<p>Sets the color of the vertical indentation lines.</p>" -msgstr "<p>टेबुलेटर मार्क्स के रंग को नियत करता है:</p>" - -#: schema/kateschemaconfig.cpp:187 -#, fuzzy -#| msgid "Bracket highlight:" -msgid "Bracket Highlight" -msgstr "ब्रेकेट उभारें:" - -#: schema/kateschemaconfig.cpp:189 -msgid "" -"<p>Sets the bracket matching color. This means, if you place the cursor e.g. " -"at a <b>(</b>, the matching <b>)</b> will be highlighted with this color.</p>" -msgstr "" -"<p>ब्रेकेट मेचिंग रंग नियत करे. इसका अर्थ है यदि आप संकेतक यहाँ रखेंगे <b>(</b>, मेचिंग <b>)</" -"b> इस रंग से उभर जाएगा.</p>" - -#: schema/kateschemaconfig.cpp:196 -#, fuzzy -#| msgid "Colors" -msgid "Marker Colors" -msgstr "रंग" - -#: schema/kateschemaconfig.cpp:199 view/kateviewhelpers.cpp:1189 -msgid "Bookmark" -msgstr " पसंदीदा " - -#: schema/kateschemaconfig.cpp:200 -msgid "Active Breakpoint" -msgstr "सक्रिय ब्रेकपाइन्ट" - -#: schema/kateschemaconfig.cpp:201 -msgid "Reached Breakpoint" -msgstr "रीच्ड ब्रेकपाइन्ट" - -#: schema/kateschemaconfig.cpp:202 -msgid "Disabled Breakpoint" -msgstr "अक्षम ब्रेकपाइन्ट" - -#: schema/kateschemaconfig.cpp:203 -msgid "Execution" -msgstr "चलाना" - -#: schema/kateschemaconfig.cpp:204 -msgid "Warning" -msgstr "चेतावनी" - -#: schema/kateschemaconfig.cpp:205 -msgid "Error" -msgstr "त्रुटि" - -#: schema/kateschemaconfig.cpp:208 -#, fuzzy -#| msgid "" -#| "<p>Sets the background color of the selected marker type.</p><p><b>Note</" -#| "b>: The marker color is displayed lightly because of transparency.</p>" -msgid "" -"<p>Sets the background color of mark type.</p><p><b>Note</b>: The marker " -"color is displayed lightly because of transparency.</p>" -msgstr "" -"<p>चुने गए मार्कर क़िस्म का पृष्ठभूमि रंग सेट करता है.</p><p><b>Note</b>: पारदर्शी होने के " -"कारण मार्कर का रंग हल्का दिखेगा.</p>" - -#: schema/kateschemaconfig.cpp:219 -msgid "Text Templates & Snippets" -msgstr "" - -#: schema/kateschemaconfig.cpp:223 -#, fuzzy -#| msgid "Background" -msgid "Background" -msgstr "पृष्ठभूमि" - -#: schema/kateschemaconfig.cpp:228 -#, fuzzy -#| msgid "Template Editable Placeholder" -msgid "Editable Placeholder" -msgstr "टेम्पलेट संपादनयोग्य प्लेसहोल्डर" - -#: schema/kateschemaconfig.cpp:233 -#, fuzzy -msgid "Focused Editable Placeholder" -msgstr "स्थानधारक क्लिक करें और ओवरराइट करें" - -#: schema/kateschemaconfig.cpp:238 -#, fuzzy -msgid "Not Editable Placeholder" -msgstr "नमूने को खोल नहीं सकते है ।" - -#: schema/kateschemaconfig.cpp:466 -msgid "" -"<p>This list displays the default styles for the current schema and offers " -"the means to edit them. The style name reflects the current style settings.</" -"p><p>To edit the colors, click the colored squares, or select the color to " -"edit from the popup menu.</p><p>You can unset the Background and Selected " -"Background colors from the popup menu when appropriate.</p>" -msgstr "" - -#: schema/kateschemaconfig.cpp:501 -#, fuzzy -#| msgid "Normal Text" -msgctxt "@item:intable" -msgid "Normal Text & Source Code" -msgstr "सामान्य पाठ" - -#: schema/kateschemaconfig.cpp:510 -msgctxt "@item:intable" -msgid "Numbers, Types & Constants" -msgstr "" - -#: schema/kateschemaconfig.cpp:519 -#, fuzzy -#| msgid "Set of characters" -msgctxt "@item:intable" -msgid "Strings & Characters" -msgstr "अक्षरों के समूह" - -#: schema/kateschemaconfig.cpp:528 -#, fuzzy -msgctxt "@item:intable" -msgid "Comments & Documentation" -msgstr "स्नेप लकीरें दिखाएँ" - -#: schema/kateschemaconfig.cpp:537 -msgctxt "@item:intable" -msgid "Miscellaneous" -msgstr "" - -#: schema/kateschemaconfig.cpp:610 -msgid "H&ighlight:" -msgstr "उभारें: (&i)" - -#: schema/kateschemaconfig.cpp:620 schema/kateschemaconfig.cpp:934 -#, fuzzy -#| msgid "E&xport as HTML..." -msgid "Export..." -msgstr "एचटीएमएल रूप में निर्यात करें... (&x)" - -#: schema/kateschemaconfig.cpp:624 schema/kateschemaconfig.cpp:938 -#, fuzzy -#| msgid "Normal &Color..." -msgid "Import..." -msgstr "सामान्य रंग (&C)" - -#: schema/kateschemaconfig.cpp:657 -msgid "" -"<p>This list displays the contexts of the current syntax highlight mode and " -"offers the means to edit them. The context name reflects the current style " -"settings.</p><p>To edit using the keyboard, press <strong><SPACE></" -"strong> and choose a property from the popup menu.</p><p>To edit the colors, " -"click the colored squares, or select the color to edit from the popup menu.</" -"p><p>You can unset the Background and Selected Background colors from the " -"context menu when appropriate.</p>" -msgstr "" - -#: schema/kateschemaconfig.cpp:678 -#, fuzzy -#| msgid "Highlighting for Scheme" -msgid "Loading all highlightings for schema" -msgstr "योजना के लिए उभारें" - -#: schema/kateschemaconfig.cpp:799 -msgid "Importing colors for single highlighting" -msgstr "" - -#: schema/kateschemaconfig.cpp:801 schema/kateschemaconfig.cpp:872 -#: schema/kateschemaconfig.cpp:991 schema/kateschemaconfig.cpp:1122 -#, fuzzy -#| msgid "Font & Color Schemas" -msgid "Kate color schema" -msgstr "फ़ॉन्ट व रंग प्रसंग" - -#: schema/kateschemaconfig.cpp:815 -msgid "File is not a single highlighting color file" -msgstr "" - -#: schema/kateschemaconfig.cpp:816 schema/kateschemaconfig.cpp:1133 -#, fuzzy -#| msgid "File Format" -msgid "Fileformat error" -msgstr "फ़ाइल फार्मेट" - -#: schema/kateschemaconfig.cpp:826 -#, kde-format -msgid "The selected file contains colors for a non existing highlighting:%1" -msgstr "" - -#: schema/kateschemaconfig.cpp:827 -msgid "Import failure" -msgstr "" - -#: schema/kateschemaconfig.cpp:850 -#, kde-format -msgid "Colors have been imported for highlighting: %1" -msgstr "" - -#: schema/kateschemaconfig.cpp:851 -msgid "Import has finished" -msgstr "" - -#: schema/kateschemaconfig.cpp:870 -#, kde-format -msgid "Exporting colors for single highlighting: %1" -msgstr "" - -#: schema/kateschemaconfig.cpp:926 -msgid "&New..." -msgstr "नया... (&N)" - -#: schema/kateschemaconfig.cpp:949 -msgid "Colors" -msgstr "रंग" - -#: schema/kateschemaconfig.cpp:953 -msgid "Font" -msgstr "फ़ॉन्ट" - -#: schema/kateschemaconfig.cpp:957 -#, fuzzy -#| msgid "Normal Text Styles" -msgid "Default Text Styles" -msgstr "सामान्य पाठ शैली" - -#: schema/kateschemaconfig.cpp:961 -msgid "Highlighting Text Styles" -msgstr "पाठ शैलियाँ उभार रहे" - -#: schema/kateschemaconfig.cpp:967 -#, kde-format -msgid "&Default schema for %1:" -msgstr " %1हेतु डिफ़ॉल्ट योजना: (&D)" - -#: schema/kateschemaconfig.cpp:989 -#, fuzzy, kde-format -#| msgid "Font & Color Schemas" -msgid "Exporting color schema: %1" -msgstr "फ़ॉन्ट व रंग प्रसंग" - -#: schema/kateschemaconfig.cpp:1021 -msgid "Exporting schema" -msgstr "" - -#: schema/kateschemaconfig.cpp:1120 -#, fuzzy -#| msgid "Font & Color Schemas" -msgid "Importing Color Schema" -msgstr "फ़ॉन्ट व रंग प्रसंग" - -#: schema/kateschemaconfig.cpp:1132 -msgid "The file does not contain a full color schema." -msgstr "" - -#: schema/kateschemaconfig.cpp:1139 -#, fuzzy -#| msgid "Namespace" -msgid "Name unspecified" -msgstr "नेमस्पेस" - -#: schema/kateschemaconfig.cpp:1189 -msgid "Importing schema" -msgstr "" - -#: schema/kateschemaconfig.cpp:1332 -msgid "Name for New Schema" -msgstr "नई योजना का नाम" - -#: schema/kateschemaconfig.cpp:1332 -msgid "Name:" -msgstr "नाम:" - -#: schema/kateschemaconfig.cpp:1332 schema/kateschemaconfig.cpp:1340 -msgid "New Schema" -msgstr "नई योजना" - -#: schema/kateschemaconfig.cpp:1340 -#, kde-format -msgid "" -"<p>The schema %1 already exists.</p><p>Please choose a different schema name." -"</p>" -msgstr "" - -#: schema/kateschemaconfig.cpp:1375 -msgid "Fonts & Colors" -msgstr "फ़ॉन्ट व रंग" - -#: schema/kateschemaconfig.cpp:1380 -msgid "Font & Color Schemas" -msgstr "फ़ॉन्ट व रंग प्रसंग" - -#: schema/katestyletreewidget.cpp:137 -#, fuzzy -#| msgid "Context" -msgctxt "@title:column Meaning of text in editor" -msgid "Context" -msgstr "कॉन्टेक्स्ट" - -#: schema/katestyletreewidget.cpp:137 -#, fuzzy -#| msgid "Normal" -msgctxt "@title:column Text style" -msgid "Normal" -msgstr "सामान्य" - -#: schema/katestyletreewidget.cpp:137 -#, fuzzy -#| msgid "Selected" -msgctxt "@title:column Text style" -msgid "Selected" -msgstr "चुना गया" - -#: schema/katestyletreewidget.cpp:137 -#, fuzzy -#| msgid "Background" -msgctxt "@title:column Text style" -msgid "Background" -msgstr "पृष्ठभूमि" - -#: schema/katestyletreewidget.cpp:137 -#, fuzzy -#| msgid "Background Selected" -msgctxt "@title:column Text style" -msgid "Background Selected" -msgstr "पृष्ठभूमि चुने गए" - -#: schema/katestyletreewidget.cpp:139 -msgid "Use Default Style" -msgstr "डिफ़ॉल्ट शैली इस्तेमाल करें" - -#: schema/katestyletreewidget.cpp:233 -msgid "&Bold" -msgstr "गाढ़ा (&B)" - -#: schema/katestyletreewidget.cpp:238 -msgid "&Italic" -msgstr "तिरछा (&I)" - -#: schema/katestyletreewidget.cpp:243 -msgid "&Underline" -msgstr "रेखांकित (&U)" - -#: schema/katestyletreewidget.cpp:248 -msgid "S&trikeout" -msgstr "लिखकर-काटें (&t)" - -#: schema/katestyletreewidget.cpp:255 -msgid "Normal &Color..." -msgstr "सामान्य रंग (&C)" - -#: schema/katestyletreewidget.cpp:258 -msgid "&Selected Color..." -msgstr "चुने गए रंग (&S)" - -#: schema/katestyletreewidget.cpp:261 -msgid "&Background Color..." -msgstr "पृष्ठभूमि रंग... (&B)" - -#: schema/katestyletreewidget.cpp:264 -msgid "S&elected Background Color..." -msgstr "चयनित पृष्ठभूमि का रंग... (&e)" - -#: schema/katestyletreewidget.cpp:270 -#, fuzzy -#| msgid "Normal &Color..." -msgid "Unset Normal Color" -msgstr "सामान्य रंग (&C)" - -#: schema/katestyletreewidget.cpp:273 -#, fuzzy -#| msgid "Unset Selected Background Color" -msgid "Unset Selected Color" -msgstr "चयनित पृष्ठभूमि रंग अनसेट करें" - -#: schema/katestyletreewidget.cpp:279 -msgid "Unset Background Color" -msgstr "पृष्ठभूमि का रंग अनसेट करें" - -#: schema/katestyletreewidget.cpp:284 -msgid "Unset Selected Background Color" -msgstr "चयनित पृष्ठभूमि रंग अनसेट करें" - -#: schema/katestyletreewidget.cpp:290 -msgid "Use &Default Style" -msgstr "डिफ़ॉल्ट शैली इस्तेमाल करें (&D)" - -#: schema/katestyletreewidget.cpp:404 -#, fuzzy -#| msgid "None set" -msgctxt "No text or background color set" -msgid "None set" -msgstr "सेट नहीं" - -#: schema/katestyletreewidget.cpp:637 -msgid "" -"\"Use Default Style\" will be automatically unset when you change any style " -"properties." -msgstr "\"डिफ़ॉल्ट शैली इस्तेमाल करें\" स्वचलित अनसेट होगा जब आप कोई शैली गुण बदलेंगे" - -#: schema/katestyletreewidget.cpp:638 -msgid "Kate Styles" -msgstr "के-एटीई शैलियाँ" - -#: script/data/commands/emmet.js:18 -msgid "" -"Expands the abbreviation using Emmet expressions; see http://code.google.com/" -"p/zen-coding/wiki/ZenHTMLSelectorsEn" -msgstr "" - -#: script/data/commands/emmet.js:19 -msgid "" -"Wraps the selected text in XML tags constructed from the provided Emmet " -"expression (defaults to div)." -msgstr "" - -#: script/data/commands/emmet.js:20 -msgid "Moves the caret to the current tag's pair" -msgstr "" - -#: script/data/commands/emmet.js:21 -msgid "" -"Select contents of HTML/XML tag, moving inward on continuous invocations" -msgstr "" - -#: script/data/commands/emmet.js:22 -msgid "" -"Select contents of HTML/XML tag, moving outwards on continuous invocations" -msgstr "" - -#: script/data/commands/emmet.js:23 -msgid "Move to the next edit point (tag or empty attribute)." -msgstr "" - -#: script/data/commands/emmet.js:24 -msgid "Move to the previous edit point (tag or empty attribute)." -msgstr "" - -#: script/data/commands/emmet.js:25 -#, fuzzy -#| msgid "Select to Next Line" -msgid "Select next edit point (tag or empty attribute)." -msgstr "अगली पंक्ति चुनें" - -#: script/data/commands/emmet.js:26 -#, fuzzy -#| msgid "Select to Previous Line" -msgid "Select previous edit point (tag or empty attribute)." -msgstr "पिछली पंक्ति चुनें" - -#: script/data/commands/emmet.js:27 -msgid "Toggle comment of current tag or CSS selector" -msgstr "" - -#: script/data/commands/emmet.js:28 -#, fuzzy -#| msgid "Delete the current file type." -msgid "Deletes tag under cursor" -msgstr "वर्तमान फ़ाइल क़िस्म मिटाएँ." - -#: script/data/commands/emmet.js:29 -msgid "Splits or joins a tag" -msgstr "" - -#: script/data/commands/emmet.js:30 -msgid "Evaluates a simple math expression" -msgstr "" - -#: script/data/commands/emmet.js:31 -msgid "Decrement number under cursor by 1" -msgstr "" - -#: script/data/commands/emmet.js:32 -msgid "Decrement number under cursor by 10" -msgstr "" - -#: script/data/commands/emmet.js:33 -msgid "Decrement number under cursor by 0.1" -msgstr "" - -#: script/data/commands/emmet.js:34 -msgid "Increment number under cursor by 1" -msgstr "" - -#: script/data/commands/emmet.js:35 -msgid "Increment number under cursor by 10" -msgstr "" - -#: script/data/commands/emmet.js:36 -msgid "Increment number under cursor by 0.1" -msgstr "" - -#: script/data/commands/emmet.js:45 -msgid "Emmet" -msgstr "" - -#: script/data/commands/emmet.js:49 -msgid "Expand abbreviation" -msgstr "" - -#: script/data/commands/emmet.js:51 -msgid "Wrap with tag" -msgstr "" - -#: script/data/commands/emmet.js:54 -#, fuzzy -#| msgid "Move to Matching Bracket" -msgid "Move cursor to matching tag" -msgstr "मैचिंग ब्रेकेट में जाएँ" - -#: script/data/commands/emmet.js:56 -msgid "Select HTML/XML tag contents inwards" -msgstr "" - -#: script/data/commands/emmet.js:58 -msgid "Select HTML/XML tag contents outwards" -msgstr "" - -#: script/data/commands/emmet.js:60 -#, fuzzy -#| msgid "Comment" -msgid "Toggle comment" -msgstr "टिप्पणी" - -#: script/data/commands/emmet.js:62 -msgid "Go to next edit point" -msgstr "" - -#: script/data/commands/emmet.js:64 -#, fuzzy -#| msgid "Move to Previous Line" -msgid "Go to previous edit point" -msgstr "पिछली पंक्ति पर जाएँ" - -#: script/data/commands/emmet.js:66 -#, fuzzy -#| msgid "Select to Next Line" -msgid "Select next edit point" -msgstr "अगली पंक्ति चुनें" - -#: script/data/commands/emmet.js:68 -#, fuzzy -#| msgid "Select to Previous Line" -msgid "Select previous edit point" -msgstr "पिछली पंक्ति चुनें" - -#: script/data/commands/emmet.js:70 -msgid "Delete tag under cursor" -msgstr "" - -#: script/data/commands/emmet.js:72 -msgid "Split or join a tag" -msgstr "" - -#: script/data/commands/emmet.js:74 -msgid "Evaluate a simple math expression" -msgstr "" - -#: script/data/commands/emmet.js:76 -msgid "Decrement number by 1" -msgstr "" - -#: script/data/commands/emmet.js:78 -msgid "Decrement number by 10" -msgstr "" - -#: script/data/commands/emmet.js:80 -msgid "Decrement number by 0.1" -msgstr "" - -#: script/data/commands/emmet.js:82 -msgid "Increment number by 1" -msgstr "" - -#: script/data/commands/emmet.js:84 -msgid "Increment number by 10" -msgstr "" - -#: script/data/commands/emmet.js:86 -msgid "Increment number by 0.1" -msgstr "" - -#: script/data/commands/jumpMatchingIndent.js:33 -#, fuzzy -#| msgid "Configuration" -msgid "Navigation" -msgstr "कॉन्फ़िगरेशन" - -#: script/data/commands/jumpMatchingIndent.js:36 -#: script/data/commands/jumpMatchingIndent.js:50 -#, fuzzy -#| msgid "Move to Matching Bracket" -msgid "Move cursor to previous matching indent" -msgstr "मैचिंग ब्रेकेट में जाएँ" - -#: script/data/commands/jumpMatchingIndent.js:40 -#: script/data/commands/jumpMatchingIndent.js:53 -#, fuzzy -#| msgid "Move to Matching Bracket" -msgid "Move cursor to next matching indent" -msgstr "मैचिंग ब्रेकेट में जाएँ" - -#: script/data/commands/quickcoding.js:19 -msgid "Quick Coding" -msgstr "" - -#: script/data/commands/quickcoding.js:22 -msgid "Expand Abbreviation" -msgstr "" - -#: script/data/commands/quickcoding.js:32 -msgid "Expand Quick Coding Abbreviation" -msgstr "" - -#: script/data/commands/utils.js:333 -#, fuzzy -#| msgid "Selected text:" -msgid "Sort Selected Text" -msgstr "चुना गया पाठ:" - -#: script/data/commands/utils.js:336 -#, fuzzy -#| msgid "Scroll Line Down" -msgid "Move Lines Down" -msgstr "पंक्ति नीचे स्क्रॉल करें" - -#: script/data/commands/utils.js:339 -#, fuzzy -#| msgid "Scroll Line Up" -msgid "Move Lines Up" -msgstr "पंक्ति ऊपर स्क्रॉल करें" - -#: script/data/commands/utils.js:342 -msgid "Duplicate Selected Lines Up" -msgstr "" - -#: script/data/commands/utils.js:345 -msgid "Duplicate Selected Lines Down" -msgstr "" - -#: script/data/commands/utils.js:348 -#, fuzzy -#| msgid "Selected text:" -msgid "URI-encode Selected Text" -msgstr "चुना गया पाठ:" - -#: script/data/commands/utils.js:351 -#, fuzzy -#| msgid "Selected text:" -msgid "URI-decode Selected Text" -msgstr "चुना गया पाठ:" - -#: script/data/commands/utils.js:361 -#, fuzzy -#| msgid "Select the entire text of the current document." -msgid "Sort the selected text or whole document." -msgstr "मौज़ूदा दस्तावेज़ का संपूर्ण पाठ चुनें" - -#: script/data/commands/utils.js:363 -#, fuzzy -#| msgid "Selected" -msgid "Move selected lines down." -msgstr "चुना गया" - -#: script/data/commands/utils.js:365 -#, fuzzy -#| msgid "Selected" -msgid "Move selected lines up." -msgstr "चुना गया" - -#: script/data/commands/utils.js:367 -msgid "Remove duplicate lines from the selected text or whole document." -msgstr "" - -#: script/data/commands/utils.js:369 -msgid "" -"Sort the selected text or whole document in natural order.<br>Here is an " -"example to show the difference to the normal sort method:<br>sort(a10, a1, " -"a2) => a1, a10, a2<br>natsort(a10, a1, a2) => a1, a2, a10" -msgstr "" - -#: script/data/commands/utils.js:371 -msgid "Trims trailing whitespace from selection or whole document." -msgstr "" - -#: script/data/commands/utils.js:373 -msgid "Trims leading whitespace from selection or whole document." -msgstr "" - -#: script/data/commands/utils.js:375 -msgid "Trims leading and trailing whitespace from selection or whole document." -msgstr "" - -#: script/data/commands/utils.js:377 -msgid "" -"Joins selected lines or whole document. Optionally pass a separator to put " -"between each line:<br><code>join ', '</code> will e.g. join lines and " -"separate them by a comma." -msgstr "" - -#: script/data/commands/utils.js:379 -msgid "Removes empty lines from selection or whole document." -msgstr "" - -#: script/data/commands/utils.js:383 -msgid "" -"Given a JavaScript function as argument, call that for the list of " -"(selected) lines and replace them with the return value of that callback." -"<br>Example (join selected lines):<br><code>each 'function(lines){return " -"lines.join(\", \");}'</code><br>To save you some typing, you can also do " -"this to achieve the same:<br><code>each 'lines.join(\", \")'</code>" -msgstr "" - -#: script/data/commands/utils.js:385 -msgid "" -"Given a JavaScript function as argument, call that for the list of " -"(selected) lines and remove those where the callback returns false." -"<br>Example (see also <code>rmblank</code>):<br><code>filter 'function(l)" -"{return l.length > 0;}'</code><br>To save you some typing, you can also do " -"this to achieve the same:<br><code>filter 'line.length > 0'</code>" -msgstr "" - -#: script/data/commands/utils.js:387 -msgid "" -"Given a JavaScript function as argument, call that for the list of " -"(selected) lines and replace the line with the return value of the callback." -"<br>Example (see also <code>ltrim</code>):<br><code>map 'function(line)" -"{return line.replace(/^\\s+/, \"\");}'</code><br>To save you some typing, " -"you can also do this to achieve the same:<br><code>map 'line.replace(/^\\s" -"+/, \"\")'</code>" -msgstr "" - -#: script/data/commands/utils.js:389 -msgid "Duplicates the selected lines up." -msgstr "" - -#: script/data/commands/utils.js:391 -msgid "Duplicates the selected lines down." -msgstr "" - -#: script/data/commands/utils.js:393 -msgid "" -"Encode special chars in a single line selection, so the result text can be " -"used as URI." -msgstr "" - -#: script/data/commands/utils.js:395 -msgid "Reverse action of URI encode." -msgstr "" - -#: script/data/indentation/cppstyle.js:2 -#, fuzzy -#| msgid "C Style" -msgctxt "Autoindent mode" -msgid "C++/boost Style" -msgstr "सी शैली" - -#: script/data/indentation/cstyle.js:2 -#, fuzzy -#| msgid "C Style" -msgctxt "Autoindent mode" -msgid "C Style" -msgstr "सी शैली" - -#: script/data/indentation/haskell.js:2 -#, fuzzy -#| msgid "Haskell" -msgctxt "Autoindent mode" -msgid "Haskell" -msgstr "हैसकेल" - -#: script/data/indentation/latex.js:2 -#, fuzzy -#| msgid "Latest" -msgctxt "Autoindent mode" -msgid "Latex" -msgstr "नवीनतम" - -#: script/data/indentation/lilypond.js:2 -#, fuzzy -#| msgid "LilyPond" -msgctxt "Autoindent mode" -msgid "LilyPond" -msgstr "लिलिपाण्ड" - -#: script/data/indentation/lisp.js:2 -msgctxt "Autoindent mode" -msgid "LISP" -msgstr "" - -#: script/data/indentation/lua.js:2 -#, fuzzy -#| msgid "Lua" -msgctxt "Autoindent mode" -msgid "Lua" -msgstr "लुआ" - -#: script/data/indentation/pascal.js:2 -#, fuzzy -#| msgid "Pascal" -msgctxt "Autoindent mode" -msgid "Pascal" -msgstr "पास्कल" - -#: script/data/indentation/python.js:2 -#, fuzzy -#| msgid "Python" -msgctxt "Autoindent mode" -msgid "Python" -msgstr "पायथन" - -#: script/data/indentation/ruby.js:2 -#, fuzzy -#| msgid "Ruby" -msgctxt "Autoindent mode" -msgid "Ruby" -msgstr "रूबी" - -#: script/data/indentation/xml.js:2 -#, fuzzy -#| msgid "XML Style" -msgctxt "Autoindent mode" -msgid "XML Style" -msgstr "एक्सएमएल शैली" - -#: script/katecommandlinescript.cpp:55 -#, kde-format -msgid "Function '%1' not found in script: %2" -msgstr "" - -#: script/katecommandlinescript.cpp:68 -#, fuzzy, kde-format -#| msgid "Error: %1" -msgid "Error calling %1" -msgstr "त्रुटि: %1" - -#: script/katecommandlinescript.cpp:80 -#, kde-format -msgid "Function 'action' not found in script: %1" -msgstr "" - -#: script/katecommandlinescript.cpp:91 -#, fuzzy, kde-format -#| msgid "Error: %1" -msgid "Error calling action(%1)" -msgstr "त्रुटि: %1" - -#: script/katecommandlinescript.cpp:116 -#, kde-format -msgid "Bad quoting in call: %1. Please escape single quotes with a backslash." -msgstr "" - -#: script/katecommandlinescript.cpp:124 script/katescriptmanager.cpp:344 -#: utils/katecmds.cpp:203 vimode/katevicmds.cpp:54 -msgid "Could not access view" -msgstr "दृश्य पर पहुँच नहीं सकता" - -#: script/katecommandlinescript.cpp:166 -#, kde-format -msgid "Error calling 'help %1'" -msgstr "" - -#: script/katecommandlinescript.cpp:171 -#, kde-format -msgid "No help specified for command '%1' in script %2" -msgstr "" - -#: script/katescript.cpp:247 -#, fuzzy, kde-format -#| msgid "Error: %1" -msgid "Error loading script %1\n" -msgstr "त्रुटि: %1" - -#: script/katescript.cpp:248 -#, kde-format -msgid "Error loading script %1" -msgstr "" - -#: script/katescripthelpers.cpp:50 -#, fuzzy, kde-format -#| msgid "Unable to open %1" -msgid "Unable to find '%1'" -msgstr "%1 खोलने में अक्षम" - -#: script/katescriptmanager.cpp:352 script/katescriptmanager.cpp:365 -#, kde-format -msgid "Command not found: %1" -msgstr "कमांड: %1 नहीं मिला." - -#: script/katescriptmanager.cpp:362 -msgid "Reload all JavaScript files (indenters, command line scripts, etc)." -msgstr "" - -#: search/katesearchbar.cpp:81 -msgid "Add..." -msgstr "जोड़ें..." - -#: search/katesearchbar.cpp:349 -#, fuzzy -msgid "Reached top, continued from bottom" -msgstr "ऊपर से;नीचे से;खोज;रद्द करो" - -#: search/katesearchbar.cpp:351 -#, fuzzy -msgid "Reached bottom, continued from top" -msgstr "ऊपर से;नीचे से;खोज;रद्द करो" - -#: search/katesearchbar.cpp:356 -msgid "Not found" -msgstr "नहीं मिला" - -#: search/katesearchbar.cpp:606 -#, fuzzy -msgid "Bottom of file reached. Continue from top?" -msgstr "ऊपर से;नीचे से;खोज;रद्द करो" - -#: search/katesearchbar.cpp:607 -#, fuzzy -msgid "Top of file reached. Continue from bottom?" -msgstr "ऊपर से;नीचे से;खोज;रद्द करो" - -#: search/katesearchbar.cpp:608 -#, fuzzy -#| msgid "Continue from the end?" -msgid "Continue search?" -msgstr "अंत से जारी रखें?" - -#: search/katesearchbar.cpp:615 -#, fuzzy -#| msgid "Continue from the end?" -msgid "Continuing search from top" -msgstr "अंत से जारी रखें?" - -#: search/katesearchbar.cpp:622 -#, fuzzy -#| msgid "Continue from the end?" -msgid "Continuing search from bottom" -msgstr "अंत से जारी रखें?" - -#: search/katesearchbar.cpp:666 -#, fuzzy, kde-format -#| msgid "Not found" -msgctxt "short translation" -msgid "1 match found" -msgid_plural "%1 matches found" -msgstr[0] "नहीं मिला" -msgstr[1] "नहीं मिला" - -#: search/katesearchbar.cpp:908 -#, fuzzy, kde-format -msgctxt "short translation" -msgid "1 replacement made" -msgid_plural "%1 replacements made" -msgstr[0] "" -"1 बदल दिया.\n" -"%n बदल दिए." -msgstr[1] "" -"1 बदल दिया.\n" -"%n बदल दिए." - -#: search/katesearchbar.cpp:1101 -msgid "Beginning of line" -msgstr "पंक्ति का आरंभ" - -#: search/katesearchbar.cpp:1102 -msgid "End of line" -msgstr "पंक्ति का अंत" - -#: search/katesearchbar.cpp:1104 -#, fuzzy -msgid "Any single character (excluding line breaks)" -msgstr "<qt>यह एक अक्षर को मैच करेगा</qt>" - -#: search/katesearchbar.cpp:1106 -#, fuzzy -#| msgid "One or more occurences" -msgid "One or more occurrences" -msgstr "एक या अधिक बार" - -#: search/katesearchbar.cpp:1107 -#, fuzzy -msgid "Zero or more occurrences" -msgstr "दोहराएँ, शून्य या अधिक बार" - -#: search/katesearchbar.cpp:1108 -#, fuzzy -msgid "Zero or one occurrences" -msgstr "Join one or more Projects" - -#: search/katesearchbar.cpp:1109 -#, fuzzy -msgid "<a> through <b> occurrences" -msgstr "इससे होकर लपेटें (~W)" - -#: search/katesearchbar.cpp:1111 -#, fuzzy -msgid "Group, capturing" -msgstr "समूह पाठ" - -#: search/katesearchbar.cpp:1112 -msgid "Or" -msgstr "या" - -#: search/katesearchbar.cpp:1113 -msgid "Set of characters" -msgstr "अक्षरों के समूह" - -#: search/katesearchbar.cpp:1114 -msgid "Negative set of characters" -msgstr "अक्षरों के ऋण समूह" - -#: search/katesearchbar.cpp:1118 -#, fuzzy -msgid "Whole match reference" -msgstr "सिर्फ अंग्रेज़ी के पूरे अक्षरों के जोड़ मिलाएँ" - -#: search/katesearchbar.cpp:1131 -msgid "Reference" -msgstr "संदर्भ" - -#: search/katesearchbar.cpp:1138 -msgid "Line break" -msgstr "पंक्ति ब्रेक" - -#: search/katesearchbar.cpp:1139 -msgid "Tab" -msgstr "टैब" - -#: search/katesearchbar.cpp:1142 -msgid "Word boundary" -msgstr "शब्द सीमा" - -#: search/katesearchbar.cpp:1143 -msgid "Not word boundary" -msgstr "नॉट शब्द सीमा" - -#: search/katesearchbar.cpp:1144 -msgid "Digit" -msgstr "डिजिट" - -#: search/katesearchbar.cpp:1145 -msgid "Non-digit" -msgstr "नॉन-डिजिट" - -#: search/katesearchbar.cpp:1146 -#, fuzzy -msgid "Whitespace (excluding line breaks)" -msgstr "कक्षों में लाइन ब्रेक प्रविष्ट करना" - -#: search/katesearchbar.cpp:1147 -#, fuzzy -msgid "Non-whitespace (excluding line breaks)" -msgstr "कक्षों में लाइन ब्रेक प्रविष्ट करना" - -#: search/katesearchbar.cpp:1148 -#, fuzzy -msgid "Word character (alphanumerics plus '_')" -msgstr "जब डबल क्लिक किया जाए, अक्षर जो अल्फान्यूमेरिक से भिन्न हों, शब्द के भाग समझे जाएँ:" - -#: search/katesearchbar.cpp:1149 -msgid "Non-word character" -msgstr "नॉन-वर्ड अक्षर" - -#: search/katesearchbar.cpp:1152 -#, fuzzy -msgid "Octal character 000 to 377 (2^8-1)" -msgstr "संप्रतीक की लंबरूप केंद्र के लिये पंक्तिकरण" - -#: search/katesearchbar.cpp:1153 -#, fuzzy -msgid "Hex character 0000 to FFFF (2^16-1)" -msgstr "16 : संवाद में रुकें प्रतीक जोड़ें." - -#: search/katesearchbar.cpp:1154 -msgid "Backslash" -msgstr "बैकस्लैश" - -#: search/katesearchbar.cpp:1158 -#, fuzzy -msgid "Group, non-capturing" -msgstr "बिना-खण्डन का अंतर (~p)" - -#: search/katesearchbar.cpp:1159 -#, fuzzy -msgid "Lookahead" -msgstr "Neg. आगे देखें" - -#: search/katesearchbar.cpp:1160 -#, fuzzy -msgid "Negative lookahead" -msgstr "नकारात्मक विचलन" - -#: search/katesearchbar.cpp:1165 -msgid "Begin lowercase conversion" -msgstr "लोअरकेस रूपांतरण चालू करें" - -#: search/katesearchbar.cpp:1166 -msgid "Begin uppercase conversion" -msgstr "अपरकेस रूपांतरण चालू करें" - -#: search/katesearchbar.cpp:1167 -msgid "End case conversion" -msgstr "केस रूपांतरण बन्द करें" - -#: search/katesearchbar.cpp:1168 -#, fuzzy -#| msgid "Begin lowercase conversion" -msgid "Lowercase first character conversion" -msgstr "लोअरकेस रूपांतरण चालू करें" - -#: search/katesearchbar.cpp:1169 -#, fuzzy -#| msgid "Begin uppercase conversion" -msgid "Uppercase first character conversion" -msgstr "अपरकेस रूपांतरण चालू करें" - -#: search/katesearchbar.cpp:1170 -#, fuzzy -msgid "Replacement counter (for Replace All)" -msgstr "सारे अद्वितीय प्रविष्टि को प्रतिस्थापित करें" - -#. i18n: ectx: property (text), widget (QLabel, label) -#: search/searchbarincremental.ui:32 search/searchbarpower.ui:32 -#, fuzzy -#| msgid "Find:" -msgid "F&ind:" -msgstr "ढूंढें:" - -#. i18n: ectx: property (toolTip), widget (KComboBox, pattern) -#: search/searchbarincremental.ui:60 search/searchbarpower.ui:54 -msgid "Text to search for" -msgstr "ढूंढा जाने वाला पाठ" - -#. i18n: ectx: property (toolTip), widget (QPushButton, findNext) -#. i18n: ectx: property (toolTip), widget (QPushButton, next) -#: search/searchbarincremental.ui:73 search/searchbarpower.ui:67 -msgid "Jump to next match" -msgstr "अगले मेल-खाते पाठ में जाएँ" - -#. i18n: ectx: property (text), widget (QPushButton, findNext) -#. i18n: ectx: property (text), widget (QPushButton, next) -#: search/searchbarincremental.ui:76 search/searchbarpower.ui:70 -#, fuzzy -#| msgid "Next" -msgid "&Next" -msgstr "अगला" - -#. i18n: ectx: property (toolTip), widget (QPushButton, findPrev) -#. i18n: ectx: property (toolTip), widget (QPushButton, prev) -#: search/searchbarincremental.ui:88 search/searchbarpower.ui:77 -msgid "Jump to previous match" -msgstr "पिछले मेल-खाते पाठ में जाएँ" - -#. i18n: ectx: property (text), widget (QPushButton, findPrev) -#. i18n: ectx: property (text), widget (QPushButton, prev) -#: search/searchbarincremental.ui:91 search/searchbarpower.ui:80 -#, fuzzy -#| msgid "Previous" -msgid "&Previous" -msgstr "पिछला" - -#. i18n: ectx: property (text), widget (QCheckBox, matchCase) -#: search/searchbarincremental.ui:119 search/searchbarpower.ui:214 -msgid "&Match case" -msgstr "अक्ष मिलाएँ (&M)" - -#. i18n: ectx: property (toolTip), widget (QToolButton, mutate) -#: search/searchbarincremental.ui:145 -#, fuzzy -msgid "Switch to power search and replace bar" -msgstr "" -"संवाद के बगैर मानक पट्टी में सामग्रियों तथा फ़ॉर्मेट को मिटाने के लिए \\<emph\\>काटें\\</" -"emph\\> का इस्तेमाल करें." - -#. i18n: ectx: property (text), widget (QLabel, label_3) -#: search/searchbarpower.ui:92 -#, fuzzy -#| msgid "Replace:" -msgid "Rep&lace:" -msgstr "बदलें:" - -#. i18n: ectx: property (toolTip), widget (KComboBox, replacement) -#: search/searchbarpower.ui:111 -msgid "Text to replace with" -msgstr "पाठ जिसे बदलना है" - -#. i18n: ectx: property (toolTip), widget (QPushButton, replaceNext) -#: search/searchbarpower.ui:124 -msgid "Replace next match" -msgstr "अगला मिलान बदलें" - -#. i18n: ectx: property (text), widget (QPushButton, m_replaceBtn) -#. i18n: ectx: property (text), widget (QPushButton, replaceNext) -#: search/searchbarpower.ui:127 spellcheck/spellcheckbar.ui:130 -msgid "&Replace" -msgstr "बदलें (&R)" - -#. i18n: ectx: property (toolTip), widget (QPushButton, replaceAll) -#: search/searchbarpower.ui:134 -msgid "Replace all matches" -msgstr "सभी मिलानों को बदलें" - -#. i18n: ectx: property (text), widget (QPushButton, replaceAll) -#: search/searchbarpower.ui:137 -#, fuzzy -#| msgid "Replace &all" -msgid "Replace &All" -msgstr "सभी बदलें (&a)" - -#. i18n: ectx: property (toolTip), widget (QComboBox, searchMode) -#: search/searchbarpower.ui:165 -msgid "Search mode" -msgstr "सर्च मोड" - -#. i18n: ectx: property (text), item, widget (QComboBox, searchMode) -#: search/searchbarpower.ui:175 -#, fuzzy -#| msgid "Plain text" -msgid "Plain text" -msgstr "सादा पाठ" - -#. i18n: ectx: property (text), item, widget (QComboBox, searchMode) -#: search/searchbarpower.ui:180 -#, fuzzy -#| msgid "Whole words" -msgid "Whole words" -msgstr "संपूर्ण शब्द" - -#. i18n: ectx: property (text), item, widget (QComboBox, searchMode) -#: search/searchbarpower.ui:185 -#, fuzzy -#| msgid "Escape sequences" -msgid "Escape sequences" -msgstr "एस्केप अनुक्रम" - -#. i18n: ectx: property (text), item, widget (QComboBox, searchMode) -#: search/searchbarpower.ui:190 -msgid "Regular expression" -msgstr "रेगुलर एक्सप्रेशन" - -#. i18n: ectx: property (toolTip), widget (QCheckBox, matchCase) -#: search/searchbarpower.ui:211 -msgid "Case-sensitive searching" -msgstr "केस संवेदनशील खोज" - -#. i18n: ectx: property (text), widget (QCheckBox, selectionOnly) -#: search/searchbarpower.ui:221 -#, fuzzy -#| msgid "Selection Only" -msgid "Selection &only" -msgstr "सिर्फ चयन" - -#. i18n: ectx: property (text), widget (QLabel, label_2) -#: search/searchbarpower.ui:230 -#, fuzzy -#| msgid "&Mode" -msgid "Mo&de:" -msgstr "मोड (&M)" - -#. i18n: ectx: property (text), widget (QPushButton, findAll) -#: search/searchbarpower.ui:243 -#, fuzzy -#| msgid "&Find Next" -msgid "&Find All" -msgstr "अगला ढूंढें (&F)" - -#. i18n: ectx: property (toolTip), widget (QToolButton, mutate) -#: search/searchbarpower.ui:254 -#, fuzzy -msgid "Switch to incremental search bar" -msgstr "मेन्यू पट्टी में आने व जाने को स्विच करने के लिए F10 दबाएँ" - -#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel2) -#. i18n: ectx: property (whatsThis), widget (QLabel, m_unknownWord) -#: spellcheck/spellcheckbar.ui:30 spellcheck/spellcheckbar.ui:46 -msgid "" -"<qt><p>This word was considered to be an \"unknown word\" because it does " -"not match any entry in the dictionary currently in use. It may also be a " -"word in a foreign language.</p>\n" -"<p>If the word is not misspelled, you may add it to the dictionary by " -"clicking <b>Add to Dictionary</b>. If you do not want to add the unknown " -"word to the dictionary, but you want to leave it unchanged, click <b>Ignore</" -"b> or <b>Ignore All</b>.</p>\n" -"<p>However, if the word is misspelled, you can try to find the correct " -"replacement in the list below. If you cannot find a replacement there, you " -"may type it in the text box below, and click <b>Replace</b> or <b>Replace " -"All</b>.</p>\n" -"</qt>" -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, textLabel2) -#: spellcheck/spellcheckbar.ui:33 -#, fuzzy -#| msgid "Unknown Property" -msgid "Unknown word:" -msgstr "अज्ञात प्रापर्टी" - -#. i18n: ectx: property (toolTip), widget (QLabel, m_unknownWord) -#: spellcheck/spellcheckbar.ui:40 -#, fuzzy -#| msgid "Unknown Property" -msgid "Unknown word" -msgstr "अज्ञात प्रापर्टी" - -#. i18n: ectx: property (text), widget (QLabel, m_unknownWord) -#: spellcheck/spellcheckbar.ui:49 -msgid "<b>misspelled</b>" -msgstr "" - -#. i18n: ectx: property (whatsThis), widget (QPushButton, m_addBtn) -#: spellcheck/spellcheckbar.ui:72 -msgid "" -"<qt>\n" -"<p>The unknown word was detected and considered unknown because it is not " -"included in the dictionary.<br>\n" -"Click here if you consider the unknown word not to be misspelled, and you " -"want to avoid wrongly detecting it again in the future. If you want to let " -"it remain as is, but not add it to the dictionary, then click <b>Ignore</b> " -"or <b>Ignore All</b> instead.</p>\n" -"</qt>" -msgstr "" - -#. i18n: ectx: property (text), widget (QPushButton, m_addBtn) -#: spellcheck/spellcheckbar.ui:75 -#, fuzzy -#| msgid "&Section:" -msgid "<< Add to Dictionary" -msgstr "खण्ड: (&S)" - -#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel4) -#: spellcheck/spellcheckbar.ui:89 -msgid "" -"<qt>\n" -"<p>If the unknown word is misspelled, you should type the correction for " -"your misspelled word here or select it from the list below.</p>\n" -"<p>You can then click <b>Replace</b> if you want to correct only this " -"occurrence of the word or <b>Replace All</b> if you want to correct all " -"occurrences.</p>\n" -"</qt>" -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, textLabel4) -#: spellcheck/spellcheckbar.ui:92 -#, fuzzy -#| msgid "Text to replace with" -msgid "Replace &with:" -msgstr "पाठ जिसे बदलना है" - -#. i18n: ectx: property (text), widget (QPushButton, m_suggestBtn) -#: spellcheck/spellcheckbar.ui:118 -msgid "S&uggest" -msgstr "" - -#. i18n: ectx: property (whatsThis), widget (QPushButton, m_replaceBtn) -#: spellcheck/spellcheckbar.ui:127 -msgid "" -"<qt>\n" -"<p>Click here to replace this occurrence of the unknown text with the text " -"in the edit box above (to the left).</p>\n" -"</qt>" -msgstr "" - -#. i18n: ectx: property (whatsThis), widget (QPushButton, m_skipBtn) -#: spellcheck/spellcheckbar.ui:140 -msgid "" -"<qt>\n" -"<p>Click here to let this occurrence of the unknown word remain as is.</p>\n" -"<p>This action is useful when the word is a name, an acronym, a foreign word " -"or any other unknown word that you want to use but not add to the dictionary." -"</p>\n" -"</qt>" -msgstr "" - -#. i18n: ectx: property (text), widget (QPushButton, m_skipBtn) -#: spellcheck/spellcheckbar.ui:143 -msgid "&Ignore" -msgstr " नज़र अंदाज़ करें (&I)" - -#. i18n: ectx: property (whatsThis), widget (QLabel, textLabel5) -#. i18n: ectx: property (whatsThis), widget (QComboBox, m_language) -#: spellcheck/spellcheckbar.ui:156 spellcheck/spellcheckbar.ui:174 -msgid "" -"<qt>\n" -"<p>Select the language of the document you are proofing here.</p>\n" -"</qt>" -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, textLabel5) -#: spellcheck/spellcheckbar.ui:159 -#, fuzzy -#| msgid "E Language" -msgid "&Language:" -msgstr "ई लैंग्वेज" - -#. i18n: ectx: property (toolTip), widget (QComboBox, m_language) -#: spellcheck/spellcheckbar.ui:169 -#, fuzzy -#| msgid "" -#| "_: Language Section\n" -#| "Other" -msgid "Language Selection" -msgstr "अन्य" - -#. i18n: ectx: property (whatsThis), widget (QPushButton, m_autoCorrect) -#. i18n: ectx: property (whatsThis), widget (QPushButton, m_skipAllBtn) -#: spellcheck/spellcheckbar.ui:197 spellcheck/spellcheckbar.ui:222 -msgid "" -"<qt>\n" -"<p>Click here to let all occurrences of the unknown word remain as they are." -"</p>\n" -"<p>This action is useful when the word is a name, an acronym, a foreign word " -"or any other unknown word that you want to use but not add to the dictionary." -"</p>\n" -"</qt>" -msgstr "" - -#. i18n: ectx: property (text), widget (QPushButton, m_autoCorrect) -#: spellcheck/spellcheckbar.ui:200 -msgid "Autocorrect" -msgstr "" - -#. i18n: ectx: property (whatsThis), widget (QPushButton, m_replaceAllBtn) -#: spellcheck/spellcheckbar.ui:209 -msgid "" -"<qt>\n" -"<p>Click here to replace all occurrences of the unknown text with the text " -"in the edit box above (to the left).</p>\n" -"</qt>" -msgstr "" - -#. i18n: ectx: property (text), widget (QPushButton, m_replaceAllBtn) -#: spellcheck/spellcheckbar.ui:212 -#, fuzzy -#| msgid "Replace &all" -msgid "R&eplace All" -msgstr "सभी बदलें (&a)" - -#. i18n: ectx: property (text), widget (QPushButton, m_skipAllBtn) -#: spellcheck/spellcheckbar.ui:225 -#, fuzzy -#| msgid "&Ignore" -msgid "I&gnore All" -msgstr " नज़र अंदाज़ करें (&I)" - -#: spellcheck/spellcheckdialog.cpp:65 -#, fuzzy -msgid "Spelling (from cursor)..." -msgstr "संकेतक स्थिति से जाँचें... (&h)" - -#: spellcheck/spellcheckdialog.cpp:68 -#, fuzzy -msgid "Check the document's spelling from the cursor and forward" -msgstr "" -"अन्य दस्तावेज़ में स्विच करें तथा संकेतक को वहाँ रखें जहाँ ड्राइंग वस्तु प्रविष्ट किया गया है." - -#: spellcheck/spellcheckdialog.cpp:71 -msgid "Spellcheck Selection..." -msgstr "वर्तनी जाँच चयन..." - -#: spellcheck/spellcheckdialog.cpp:74 -#, fuzzy -msgid "Check spelling of the selected text" -msgstr "आप चयनित पाठ या सम्पूर्ण दस्तावेज़ की वर्तनी को हस्तचालित जाँच सकते हैं." - -#: spellcheck/spellingmenu.cpp:102 -#, fuzzy -#| msgid "&Ignore" -msgid "Ignore Word" -msgstr " नज़र अंदाज़ करें (&I)" - -#: spellcheck/spellingmenu.cpp:105 -#, fuzzy -#| msgid "&Section:" -msgid "Add to Dictionary" -msgstr "खण्ड: (&S)" - -#: swapfile/kateswapfile.cpp:629 -msgid "The file was not closed properly." -msgstr "" - -#: swapfile/kateswapfile.cpp:633 -#, fuzzy -#| msgid "&Ignore Changes" -msgid "View Changes" -msgstr "परिवर्तनों को नज़र अंदाज़ करें (&I)" - -#: swapfile/kateswapfile.cpp:634 -#, fuzzy -#| msgid "Reverse" -msgid "Recover Data" -msgstr "विपरीत" - -#: swapfile/kateswapfile.cpp:635 -#, fuzzy -#| msgid "Disabled" -msgid "Discard" -msgstr "अक्षम" - -#. i18n: tag language attribute name -#: syntax/data/abap.xml:3 -msgctxt "Language" -msgid "ABAP" -msgstr "" - -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#: syntax/data/abap.xml:3 syntax/data/actionscript.xml:3 syntax/data/ada.xml:3 -#: syntax/data/ansforth94.xml:37 syntax/data/ansic89.xml:27 -#: syntax/data/boo.xml:5 syntax/data/c.xml:3 syntax/data/cg.xml:23 -#: syntax/data/cgis.xml:3 syntax/data/clipper.xml:3 syntax/data/clojure.xml:25 -#: syntax/data/commonlisp.xml:26 syntax/data/component-pascal.xml:13 -#: syntax/data/crk.xml:2 syntax/data/cs.xml:2 syntax/data/d.xml:104 -#: syntax/data/e.xml:3 syntax/data/eiffel.xml:13 syntax/data/fortran.xml:3 -#: syntax/data/freebasic.xml:3 syntax/data/fsharp.xml:12 -#: syntax/data/glsl.xml:3 syntax/data/go.xml:29 syntax/data/grammar.xml:6 -#: syntax/data/haskell.xml:3 syntax/data/haxe.xml:15 syntax/data/idl.xml:3 -#: syntax/data/ilerpg.xml:48 syntax/data/inform.xml:5 syntax/data/java.xml:3 -#: syntax/data/julia.xml:32 syntax/data/kbasic.xml:3 syntax/data/lex.xml:23 -#: syntax/data/literate-haskell.xml:3 syntax/data/logtalk.xml:4 -#: syntax/data/lpc.xml:19 syntax/data/m4.xml:41 syntax/data/modelica.xml:19 -#: syntax/data/modula-2.xml:3 syntax/data/monobasic.xml:13 -#: syntax/data/nemerle.xml:4 syntax/data/nesc.xml:3 syntax/data/noweb.xml:3 -#: syntax/data/objectivec.xml:3 syntax/data/objectivecpp.xml:3 -#: syntax/data/ocaml.xml:12 syntax/data/oors.xml:3 syntax/data/opal.xml:3 -#: syntax/data/opencl.xml:3 syntax/data/protobuf.xml:3 -#: syntax/data/purebasic.xml:3 syntax/data/rapidq.xml:3 -#: syntax/data/rsiidl.xml:3 syntax/data/sather.xml:3 syntax/data/scala.xml:3 -#: syntax/data/sml.xml:3 syntax/data/stata.xml:3 syntax/data/tads3.xml:5 -#: syntax/data/vala.xml:25 syntax/data/xharbour.xml:3 syntax/data/yacc.xml:28 -#: syntax/data/zonnon.xml:3 -#, fuzzy -#| msgid "Sources" -msgctxt "Language Section" -msgid "Sources" -msgstr "सोर्सेज़" - -#. i18n: tag language attribute name -#: syntax/data/abc.xml:5 -#, fuzzy -#| msgid "ABC" -msgctxt "Language" -msgid "ABC" -msgstr "एबीसी" - -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#: syntax/data/abc.xml:5 syntax/data/alert.xml:33 -#: syntax/data/alert_indent.xml:29 syntax/data/changelog.xml:3 -#: syntax/data/cue.xml:3 syntax/data/debianchangelog.xml:3 -#: syntax/data/debiancontrol.xml:3 syntax/data/diff.xml:18 -#: syntax/data/email.xml:6 syntax/data/gdb.xml:10 syntax/data/git-rebase.xml:3 -#: syntax/data/jam.xml:24 syntax/data/lilypond.xml:57 syntax/data/m3u.xml:17 -#: syntax/data/makefile.xml:8 syntax/data/mup.xml:3 syntax/data/povray.xml:8 -#: syntax/data/qmake.xml:3 syntax/data/rib.xml:8 syntax/data/rpmspec.xml:11 -#: syntax/data/valgrind-suppression.xml:3 -#, fuzzy -#| msgid "Other" -msgctxt "Language Section" -msgid "Other" -msgstr "अन्य" - -#. i18n: tag language attribute name -#: syntax/data/actionscript.xml:3 -#, fuzzy -#| msgid "ActionScript 2.0" -msgctxt "Language" -msgid "ActionScript 2.0" -msgstr "एकशन स्क्रिप्ट 2.0" - -#. i18n: tag language attribute name -#: syntax/data/ada.xml:3 -#, fuzzy -#| msgid "Ada" -msgctxt "Language" -msgid "Ada" -msgstr "एडीए" - -#. i18n: tag language attribute name -#: syntax/data/ahdl.xml:3 -#, fuzzy -#| msgid "AHDL" -msgctxt "Language" -msgid "AHDL" -msgstr "एडीएचएल" - -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#: syntax/data/ahdl.xml:3 syntax/data/spice.xml:4 syntax/data/systemc.xml:10 -#: syntax/data/systemverilog.xml:42 syntax/data/vera.xml:42 -#: syntax/data/verilog.xml:3 syntax/data/vhdl.xml:14 -#, fuzzy -#| msgid "Hardware" -msgctxt "Language Section" -msgid "Hardware" -msgstr "हार्डवेयर" - -#. i18n: tag language attribute name -#: syntax/data/ahk.xml:3 -msgctxt "Language" -msgid "AutoHotKey" -msgstr "" - -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#: syntax/data/ahk.xml:3 syntax/data/ample.xml:3 syntax/data/awk.xml:3 -#: syntax/data/bash.xml:11 syntax/data/cubescript.xml:10 -#: syntax/data/dosbat.xml:11 syntax/data/erlang.xml:39 -#: syntax/data/euphoria.xml:32 syntax/data/ferite.xml:3 -#: syntax/data/gnuplot.xml:3 syntax/data/idconsole.xml:3 -#: syntax/data/javascript.xml:6 syntax/data/k.xml:3 syntax/data/ld.xml:4 -#: syntax/data/lsl.xml:14 syntax/data/lua.xml:38 syntax/data/mason.xml:3 -#: syntax/data/mel.xml:23 syntax/data/perl.xml:42 syntax/data/php.xml:67 -#: syntax/data/pig.xml:4 syntax/data/pike.xml:4 syntax/data/puppet.xml:30 -#: syntax/data/python.xml:16 syntax/data/q.xml:3 syntax/data/qml.xml:4 -#: syntax/data/r.xml:11 syntax/data/rexx.xml:3 syntax/data/ruby.xml:33 -#: syntax/data/scheme.xml:43 syntax/data/sed.xml:3 syntax/data/sieve.xml:4 -#: syntax/data/tcl.xml:31 syntax/data/tcsh.xml:11 syntax/data/uscript.xml:3 -#: syntax/data/velocity.xml:3 syntax/data/zsh.xml:11 -#, fuzzy -#| msgid "Scripts" -msgctxt "Language Section" -msgid "Scripts" -msgstr "स्क्रिप्ट्स" - -#. i18n: tag language attribute name -#: syntax/data/alert.xml:33 -#, fuzzy -#| msgid "Alerts" -msgctxt "Language" -msgid "Alerts" -msgstr "चेतावनी" - -#. i18n: tag language attribute name -#: syntax/data/alert_indent.xml:29 -#, fuzzy -#| msgid "Alerts" -msgctxt "Language" -msgid "Alerts_indent" -msgstr "चेतावनी" - -#. i18n: tag language attribute name -#: syntax/data/ample.xml:3 -msgctxt "Language" -msgid "AMPLE" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/ansforth94.xml:37 -msgctxt "Language" -msgid "ANS-Forth94" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/ansic89.xml:27 -#, fuzzy -#| msgid "ANSI C89" -msgctxt "Language" -msgid "ANSI C89" -msgstr "एन्सी सी89" - -#. i18n: tag language attribute name -#: syntax/data/ansys.xml:3 -#, fuzzy -#| msgid "Ansys" -msgctxt "Language" -msgid "Ansys" -msgstr "एनसिस" - -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#: syntax/data/ansys.xml:3 syntax/data/bmethod.xml:3 syntax/data/dot.xml:4 -#: syntax/data/gap.xml:17 syntax/data/gdl.xml:3 syntax/data/mathematica.xml:3 -#: syntax/data/matlab.xml:60 syntax/data/maxima.xml:24 -#: syntax/data/octave.xml:18 syntax/data/replicode.xml:14 -#: syntax/data/sci.xml:3 syntax/data/tibasic.xml:3 syntax/data/yacas.xml:3 -#, fuzzy -#| msgid "Scientific" -msgctxt "Language Section" -msgid "Scientific" -msgstr "वैज्ञानिक" - -#. i18n: tag language attribute name -#: syntax/data/apache.xml:15 -#, fuzzy -#| msgid "Apache Configuration" -msgctxt "Language" -msgid "Apache Configuration" -msgstr "अपाची कॉन्फ़िगरेशन" - -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#: syntax/data/apache.xml:15 syntax/data/asterisk.xml:19 -#: syntax/data/cisco.xml:3 syntax/data/fstab.xml:4 syntax/data/ini.xml:3 -#: syntax/data/mergetagtext.xml:28 syntax/data/nagios.xml:3 -#: syntax/data/varnish.xml:3 syntax/data/varnishtest.xml:3 -#: syntax/data/winehq.xml:3 syntax/data/xorg.xml:3 -#, fuzzy -#| msgid "Configuration" -msgctxt "Language Section" -msgid "Configuration" -msgstr "कॉन्फ़िगरेशन" - -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#: syntax/data/asm-avr.xml:36 syntax/data/asm-dsp56k.xml:4 -#: syntax/data/asm-m68k.xml:4 syntax/data/asm6502.xml:3 -#: syntax/data/fasm.xml:16 syntax/data/gnuassembler.xml:46 -#: syntax/data/mips.xml:3 syntax/data/nasm.xml:43 syntax/data/picsrc.xml:11 -#, fuzzy -#| msgid "Assembler" -msgctxt "Language Section" -msgid "Assembler" -msgstr "असेंबलर" - -#. i18n: tag language attribute name -#: syntax/data/asm-avr.xml:36 -#, fuzzy -#| msgid "AVR Assembler" -msgctxt "Language" -msgid "AVR Assembler" -msgstr "एवीआर असेंबलर" - -#. i18n: tag language attribute name -#: syntax/data/asm-dsp56k.xml:4 -msgctxt "Language" -msgid "Motorola DSP56k" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/asm-m68k.xml:4 -msgctxt "Language" -msgid "Motorola 68k (VASM/Devpac)" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/asm6502.xml:3 -#, fuzzy -#| msgid "Asm6502" -msgctxt "Language" -msgid "Asm6502" -msgstr "एएसएम6502" - -#. i18n: tag language attribute name -#: syntax/data/asn1.xml:16 -#, fuzzy -#| msgid "ASN.1" -msgctxt "Language" -msgid "ASN.1" -msgstr "एएसएन.1" - -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#: syntax/data/asn1.xml:16 syntax/data/asp.xml:3 syntax/data/bibtex.xml:9 -#: syntax/data/ccss.xml:4 syntax/data/coldfusion.xml:3 -#: syntax/data/context.xml:3 syntax/data/css.xml:21 -#: syntax/data/djangotemplate.xml:7 syntax/data/doxygenlua.xml:30 -#: syntax/data/dtd.xml:6 syntax/data/gettext.xml:26 syntax/data/glosstex.xml:3 -#: syntax/data/haml.xml:3 syntax/data/html.xml:7 syntax/data/javadoc.xml:3 -#: syntax/data/jira.xml:13 syntax/data/json.xml:15 syntax/data/jsp.xml:3 -#: syntax/data/latex.xml:3 syntax/data/less.xml:3 syntax/data/mab.xml:3 -#: syntax/data/mako.xml:7 syntax/data/mandoc.xml:3 syntax/data/markdown.xml:38 -#: syntax/data/mediawiki.xml:9 syntax/data/metafont.xml:9 -#: syntax/data/pango.xml:3 syntax/data/postscript.xml:3 syntax/data/ppd.xml:12 -#: syntax/data/relaxngcompact.xml:3 syntax/data/rest.xml:9 -#: syntax/data/restructuredtext.xml:3 syntax/data/rhtml.xml:47 -#: syntax/data/roff.xml:10 syntax/data/scss.xml:23 syntax/data/sgml.xml:3 -#: syntax/data/sisu.xml:3 syntax/data/texinfo.xml:3 syntax/data/textile.xml:18 -#: syntax/data/txt2tags.xml:6 syntax/data/vcard.xml:5 syntax/data/vrml.xml:3 -#: syntax/data/wml.xml:57 syntax/data/xml.xml:9 syntax/data/xmldebug.xml:3 -#: syntax/data/xslt.xml:55 syntax/data/xul.xml:7 syntax/data/yaml.xml:4 -#, fuzzy -#| msgid "Markup" -msgctxt "Language Section" -msgid "Markup" -msgstr "मार्कअप" - -#. i18n: tag language attribute name -#: syntax/data/asp.xml:3 -#, fuzzy -#| msgid "ASP" -msgctxt "Language" -msgid "ASP" -msgstr "एएसपी" - -#. i18n: tag language attribute name -#: syntax/data/asterisk.xml:19 -msgctxt "Language" -msgid "Asterisk" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/awk.xml:3 -#, fuzzy -#| msgid "AWK" -msgctxt "Language" -msgid "AWK" -msgstr "एडबल्यूके" - -#. i18n: tag language attribute name -#: syntax/data/bash.xml:11 -#, fuzzy -#| msgid "Bash" -msgctxt "Language" -msgid "Bash" -msgstr "बैश" - -#. i18n: tag language attribute name -#: syntax/data/bibtex.xml:9 -#, fuzzy -#| msgid "BibTeX" -msgctxt "Language" -msgid "BibTeX" -msgstr "बिब-टेक्स" - -#. i18n: tag language attribute name -#: syntax/data/bmethod.xml:3 -msgctxt "Language" -msgid "B-Method" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/boo.xml:5 -msgctxt "Language" -msgid "Boo" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/c.xml:3 -#, fuzzy -#| msgid "C" -msgctxt "Language" -msgid "C" -msgstr "सी" - -#. i18n: tag language attribute name -#: syntax/data/ccss.xml:4 -msgctxt "Language" -msgid "CleanCSS" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/cg.xml:23 -#, fuzzy -#| msgid "Cg" -msgctxt "Language" -msgid "Cg" -msgstr "सीजी" - -#. i18n: tag language attribute name -#: syntax/data/cgis.xml:3 -#, fuzzy -#| msgid "CGiS" -msgctxt "Language" -msgid "CGiS" -msgstr "सीजीआईएस" - -#. i18n: tag language attribute name -#: syntax/data/changelog.xml:3 -#, fuzzy -#| msgid "ChangeLog" -msgctxt "Language" -msgid "ChangeLog" -msgstr "चेंजलॉग" - -#. i18n: tag language attribute name -#: syntax/data/cisco.xml:3 -#, fuzzy -#| msgid "Cisco" -msgctxt "Language" -msgid "Cisco" -msgstr "सिस्को" - -#. i18n: tag language attribute name -#: syntax/data/clipper.xml:3 -#, fuzzy -#| msgid "Clipper" -msgctxt "Language" -msgid "Clipper" -msgstr "क्लिपर" - -#. i18n: tag language attribute name -#: syntax/data/clojure.xml:25 -msgctxt "Language" -msgid "Clojure" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/coffee.xml:4 -#, fuzzy -#| msgid "Scripts" -msgctxt "Language" -msgid "CoffeeScript" -msgstr "स्क्रिप्ट्स" - -#. i18n: tag language attribute name -#: syntax/data/coldfusion.xml:3 -#, fuzzy -#| msgid "ColdFusion" -msgctxt "Language" -msgid "ColdFusion" -msgstr "कोल्ड-फ्यूज़न" - -#. i18n: tag language attribute name -#: syntax/data/commonlisp.xml:26 -#, fuzzy -#| msgid "Common Lisp" -msgctxt "Language" -msgid "Common Lisp" -msgstr "कॉमन लिस्प" - -#. i18n: tag language attribute name -#: syntax/data/component-pascal.xml:13 -#, fuzzy -#| msgid "Component-Pascal" -msgctxt "Language" -msgid "Component-Pascal" -msgstr "कम्पोनेंट-पास्कल" - -#. i18n: tag language attribute name -#: syntax/data/context.xml:3 -msgctxt "Language" -msgid "ConTeXt" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/crk.xml:2 -#, fuzzy -#| msgid "CMake" -msgctxt "Language" -msgid "Crack" -msgstr "सी-मेक" - -#. i18n: tag language attribute name -#: syntax/data/cs.xml:2 -#, fuzzy -#| msgid "C#" -msgctxt "Language" -msgid "C#" -msgstr "सी#" - -#. i18n: tag language attribute name -#: syntax/data/css.xml:21 -#, fuzzy -#| msgid "CSS" -msgctxt "Language" -msgid "CSS" -msgstr "सीएसएस" - -#. i18n: tag language attribute name -#: syntax/data/cubescript.xml:10 -#, fuzzy -#| msgid "Scripts" -msgctxt "Language" -msgid "CubeScript" -msgstr "स्क्रिप्ट्स" - -#. i18n: tag language attribute name -#: syntax/data/cue.xml:3 -#, fuzzy -#| msgid "CUE Sheet" -msgctxt "Language" -msgid "CUE Sheet" -msgstr "क्यू-शीट" - -#. i18n: tag language attribute name -#: syntax/data/curry.xml:33 -msgctxt "Language" -msgid "Curry" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/d.xml:104 -#, fuzzy -#| msgid "D" -msgctxt "Language" -msgid "D" -msgstr "डी" - -#. i18n: tag language attribute name -#: syntax/data/debianchangelog.xml:3 -#, fuzzy -#| msgid "Debian Changelog" -msgctxt "Language" -msgid "Debian Changelog" -msgstr "डेबियन चेंजलॉग" - -#. i18n: tag language attribute name -#: syntax/data/debiancontrol.xml:3 -#, fuzzy -#| msgid "Debian Control" -msgctxt "Language" -msgid "Debian Control" -msgstr "डेबियन नियंत्रण" - -#. i18n: tag language attribute name -#: syntax/data/desktop.xml:3 -#, fuzzy -#| msgid ".desktop" -msgctxt "Language" -msgid ".desktop" -msgstr ".डेस्कटॉप" - -#. i18n: tag language attribute name -#: syntax/data/diff.xml:18 -#, fuzzy -#| msgid "Diff" -msgctxt "Language" -msgid "Diff" -msgstr "डिफ" - -#. i18n: tag language attribute name -#: syntax/data/djangotemplate.xml:7 -#, fuzzy -#| msgid "Django HTML Template" -msgctxt "Language" -msgid "Django HTML Template" -msgstr "डीजांगो एचटीएमएल टेंपलेट" - -#. i18n: tag language attribute name -#: syntax/data/dosbat.xml:11 -msgctxt "Language" -msgid "MS-DOS Batch" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/dot.xml:4 -msgctxt "Language" -msgid "dot" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/doxygen.xml:31 -#, fuzzy -#| msgid "Doxygen" -msgctxt "Language" -msgid "Doxygen" -msgstr "डॉक्सीज़ेन" - -#. i18n: tag language attribute name -#: syntax/data/doxygenlua.xml:30 -#, fuzzy -#| msgid "Doxygen" -msgctxt "Language" -msgid "DoxygenLua" -msgstr "डॉक्सीज़ेन" - -#. i18n: tag language attribute name -#: syntax/data/dtd.xml:6 -msgctxt "Language" -msgid "DTD" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/e.xml:3 -#, fuzzy -#| msgid "E Language" -msgctxt "Language" -msgid "E Language" -msgstr "ई लैंग्वेज" - -#. i18n: tag language attribute name -#: syntax/data/eiffel.xml:13 -#, fuzzy -#| msgid "Eiffel" -msgctxt "Language" -msgid "Eiffel" -msgstr "आईफ़ेल" - -#. i18n: tag language attribute name -#: syntax/data/email.xml:6 -#, fuzzy -#| msgid "Email" -msgctxt "Language" -msgid "Email" -msgstr "ईमेल" - -#. i18n: tag language attribute name -#: syntax/data/erlang.xml:39 -msgctxt "Language" -msgid "Erlang" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/euphoria.xml:32 -#, fuzzy -#| msgid "Euphoria" -msgctxt "Language" -msgid "Euphoria" -msgstr "यूफ़ोरिया" - -#. i18n: tag language attribute name -#: syntax/data/fasm.xml:16 -#, fuzzy -#| msgid "Intel x86 (NASM)" -msgctxt "Language" -msgid "Intel x86 (FASM)" -msgstr "इंटेल एक्स86 (एनएएसएम)" - -#. i18n: tag language attribute name -#: syntax/data/ferite.xml:3 -#, fuzzy -#| msgid "ferite" -msgctxt "Language" -msgid "ferite" -msgstr "फेराइट" - -#. i18n: tag language attribute name -#: syntax/data/fgl-4gl.xml:3 -#, fuzzy -#| msgid "4GL" -msgctxt "Language" -msgid "4GL" -msgstr "4जीएल" - -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#. i18n: tag language attribute section -#: syntax/data/fgl-4gl.xml:3 syntax/data/fgl-per.xml:3 syntax/data/ldif.xml:3 -#: syntax/data/progress.xml:3 syntax/data/sql-mysql.xml:8 -#: syntax/data/sql-postgresql.xml:4 syntax/data/sql.xml:6 -#, fuzzy -#| msgid "Database" -msgctxt "Language Section" -msgid "Database" -msgstr "डाटाबेस" - -#. i18n: tag language attribute name -#: syntax/data/fgl-per.xml:3 -#, fuzzy -#| msgid "4GL-PER" -msgctxt "Language" -msgid "4GL-PER" -msgstr "4जीएल-पीईआर" - -#. i18n: tag language attribute name -#: syntax/data/fortran.xml:3 -#, fuzzy -#| msgid "Fortran" -msgctxt "Language" -msgid "Fortran" -msgstr "फोरट्रॉन" - -#. i18n: tag language attribute name -#: syntax/data/freebasic.xml:3 -#, fuzzy -#| msgid "FreeBASIC" -msgctxt "Language" -msgid "FreeBASIC" -msgstr "फ्री-बेसिक" - -#. i18n: tag language attribute name -#: syntax/data/fsharp.xml:12 -msgctxt "Language" -msgid "FSharp" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/fstab.xml:4 -msgctxt "Language" -msgid "fstab" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/gap.xml:17 -#, fuzzy -#| msgid "GAP" -msgctxt "Language" -msgid "GAP" -msgstr "जीएपी" - -#. i18n: tag language attribute name -#: syntax/data/gdb.xml:10 -#, fuzzy -#| msgid "Backspace" -msgctxt "Language" -msgid "GDB Backtrace" -msgstr "बेकस्पेस" - -#. i18n: tag language attribute name -#: syntax/data/gdl.xml:3 -#, fuzzy -#| msgid "GDL" -msgctxt "Language" -msgid "GDL" -msgstr "जीडीएल" - -#. i18n: tag language attribute name -#: syntax/data/gettext.xml:26 -#, fuzzy -#| msgid "GNU Gettext" -msgctxt "Language" -msgid "GNU Gettext" -msgstr "जीएनयू गेटटेक्स्ट" - -#. i18n: tag language attribute name -#: syntax/data/git-rebase.xml:3 -msgctxt "Language" -msgid "Git Rebase" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/glosstex.xml:3 -msgctxt "Language" -msgid "GlossTex" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/glsl.xml:3 -#, fuzzy -#| msgid "GLSL" -msgctxt "Language" -msgid "GLSL" -msgstr "जीएलएसएल" - -#. i18n: tag language attribute name -#: syntax/data/gnuassembler.xml:46 -#, fuzzy -#| msgid "GNU Assembler" -msgctxt "Language" -msgid "GNU Assembler" -msgstr "जीएनयू असेंबलर" - -#. i18n: tag language attribute name -#: syntax/data/gnuplot.xml:3 -msgctxt "Language" -msgid "Gnuplot" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/go.xml:29 -#, fuzzy -#| msgid "Go" -msgctxt "Language" -msgid "Go" -msgstr "जाएँ" - -#. i18n: tag language attribute name -#: syntax/data/grammar.xml:6 -msgctxt "Language" -msgid "KDev-PG[-Qt] Grammar" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/haml.xml:3 -msgctxt "Language" -msgid "Haml" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/haskell.xml:3 -#, fuzzy -#| msgid "Haskell" -msgctxt "Language" -msgid "Haskell" -msgstr "हैसकेल" - -#. i18n: tag language attribute name -#: syntax/data/haxe.xml:15 -msgctxt "Language" -msgid "Haxe" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/html.xml:7 -#, fuzzy -#| msgid "HTML" -msgctxt "Language" -msgid "HTML" -msgstr "एचटीएमएल" - -#. i18n: tag language attribute name -#: syntax/data/idconsole.xml:3 -#, fuzzy -#| msgid "Quake Script" -msgctxt "Language" -msgid "Quake Script" -msgstr "क्वेक स्क्रिप्ट" - -#. i18n: tag language attribute name -#: syntax/data/idl.xml:3 -#, fuzzy -#| msgid "IDL" -msgctxt "Language" -msgid "IDL" -msgstr "आईडीएल" - -#. i18n: tag language attribute name -#: syntax/data/ilerpg.xml:48 -#, fuzzy -#| msgid "ILERPG" -msgctxt "Language" -msgid "ILERPG" -msgstr "आईएलईआरपीजी" - -#. i18n: tag language attribute name -#: syntax/data/inform.xml:5 -#, fuzzy -#| msgid "Inform" -msgctxt "Language" -msgid "Inform" -msgstr "सूचित करें" - -#. i18n: tag language attribute name -#: syntax/data/ini.xml:3 -#, fuzzy -#| msgid "INI Files" -msgctxt "Language" -msgid "INI Files" -msgstr "आईएनआई फ़ाइलें" - -#. i18n: tag language attribute name -#: syntax/data/jam.xml:24 -msgctxt "Language" -msgid "Jam" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/java.xml:3 -#, fuzzy -#| msgid "Java" -msgctxt "Language" -msgid "Java" -msgstr "जावा" - -#. i18n: tag language attribute name -#: syntax/data/javadoc.xml:3 -#, fuzzy -#| msgid "Javadoc" -msgctxt "Language" -msgid "Javadoc" -msgstr "जावा-डॉक" - -#. i18n: tag language attribute name -#: syntax/data/javascript.xml:6 -#, fuzzy -#| msgid "JavaScript" -msgctxt "Language" -msgid "JavaScript" -msgstr "जावास्क्रिप्ट" - -#. i18n: tag language attribute name -#: syntax/data/jira.xml:13 -msgctxt "Language" -msgid "Jira" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/json.xml:15 -msgctxt "Language" -msgid "JSON" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/jsp.xml:3 -#, fuzzy -#| msgid "JSP" -msgctxt "Language" -msgid "JSP" -msgstr "जेएसपी" - -#. i18n: tag language attribute name -#: syntax/data/julia.xml:32 -msgctxt "Language" -msgid "Julia" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/k.xml:3 -msgctxt "Language" -msgid "k" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/kbasic.xml:3 -#, fuzzy -#| msgid "KBasic" -msgctxt "Language" -msgid "KBasic" -msgstr "के-बेसिक" - -#. i18n: tag language attribute name -#: syntax/data/latex.xml:3 -#, fuzzy -#| msgid "LaTeX" -msgctxt "Language" -msgid "LaTeX" -msgstr "लेटेक्स" - -#. i18n: tag language attribute name -#: syntax/data/ld.xml:4 -#, fuzzy -#| msgid "Quake Script" -msgctxt "Language" -msgid "GNU Linker Script" -msgstr "क्वेक स्क्रिप्ट" - -#. i18n: tag language attribute name -#: syntax/data/ldif.xml:3 -#, fuzzy -#| msgid "LDIF" -msgctxt "Language" -msgid "LDIF" -msgstr "एलडीआईएफ" - -#. i18n: tag language attribute name -#: syntax/data/less.xml:3 -msgctxt "Language" -msgid "LESSCSS" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/lex.xml:23 -#, fuzzy -#| msgid "Lex/Flex" -msgctxt "Language" -msgid "Lex/Flex" -msgstr "लैक्स/फ्लैक्स" - -#. i18n: tag language attribute name -#: syntax/data/lilypond.xml:57 -#, fuzzy -#| msgid "LilyPond" -msgctxt "Language" -msgid "LilyPond" -msgstr "लिलिपाण्ड" - -#. i18n: tag language attribute name -#: syntax/data/literate-curry.xml:3 -#, fuzzy -#| msgid "Literate Haskell" -msgctxt "Language" -msgid "Literate Curry" -msgstr "लिटरेट हास्कल" - -#. i18n: tag language attribute name -#: syntax/data/literate-haskell.xml:3 -#, fuzzy -#| msgid "Literate Haskell" -msgctxt "Language" -msgid "Literate Haskell" -msgstr "लिटरेट हास्कल" - -#. i18n: tag language attribute name -#: syntax/data/logtalk.xml:4 -#, fuzzy -#| msgid "Logtalk" -msgctxt "Language" -msgid "Logtalk" -msgstr "लॉगटाक" - -#. i18n: tag language attribute name -#: syntax/data/lpc.xml:19 -#, fuzzy -#| msgid "LPC" -msgctxt "Language" -msgid "LPC" -msgstr "एलपीसी" - -#. i18n: tag language attribute name -#: syntax/data/lsl.xml:14 -#, fuzzy -#| msgid "GLSL" -msgctxt "Language" -msgid "LSL" -msgstr "जीएलएसएल" - -#. i18n: tag language attribute name -#: syntax/data/lua.xml:38 -#, fuzzy -#| msgid "Lua" -msgctxt "Language" -msgid "Lua" -msgstr "लुआ" - -#. i18n: tag language attribute name -#: syntax/data/m3u.xml:17 -#, fuzzy -#| msgid "M3U" -msgctxt "Language" -msgid "M3U" -msgstr "एम3यू" - -#. i18n: tag language attribute name -#: syntax/data/m4.xml:41 -msgctxt "Language" -msgid "GNU M4" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/mab.xml:3 -#, fuzzy -#| msgid "MAB-DB" -msgctxt "Language" -msgid "MAB-DB" -msgstr "एमएबी-डीबी" - -#. i18n: tag language attribute name -#: syntax/data/makefile.xml:8 -#, fuzzy -#| msgid "Makefile" -msgctxt "Language" -msgid "Makefile" -msgstr "मेकफ़ाइल" - -#. i18n: tag language attribute name -#: syntax/data/mako.xml:7 -msgctxt "Language" -msgid "Mako" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/mandoc.xml:3 -#, fuzzy -#| msgid "Troff Mandoc" -msgctxt "Language" -msgid "Troff Mandoc" -msgstr "ट्रॉफ मैनडॉक" - -#. i18n: tag language attribute name -#: syntax/data/markdown.xml:38 -msgctxt "Language" -msgid "Markdown" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/mason.xml:3 -#, fuzzy -#| msgid "Mason" -msgctxt "Language" -msgid "Mason" -msgstr "मैसोन" - -#. i18n: tag language attribute name -#: syntax/data/mathematica.xml:3 -msgctxt "Language" -msgid "Mathematica" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/matlab.xml:60 -#, fuzzy -#| msgid "Matlab" -msgctxt "Language" -msgid "Matlab" -msgstr "मैटलैब" - -#. i18n: tag language attribute name -#: syntax/data/maxima.xml:24 -msgctxt "Language" -msgid "Maxima" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/mediawiki.xml:9 -#, fuzzy -#| msgid "MediaWiki" -msgctxt "Language" -msgid "MediaWiki" -msgstr "मीडिया-विकि" - -#. i18n: tag language attribute name -#: syntax/data/mel.xml:23 -#, fuzzy -#| msgid "SML" -msgctxt "Language" -msgid "MEL" -msgstr "एसएमएल" - -#. i18n: tag language attribute name -#: syntax/data/mergetagtext.xml:28 -msgctxt "Language" -msgid "mergetag text" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/metafont.xml:9 -msgctxt "Language" -msgid "Metapost/Metafont" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/mips.xml:3 -#, fuzzy -#| msgid "MIPS Assembler" -msgctxt "Language" -msgid "MIPS Assembler" -msgstr "एमआईपीएस असेंबलर" - -#. i18n: tag language attribute name -#: syntax/data/modelica.xml:19 -#, fuzzy -#| msgid "Modula-2" -msgctxt "Language" -msgid "Modelica" -msgstr "मॉड्यूला-2" - -#. i18n: tag language attribute name -#: syntax/data/modelines.xml:12 -#, fuzzy -#| msgid "Modula-2" -msgctxt "Language" -msgid "Modelines" -msgstr "मॉड्यूला-2" - -#. i18n: tag language attribute name -#: syntax/data/modula-2.xml:3 -#, fuzzy -#| msgid "Modula-2" -msgctxt "Language" -msgid "Modula-2" -msgstr "मॉड्यूला-2" - -#. i18n: tag language attribute name -#: syntax/data/monobasic.xml:13 -#, fuzzy -#| msgid "MonoBasic" -msgctxt "Language" -msgid "MonoBasic" -msgstr "मोनो-बेसिक" - -#. i18n: tag language attribute name -#: syntax/data/mup.xml:3 -#, fuzzy -#| msgid "Music Publisher" -msgctxt "Language" -msgid "Music Publisher" -msgstr "म्यूज़िक पब्लिशर" - -#. i18n: tag language attribute name -#: syntax/data/nagios.xml:3 -msgctxt "Language" -msgid "Nagios" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/nasm.xml:43 -#, fuzzy -#| msgid "Intel x86 (NASM)" -msgctxt "Language" -msgid "Intel x86 (NASM)" -msgstr "इंटेल एक्स86 (एनएएसएम)" - -#. i18n: tag language attribute name -#: syntax/data/nemerle.xml:4 -#, fuzzy -#| msgid "Nemerle" -msgctxt "Language" -msgid "Nemerle" -msgstr "नेमेरल" - -#. i18n: tag language attribute name -#: syntax/data/nesc.xml:3 -msgctxt "Language" -msgid "nesC" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/noweb.xml:3 -msgctxt "Language" -msgid "noweb" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/objectivec.xml:3 -#, fuzzy -#| msgid "Objective-C" -msgctxt "Language" -msgid "Objective-C" -msgstr "ऑब्जेक्टिव-सी" - -#. i18n: tag language attribute name -#: syntax/data/objectivecpp.xml:3 -#, fuzzy -#| msgid "Objective-C++" -msgctxt "Language" -msgid "Objective-C++" -msgstr "ऑब्जेक्टिव-सी++" - -#. i18n: tag language attribute name -#: syntax/data/ocaml.xml:12 -#, fuzzy -#| msgid "Objective Caml" -msgctxt "Language" -msgid "Objective Caml" -msgstr "ऑब्जेक्टिव सीएएमएल" - -#. i18n: tag language attribute name -#: syntax/data/octave.xml:18 -#, fuzzy -#| msgid "Octave" -msgctxt "Language" -msgid "Octave" -msgstr "अष्टक" - -#. i18n: tag language attribute name -#: syntax/data/oors.xml:3 -msgctxt "Language" -msgid "OORS" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/opal.xml:3 -#, fuzzy -#| msgid "OPAL" -msgctxt "Language" -msgid "OPAL" -msgstr "ओपीएएल" - -#. i18n: tag language attribute name -#: syntax/data/opencl.xml:3 -msgctxt "Language" -msgid "OpenCL" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/pango.xml:3 -msgctxt "Language" -msgid "Pango" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/pascal.xml:3 -#, fuzzy -#| msgid "Pascal" -msgctxt "Language" -msgid "Pascal" -msgstr "पास्कल" - -#. i18n: tag language attribute name -#: syntax/data/perl.xml:42 -#, fuzzy -#| msgid "Perl" -msgctxt "Language" -msgid "Perl" -msgstr "पर्ल" - -#. i18n: tag language attribute name -#: syntax/data/php.xml:67 -#, fuzzy -#| msgid "PHP/PHP" -msgctxt "Language" -msgid "PHP/PHP" -msgstr "पीएचपी/पीएचपी" - -#. i18n: tag language attribute name -#: syntax/data/picsrc.xml:11 -#, fuzzy -#| msgid "PicAsm" -msgctxt "Language" -msgid "PicAsm" -msgstr "पीआईसी-एएसएम" - -#. i18n: tag language attribute name -#: syntax/data/pig.xml:4 -msgctxt "Language" -msgid "Pig" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/pike.xml:4 -#, fuzzy -#| msgid "Pike" -msgctxt "Language" -msgid "Pike" -msgstr "पाइक" - -#. i18n: tag language attribute name -#: syntax/data/postscript.xml:3 -#, fuzzy -#| msgid "PostScript" -msgctxt "Language" -msgid "PostScript" -msgstr "पोस्टस्क्रिप्ट" - -#. i18n: tag language attribute name -#: syntax/data/povray.xml:8 -#, fuzzy -#| msgid "POV-Ray" -msgctxt "Language" -msgid "POV-Ray" -msgstr "पोव-रे" - -#. i18n: tag language attribute name -#: syntax/data/ppd.xml:12 -msgctxt "Language" -msgid "PostScript Printer Description" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/progress.xml:3 -#, fuzzy -#| msgid "progress" -msgctxt "Language" -msgid "progress" -msgstr "प्रगति" - -#. i18n: tag language attribute name -#: syntax/data/protobuf.xml:3 -msgctxt "Language" -msgid "Protobuf" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/puppet.xml:30 -msgctxt "Language" -msgid "Puppet" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/purebasic.xml:3 -#, fuzzy -#| msgid "PureBasic" -msgctxt "Language" -msgid "PureBasic" -msgstr "प्योर-बेसिक" - -#. i18n: tag language attribute name -#: syntax/data/python.xml:16 -#, fuzzy -#| msgid "Python" -msgctxt "Language" -msgid "Python" -msgstr "पायथन" - -#. i18n: tag language attribute name -#: syntax/data/q.xml:3 -msgctxt "Language" -msgid "q" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/qmake.xml:3 -#, fuzzy -#| msgid "CMake" -msgctxt "Language" -msgid "QMake" -msgstr "सी-मेक" - -#. i18n: tag language attribute name -#: syntax/data/qml.xml:4 -#, fuzzy -#| msgid "SML" -msgctxt "Language" -msgid "QML" -msgstr "एसएमएल" - -#. i18n: tag language attribute name -#: syntax/data/r.xml:11 -#, fuzzy -#| msgid "R Script" -msgctxt "Language" -msgid "R Script" -msgstr "आर स्क्रिप्ट" - -#. i18n: tag language attribute name -#: syntax/data/rapidq.xml:3 -#, fuzzy -#| msgid "RapidQ" -msgctxt "Language" -msgid "RapidQ" -msgstr "रेपिड-क्यू" - -#. i18n: tag language attribute name -#: syntax/data/relaxngcompact.xml:3 -msgctxt "Language" -msgid "RelaxNG-Compact" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/replicode.xml:14 -#, fuzzy -#| msgid "&Replace" -msgctxt "Language" -msgid "Replicode" -msgstr "बदलें (&R)" - -#. i18n: tag language attribute name -#: syntax/data/rest.xml:9 -msgctxt "Language" -msgid "reStructuredText" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/restructuredtext.xml:3 -#, fuzzy -#| msgid "Selected text:" -msgctxt "Language" -msgid "Restructured Text" -msgstr "चुना गया पाठ:" - -#. i18n: tag language attribute name -#: syntax/data/rexx.xml:3 -#, fuzzy -#| msgid "REXX" -msgctxt "Language" -msgid "REXX" -msgstr "रेक्स" - -#. i18n: tag language attribute name -#: syntax/data/rhtml.xml:47 -#, fuzzy -msgctxt "Language" -msgid "Ruby/Rails/RHTML" -msgstr "एचटीएमएल" - -#. i18n: tag language attribute name -#: syntax/data/rib.xml:8 -#, fuzzy -#| msgid "RenderMan RIB" -msgctxt "Language" -msgid "RenderMan RIB" -msgstr "रेंडरमैन आरआईबी" - -#. i18n: tag language attribute name -#: syntax/data/roff.xml:10 -#, fuzzy -#| msgid "Roff" -msgctxt "Language" -msgid "Roff" -msgstr "रॉफ" - -#. i18n: tag language attribute name -#: syntax/data/rpmspec.xml:11 -#, fuzzy -#| msgid "RPM Spec" -msgctxt "Language" -msgid "RPM Spec" -msgstr "आरपीएम स्पैक" - -#. i18n: tag language attribute name -#: syntax/data/rsiidl.xml:3 -#, fuzzy -#| msgid "RSI IDL" -msgctxt "Language" -msgid "RSI IDL" -msgstr "आरएसआई आईडीएल" - -#. i18n: tag language attribute name -#: syntax/data/ruby.xml:33 -#, fuzzy -#| msgid "Ruby" -msgctxt "Language" -msgid "Ruby" -msgstr "रूबी" - -#. i18n: tag language attribute name -#: syntax/data/sather.xml:3 -#, fuzzy -#| msgid "Sather" -msgctxt "Language" -msgid "Sather" -msgstr "सैदर" - -#. i18n: tag language attribute name -#: syntax/data/scala.xml:3 -#, fuzzy -#| msgid "Stata" -msgctxt "Language" -msgid "Scala" -msgstr "स्टाटा" - -#. i18n: tag language attribute name -#: syntax/data/scheme.xml:43 -#, fuzzy -#| msgid "Scheme" -msgctxt "Language" -msgid "Scheme" -msgstr "योजना" - -#. i18n: tag language attribute name -#: syntax/data/sci.xml:3 -#, fuzzy -#| msgid "scilab" -msgctxt "Language" -msgid "scilab" -msgstr "साइलैब" - -#. i18n: tag language attribute name -#: syntax/data/scss.xml:23 -msgctxt "Language" -msgid "SCSS" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/sed.xml:3 -msgctxt "Language" -msgid "sed" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/sgml.xml:3 -#, fuzzy -#| msgid "SGML" -msgctxt "Language" -msgid "SGML" -msgstr "एसजीएमएल" - -#. i18n: tag language attribute name -#: syntax/data/sieve.xml:4 -#, fuzzy -#| msgid "Sieve" -msgctxt "Language" -msgid "Sieve" -msgstr "सीव" - -#. i18n: tag language attribute name -#: syntax/data/sisu.xml:3 -#, fuzzy -#| msgid "SiSU" -msgctxt "Language" -msgid "SiSU" -msgstr "सिसू" - -#. i18n: tag language attribute name -#: syntax/data/sml.xml:3 -#, fuzzy -#| msgid "SML" -msgctxt "Language" -msgid "SML" -msgstr "एसएमएल" - -#. i18n: tag language attribute name -#: syntax/data/spice.xml:4 -#, fuzzy -#| msgid "Spice" -msgctxt "Language" -msgid "Spice" -msgstr "स्पाइस" - -#. i18n: tag language attribute name -#: syntax/data/sql-mysql.xml:8 -#, fuzzy -#| msgid "SQL (MySQL)" -msgctxt "Language" -msgid "SQL (MySQL)" -msgstr "एसक्यूएल (माइ-एसक्यूएल)" - -#. i18n: tag language attribute name -#: syntax/data/sql-postgresql.xml:4 -#, fuzzy -#| msgid "SQL (PostgreSQL)" -msgctxt "Language" -msgid "SQL (PostgreSQL)" -msgstr "एसक्यूएल (पोस्टग्रे-एसक्यूएल)" - -#. i18n: tag language attribute name -#: syntax/data/sql.xml:6 -#, fuzzy -#| msgid "SQL" -msgctxt "Language" -msgid "SQL" -msgstr "एसक्यूएल" - -#. i18n: tag language attribute name -#: syntax/data/stata.xml:3 -#, fuzzy -#| msgid "Stata" -msgctxt "Language" -msgid "Stata" -msgstr "स्टाटा" - -#. i18n: tag language attribute name -#: syntax/data/systemc.xml:10 -msgctxt "Language" -msgid "SystemC" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/systemverilog.xml:42 -#, fuzzy -#| msgid "Verilog" -msgctxt "Language" -msgid "SystemVerilog" -msgstr "वेरिलॉग" - -#. i18n: tag language attribute name -#: syntax/data/tads3.xml:5 -msgctxt "Language" -msgid "TADS 3" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/tcl.xml:31 -#, fuzzy -#| msgid "Tcl/Tk" -msgctxt "Language" -msgid "Tcl/Tk" -msgstr "टीसीएल/टीके" - -#. i18n: tag language attribute name -#: syntax/data/tcsh.xml:11 -msgctxt "Language" -msgid "Tcsh" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/texinfo.xml:3 -msgctxt "Language" -msgid "Texinfo" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/textile.xml:18 -#, fuzzy -#| msgid "Text Area Background" -msgctxt "Language" -msgid "Textile" -msgstr "पाठ क्षेत्र पृष्ठभूमि" - -#. i18n: tag language attribute name -#: syntax/data/tibasic.xml:3 -#, fuzzy -#| msgid "TI Basic" -msgctxt "Language" -msgid "TI Basic" -msgstr "टीआई बेसिक" - -#. i18n: tag language attribute name -#: syntax/data/txt2tags.xml:6 -#, fuzzy -#| msgid "txt2tags" -msgctxt "Language" -msgid "txt2tags" -msgstr "टीएक्सटी2टैग्स" - -#. i18n: tag language attribute name -#: syntax/data/uscript.xml:3 -#, fuzzy -#| msgid "UnrealScript" -msgctxt "Language" -msgid "UnrealScript" -msgstr "अनरीयल-स्क्रिप्ट" - -#. i18n: tag language attribute name -#: syntax/data/vala.xml:25 -msgctxt "Language" -msgid "Vala" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/valgrind-suppression.xml:3 -msgctxt "Language" -msgid "Valgrind Suppression" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/varnish.xml:3 -#, fuzzy -#| msgid "Apache Configuration" -msgctxt "Language" -msgid "Varnish Configuration Language" -msgstr "अपाची कॉन्फ़िगरेशन" - -#. i18n: tag language attribute name -#: syntax/data/varnishtest.xml:3 -#, fuzzy -#| msgid "Apache Configuration" -msgctxt "Language" -msgid "Varnish Test Case language" -msgstr "अपाची कॉन्फ़िगरेशन" - -#. i18n: tag language attribute name -#: syntax/data/vcard.xml:5 -msgctxt "Language" -msgid "vCard, vCalendar, iCalendar" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/velocity.xml:3 -#, fuzzy -#| msgid "Velocity" -msgctxt "Language" -msgid "Velocity" -msgstr "वेलोसिटी" - -#. i18n: tag language attribute name -#: syntax/data/vera.xml:42 -msgctxt "Language" -msgid "Vera" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/verilog.xml:3 -#, fuzzy -#| msgid "Verilog" -msgctxt "Language" -msgid "Verilog" -msgstr "वेरिलॉग" - -#. i18n: tag language attribute name -#: syntax/data/vhdl.xml:14 -#, fuzzy -#| msgid "VHDL" -msgctxt "Language" -msgid "VHDL" -msgstr "वीएचडीएल" - -#. i18n: tag language attribute name -#: syntax/data/vrml.xml:3 -#, fuzzy -#| msgid "VRML" -msgctxt "Language" -msgid "VRML" -msgstr "वीआरएमएल" - -#. i18n: tag language attribute name -#: syntax/data/winehq.xml:3 -#, fuzzy -#| msgid "WINE Config" -msgctxt "Language" -msgid "WINE Config" -msgstr "वाइन कॉन्फ़िग" - -#. i18n: tag language attribute name -#: syntax/data/wml.xml:57 -msgctxt "Language" -msgid "Wesnoth Markup Language" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/xharbour.xml:3 -#, fuzzy -#| msgid "xHarbour" -msgctxt "Language" -msgid "xHarbour" -msgstr "एक्स-हॉर्बर" - -#. i18n: tag language attribute name -#: syntax/data/xml.xml:9 -#, fuzzy -#| msgid "XML" -msgctxt "Language" -msgid "XML" -msgstr "एक्सएमएल" - -#. i18n: tag language attribute name -#: syntax/data/xmldebug.xml:3 -#, fuzzy -#| msgid "XML (Debug)" -msgctxt "Language" -msgid "XML (Debug)" -msgstr "एक्सएमएल (डिबग)" - -#. i18n: tag language attribute name -#: syntax/data/xorg.xml:3 -#, fuzzy -#| msgid "x.org Configuration" -msgctxt "Language" -msgid "x.org Configuration" -msgstr "एक्स.ऑर्ग कॉन्फ़िगरेशन" - -#. i18n: tag language attribute name -#: syntax/data/xslt.xml:55 -#, fuzzy -#| msgid "xslt" -msgctxt "Language" -msgid "xslt" -msgstr "एक्सएसएलटी" - -#. i18n: tag language attribute name -#: syntax/data/xul.xml:7 -#, fuzzy -#| msgid "XUL" -msgctxt "Language" -msgid "XUL" -msgstr "एक्सयूएल" - -#. i18n: tag language attribute name -#: syntax/data/yacas.xml:3 -#, fuzzy -#| msgid "yacas" -msgctxt "Language" -msgid "yacas" -msgstr "याकास" - -#. i18n: tag language attribute name -#: syntax/data/yacc.xml:28 -#, fuzzy -#| msgid "Yacc/Bison" -msgctxt "Language" -msgid "Yacc/Bison" -msgstr "याक/बाइसन" - -#. i18n: tag language attribute name -#: syntax/data/yaml.xml:4 -msgctxt "Language" -msgid "YAML" -msgstr "" - -#. i18n: tag language attribute name -#: syntax/data/zonnon.xml:3 -#, fuzzy -#| msgid "unknown" -msgctxt "Language" -msgid "Zonnon" -msgstr "अज्ञात" - -#. i18n: tag language attribute name -#: syntax/data/zsh.xml:11 -msgctxt "Language" -msgid "Zsh" -msgstr "" - -#: syntax/katehighlight.cpp:73 -#, fuzzy -#| msgid "None" -msgctxt "Syntax highlighting" -msgid "None" -msgstr "कुछ नहीं" - -#: syntax/katehighlight.cpp:828 -msgid "Normal Text" -msgstr "सामान्य पाठ" - -#: syntax/katehighlight.cpp:1002 -#, kde-format -msgid "" -"<b>%1</b>: Deprecated syntax. Attribute (%2) not addressed by symbolic " -"name<br />" -msgstr "" -"<b>%1</b>: डेप्रिकेटेड सिंटेक्स. एट्रिब्यूट (%2) सिंबालिक नाम से एड्रेस्ड नहीं होता<br />" - -#: syntax/katehighlight.cpp:1509 -#, kde-format -msgid "<b>%1</b>: Deprecated syntax. Context %2 has no symbolic name<br />" -msgstr "<b>%1</b>: डेप्रिकेटेड सिंटेक्स. कॉन्टेक्स्ट %2 में कोई सिंबालिक नाम नहीं है<br />" - -#: syntax/katehighlight.cpp:1592 -#, kde-format -msgid "" -"<B>%1</B>:Deprecated syntax. Context %2 not addressed by a symbolic name" -msgstr "<B>%1</B>:डेप्रिकेटेड सिंटेक्स. कॉन्टेक्स्ट %2 सिंबालिक नाम से एड्रेस्ड नहीं होता" - -#: syntax/katehighlight.cpp:1736 -msgid "" -"There were warning(s) and/or error(s) while parsing the syntax highlighting " -"configuration." -msgstr "सिंटेक्स हाइलाइटिंग कॉन्फ़िगरेशन पारसिंग करते समय चेतावनी तथा/और त्रुटियाँ हुईं." - -#: syntax/katehighlight.cpp:1738 -msgid "Kate Syntax Highlighting Parser" -msgstr "के-एटीई सिंटेक्स हाईलाइटिंग पारसर" - -#: syntax/katehighlight.cpp:1904 -msgid "" -"Since there has been an error parsing the highlighting description, this " -"highlighting will be disabled" -msgstr "चूंकि हाईलाइटिंग विवरण को पारसिंग करने में त्रुटि आई यह हाईलाइटिंग अक्षम रहेगा" - -#: syntax/katehighlight.cpp:2131 -#, fuzzy, kde-format -msgid "" -"<b>%1</b>: Specified multiline comment region (%2) could not be resolved<br /" -">" -msgstr "" -"<BR>'<STATEMENT>' <BR> कथन के साथ प्रश्न नहीं चल सका. <BR> अपना आंकड़ा श्रोत जांचें." - -#: syntax/katesyntaxdocument.cpp:80 -#, kde-format -msgid "" -"<qt>The error <b>%4</b><br /> has been detected in the file %1 at %2/%3</qt>" -msgstr "<qt>त्रुटि <b>%4</b><br /> पाई गई है फ़ाइल %1 में %2/%3 पर</qt>" - -#: syntax/katesyntaxdocument.cpp:86 -#, kde-format -msgid "Unable to open %1" -msgstr "%1 खोलने में अक्षम" - -#: syntax/katesyntaxdocument.cpp:464 -msgid "Errors!" -msgstr "त्रुटियाँ!" - -#: syntax/katesyntaxdocument.cpp:469 -#, kde-format -msgid "Error: %1" -msgstr "त्रुटि: %1" - -#: syntax/katesyntaxmanager.cpp:168 -#, fuzzy -#| msgid "Normal" -msgctxt "@item:intable Text context" -msgid "Normal" -msgstr "सामान्य" - -#: syntax/katesyntaxmanager.cpp:169 -#, fuzzy -#| msgid "Keyword" -msgctxt "@item:intable Text context" -msgid "Keyword" -msgstr "कीवर्ड" - -#: syntax/katesyntaxmanager.cpp:170 -#, fuzzy -#| msgid "Function" -msgctxt "@item:intable Text context" -msgid "Function" -msgstr "फंक्शन" - -#: syntax/katesyntaxmanager.cpp:171 -#, fuzzy -#| msgid "Variable" -msgctxt "@item:intable Text context" -msgid "Variable" -msgstr "परिवर्तनीय" - -#: syntax/katesyntaxmanager.cpp:172 -msgctxt "@item:intable Text context" -msgid "Control Flow" -msgstr "" - -#: syntax/katesyntaxmanager.cpp:173 -msgctxt "@item:intable Text context" -msgid "Operator" -msgstr "" - -#: syntax/katesyntaxmanager.cpp:174 -msgctxt "@item:intable Text context" -msgid "Built-in" -msgstr "" - -#: syntax/katesyntaxmanager.cpp:175 -#, fuzzy -#| msgid "Extensions" -msgctxt "@item:intable Text context" -msgid "Extension" -msgstr "एक्सटेंशन्स" - -#: syntax/katesyntaxmanager.cpp:176 -msgctxt "@item:intable Text context" -msgid "Preprocessor" -msgstr "" - -#: syntax/katesyntaxmanager.cpp:177 -msgctxt "@item:intable Text context" -msgid "Attribute" -msgstr "" - -#: syntax/katesyntaxmanager.cpp:179 -#, fuzzy -#| msgid "Character" -msgctxt "@item:intable Text context" -msgid "Character" -msgstr "अक्षर" - -#: syntax/katesyntaxmanager.cpp:180 -#, fuzzy -#| msgid "Character" -msgctxt "@item:intable Text context" -msgid "Special Character" -msgstr "अक्षर" - -#: syntax/katesyntaxmanager.cpp:181 -#, fuzzy -#| msgid "String" -msgctxt "@item:intable Text context" -msgid "String" -msgstr "वाक्याँश" - -#: syntax/katesyntaxmanager.cpp:182 -msgctxt "@item:intable Text context" -msgid "Verbatim String" -msgstr "" - -#: syntax/katesyntaxmanager.cpp:183 -#, fuzzy -#| msgid "Filtering" -msgctxt "@item:intable Text context" -msgid "Special String" -msgstr "फ़िल्टर किया जा रहा है" - -#: syntax/katesyntaxmanager.cpp:184 -msgctxt "@item:intable Text context" -msgid "Imports, Modules, Includes" -msgstr "" - -#: syntax/katesyntaxmanager.cpp:186 -#, fuzzy -#| msgid "Data Type" -msgctxt "@item:intable Text context" -msgid "Data Type" -msgstr "डाटा क़िस्म " - -#: syntax/katesyntaxmanager.cpp:187 -#, fuzzy -#| msgid "Decimal/Value" -msgctxt "@item:intable Text context" -msgid "Decimal/Value" -msgstr "दशमलव/मान" - -#: syntax/katesyntaxmanager.cpp:188 -#, fuzzy -#| msgid "Base-N Integer" -msgctxt "@item:intable Text context" -msgid "Base-N Integer" -msgstr "बेस-N पूर्णांक" - -#: syntax/katesyntaxmanager.cpp:189 -#, fuzzy -#| msgid "Floating Point" -msgctxt "@item:intable Text context" -msgid "Floating Point" -msgstr "फ्लोटिंग पाइंट" - -#: syntax/katesyntaxmanager.cpp:190 -#, fuzzy -#| msgid "Constant" -msgctxt "@item:intable Text context" -msgid "Constant" -msgstr "स्थिर" - -#: syntax/katesyntaxmanager.cpp:192 -#, fuzzy -#| msgid "Comment" -msgctxt "@item:intable Text context" -msgid "Comment" -msgstr "टिप्पणी" - -#: syntax/katesyntaxmanager.cpp:193 -#, fuzzy -msgctxt "@item:intable Text context" -msgid "Documentation" -msgstr "स्नेप लकीरें दिखाएँ" - -#: syntax/katesyntaxmanager.cpp:194 -#, fuzzy -#| msgid "Indentation" -msgctxt "@item:intable Text context" -msgid "Annotation" -msgstr "जगह छोड़ना" - -#: syntax/katesyntaxmanager.cpp:195 -#, fuzzy -#| msgid "Variable" -msgctxt "@item:intable Text context" -msgid "Comment Variable" -msgstr "परिवर्तनीय" - -#: syntax/katesyntaxmanager.cpp:197 -#, fuzzy -#| msgid "Region Marker" -msgctxt "@item:intable Text context" -msgid "Region Marker" -msgstr "रीजन मार्कर" - -#: syntax/katesyntaxmanager.cpp:198 -#, fuzzy -#| msgid "Inform" -msgctxt "@item:intable Text context" -msgid "Information" -msgstr "सूचित करें" - -#: syntax/katesyntaxmanager.cpp:199 -#, fuzzy -#| msgid "Warning" -msgctxt "@item:intable Text context" -msgid "Warning" -msgstr "चेतावनी" - -#: syntax/katesyntaxmanager.cpp:200 -#, fuzzy -#| msgid "Alert" -msgctxt "@item:intable Text context" -msgid "Alert" -msgstr "चेतावनी" - -#: syntax/katesyntaxmanager.cpp:202 -#, fuzzy -#| msgid "Others" -msgctxt "@item:intable Text context" -msgid "Others" -msgstr "अन्य" - -#: syntax/katesyntaxmanager.cpp:204 -#, fuzzy -#| msgid "Error" -msgctxt "@item:intable Text context" -msgid "Error" -msgstr "त्रुटि" - -#: utils/kateautoindent.cpp:86 -#, fuzzy -#| msgid "None" -msgctxt "Autoindent mode" -msgid "None" -msgstr "कुछ नहीं" - -#: utils/kateautoindent.cpp:90 -#, fuzzy -#| msgid "Normal" -msgctxt "Autoindent mode" -msgid "Normal" -msgstr "सामान्य" - -#: utils/katebookmarks.cpp:62 -msgid "Set &Bookmark" -msgstr "पसंदीदा सेट करें (&B)" - -#: utils/katebookmarks.cpp:66 -msgid "If a line has no bookmark then add one, otherwise remove it." -msgstr "यदि पंक्ति में पसंदीदा नहीं है, तो एक जोड़ें, अन्यथा इसे हटाएँ." - -#: utils/katebookmarks.cpp:69 -msgid "Clear &All Bookmarks" -msgstr "सभी पसंद साफ करें (&A)" - -#: utils/katebookmarks.cpp:71 -msgid "Remove all bookmarks of the current document." -msgstr "मौज़ूदा दस्तावेज़ के सभी पसंदीदा को हटाएँ" - -#: utils/katebookmarks.cpp:74 utils/katebookmarks.cpp:245 -msgid "Next Bookmark" -msgstr "अगला पसंदीदा " - -#: utils/katebookmarks.cpp:78 -msgid "Go to the next bookmark." -msgstr "अगले पसंदीदा पर जाएँ" - -#: utils/katebookmarks.cpp:81 utils/katebookmarks.cpp:246 -msgid "Previous Bookmark" -msgstr "पिछला पसंदीदा " - -#: utils/katebookmarks.cpp:85 -msgid "Go to the previous bookmark." -msgstr "पिछली पसंदीदा पर जाएँ" - -#: utils/katebookmarks.cpp:88 -msgid "&Bookmarks" -msgstr " पसंदीदा (&B)" - -#: utils/katebookmarks.cpp:206 -#, kde-format -msgid "&Next: %1 - \"%2\"" -msgstr "अगला: %1 - \"%2\" (&N)" - -#: utils/katebookmarks.cpp:213 -#, kde-format -msgid "&Previous: %1 - \"%2\"" -msgstr "पिछला: %1 - \"%2\" (&P)" - -#: utils/katecmds.cpp:65 -msgid "<p>indent</p><p>Indents the selected lines or the current line</p>" -msgstr "" - -#: utils/katecmds.cpp:69 -msgid "<p>unindent</p><p>Unindents the selected lines or current line.</p>" -msgstr "" - -#: utils/katecmds.cpp:73 -msgid "" -"<p>cleanindent</p><p>Cleans up the indentation of the selected lines or " -"current line according to the indentation settings in the document. </p>" -msgstr "" - -#: utils/katecmds.cpp:77 -msgid "" -"<p>comment</p><p>Inserts comment markers to make the selection or selected " -"lines or current line a comment according to the text format as defined by " -"the syntax highlight definition for the document.</p>" -msgstr "" - -#: utils/katecmds.cpp:81 -msgid "" -"<p>uncomment</p><p>Removes comment markers from the selection or selected " -"lines or current line according to the text format as defined by the syntax " -"highlight definition for the document.</p>" -msgstr "" - -#: utils/katecmds.cpp:85 -msgid "" -"<p>goto <b>line number</b></p><p>This command navigates to the specified " -"line number.</p>" -msgstr "" - -#: utils/katecmds.cpp:89 -msgid "" -"<p>set-indent-pasted-text <b>enable</b></p><p>If enabled, indentation of " -"text pasted from the clipboard is adjusted using the current indenter.</" -"p><p>Possible true values: 1 on true<br/>possible false values: 0 off false</" -"p>" -msgstr "" - -#: utils/katecmds.cpp:95 -#, fuzzy -#| msgid "Delete the current file type." -msgid "Deletes the current line." -msgstr "वर्तमान फ़ाइल क़िस्म मिटाएँ." - -#: utils/katecmds.cpp:98 -msgid "" -"<p>set-tab-width <b>width</b></p><p>Sets the tab width to the number " -"<b>width</b></p>" -msgstr "" - -#: utils/katecmds.cpp:102 -msgid "" -"<p>set-replace-tab <b>enable</b></p><p>If enabled, tabs are replaced with " -"spaces as you type.</p><p>Possible true values: 1 on true<br/>possible false " -"values: 0 off false</p>" -msgstr "" - -#: utils/katecmds.cpp:108 -msgid "" -"<p>set-show-tabs <b>enable</b></p><p>If enabled, TAB characters and trailing " -"whitespace will be visualized by a small dot.</p><p>Possible true values: 1 " -"on true<br/>possible false values: 0 off false</p>" -msgstr "" - -#: utils/katecmds.cpp:114 -msgid "" -"<p>set-remove-trailing-spaces <b>mode</b></p><p>Removes the trailing spaces " -"in the document depending on the <b>mode</b>.</p><p>Possible values:" -"<ul><li><b>none</b>: never remove trailing spaces.</li><li><b>modified</b>: " -"remove trailing spaces only of modified lines.</li><li><b>all</b>: remove " -"trailing spaces in the entire document.</li></ul></p>" -msgstr "" - -#: utils/katecmds.cpp:124 -msgid "" -"<p>set-indent-width <b>width</b></p><p>Sets the indentation width to the " -"number <b>width</b>. Used only if you are indenting with spaces.</p>" -msgstr "" - -#: utils/katecmds.cpp:128 -msgid "" -"<p>set-indent-mode <b>mode</b></p><p>The mode parameter is a value as seen " -"in the Tools - Indentation menu</p>" -msgstr "" - -#: utils/katecmds.cpp:132 -msgid "" -"<p>set-auto-indent <b>enable</b></p><p>Enable or disable autoindentation.</" -"p><p>possible true values: 1 on true<br/>possible false values: 0 off false</" -"p>" -msgstr "" - -#: utils/katecmds.cpp:138 -msgid "" -"<p>set-line-numbers <b>enable</b></p><p>Sets the visibility of the line " -"numbers pane.</p><p> possible true values: 1 on true<br/>possible false " -"values: 0 off false</p>" -msgstr "" - -#: utils/katecmds.cpp:144 -msgid "" -"<p>set-folding-markers <b>enable</b></p><p>Sets the visibility of the " -"folding markers pane.</p><p> possible true values: 1 on true<br/>possible " -"false values: 0 off false</p>" -msgstr "" - -#: utils/katecmds.cpp:150 -msgid "" -"<p>set-icon-border <b>enable</b></p><p>Sets the visibility of the icon " -"border.</p><p> possible true values: 1 on true<br/>possible false values: 0 " -"off false</p>" -msgstr "" - -#: utils/katecmds.cpp:156 -msgid "" -"<p>set-word-wrap <b>enable</b></p><p>Enables dynamic word wrap according to " -"<b>enable</b></p><p> possible true values: 1 on true<br/>possible false " -"values: 0 off false</p>" -msgstr "" - -#: utils/katecmds.cpp:162 -msgid "" -"<p>set-word-wrap-column <b>width</b></p><p>Sets the line width for hard " -"wrapping to <b>width</b>. This is used if you are having your text wrapped " -"automatically.</p>" -msgstr "" - -#: utils/katecmds.cpp:166 -msgid "" -"<p>set-replace-tabs-save <b>enable</b></p><p>When enabled, tabs will be " -"replaced with whitespace whenever the document is saved.</p><p> possible " -"true values: 1 on true<br/>possible false values: 0 off false</p>" -msgstr "" - -#: utils/katecmds.cpp:172 -msgid "" -"<p>set-highlight <b>highlight</b></p><p>Sets the syntax highlighting system " -"for the document. The argument must be a valid highlight name, as seen in " -"the Tools → Highlighting menu. This command provides an autocompletion list " -"for its argument.</p>" -msgstr "" - -#: utils/katecmds.cpp:176 -msgid "<p>set-mode <b>mode</b></p><p>Sets the mode as seen in Tools - Mode</p>" -msgstr "" - -#: utils/katecmds.cpp:180 -msgid "" -"<p>set-show-indent <b>enable</b></p><p>If enabled, indentation will be " -"visualized by a vertical dotted line.</p><p> possible true values: 1 on " -"true<br/>possible false values: 0 off false</p>" -msgstr "" - -#: utils/katecmds.cpp:186 -#, fuzzy -#| msgid "Use this command to print the current document" -msgid "<p>Open the Print dialog to print the current document.</p>" -msgstr "मौज़ूदा दस्तावेज़ को मुद्रित करने के लिए इस कमांड इस्तेमाल करें" - -#: utils/katecmds.cpp:301 utils/katecmds.cpp:330 -#, kde-format -msgid "Missing argument. Usage: %1 <value>" -msgstr "छूटा आर्गुमेंट. उपयोग: %1 <value>" - -#: utils/katecmds.cpp:314 -#, kde-format -msgid "No such highlighting '%1'" -msgstr "ऐसा कोई हाइलाइट नहीं '%1'" - -#: utils/katecmds.cpp:320 -#, kde-format -msgid "No such mode '%1'" -msgstr "ऐसा कोई मोड '%1' नहीं" - -#: utils/katecmds.cpp:335 -#, kde-format -msgid "Failed to convert argument '%1' to integer." -msgstr "आर्गुमेंट को '%1' पूर्णांक में बदलने में असफल" - -#: utils/katecmds.cpp:340 utils/katecmds.cpp:345 -msgid "Width must be at least 1." -msgstr "चौड़ाई कम से कम 1 होना चाहिए" - -#: utils/katecmds.cpp:350 -msgid "Column must be at least 1." -msgstr "स्तम्भ कम से कम 1 होना चाहिए" - -#: utils/katecmds.cpp:386 -#, kde-format -msgid "Usage: %1 on|off|1|0|true|false" -msgstr "उपयोग: %1 on|off|1|0|true|false" - -#: utils/katecmds.cpp:413 -#, kde-format -msgid "Bad argument '%1'. Usage: %2 on|off|1|0|true|false" -msgstr "गलत आर्गुमेंट '%1'. उपयोग: %2 on|off|1|0|true|false" - -#: utils/katecmds.cpp:418 -msgid "" -"Usage: set-remove-trailing-spaces 0|-|none or 1|+|mod|modified or 2|*|all" -msgstr "" - -#: utils/katecmds.cpp:432 vimode/katevicmds.cpp:177 -#, kde-format -msgid "Unknown command '%1'" -msgstr "अज्ञात कमांड '%1'" - -#: utils/katecmds.cpp:486 -msgid "" -"<p> char <b>identifier</b> </p><p>This command allows you to insert literal " -"characters by their numerical identifier, in decimal, octal or hexadecimal " -"form.</p><p>Examples:<ul><li>char <b>234</b></li><li>char <b>0x1234</b></" -"li></ul></p>" -msgstr "" - -#: utils/katecmds.cpp:548 -msgid "" -"<p>date or date <b>format</b></p><p>Inserts a date/time string as defined by " -"the specified format, or the format yyyy-MM-dd hh:mm:ss if none is specified." -"</p><p>Possible format specifiers are:<table><tr><td>d</td><td>The day as " -"number without a leading zero (1-31).</td></tr><tr><td>dd</td><td>The day as " -"number with a leading zero (01-31).</td></tr><tr><td>ddd</td><td>The " -"abbreviated localized day name (e.g. 'Mon'..'Sun').</td></tr><tr><td>dddd</" -"td><td>The long localized day name (e.g. 'Monday'..'Sunday').</td></" -"tr><tr><td>M</td><td>The month as number without a leading zero (1-12).</" -"td></tr><tr><td>MM</td><td>The month as number with a leading zero (01-12).</" -"td></tr><tr><td>MMM</td><td>The abbreviated localized month name (e.g. " -"'Jan'..'Dec').</td></tr><tr><td>yy</td><td>The year as two digit number " -"(00-99).</td></tr><tr><td>yyyy</td><td>The year as four digit number " -"(1752-8000).</td></tr><tr><td>h</td><td>The hour without a leading zero " -"(0..23 or 1..12 if AM/PM display).</td></tr><tr><td>hh</td><td>The hour with " -"a leading zero (00..23 or 01..12 if AM/PM display).</td></tr><tr><td>m</" -"td><td>The minute without a leading zero (0..59).</td></tr><tr><td>mm</" -"td><td>The minute with a leading zero (00..59).</td></tr><tr><td>s</" -"td><td>The second without a leading zero (0..59).</td></tr><tr><td>ss</" -"td><td>The second with a leading zero (00..59).</td></tr><tr><td>z</" -"td><td>The milliseconds without leading zeroes (0..999).</td></" -"tr><tr><td>zzz</td><td>The milliseconds with leading zeroes (000..999).</" -"td></tr><tr><td>AP</td><td>Use AM/PM display. AP will be replaced by either " -"\"AM\" or \"PM\".</td></tr><tr><td>ap</td><td>Use am/pm display. ap will be " -"replaced by either \"am\" or \"pm\".</td></tr></table></p>" -msgstr "" - -#: utils/kateglobal.cpp:76 -msgid "Kate Part" -msgstr "के-एटीई पार्ट" - -#: utils/kateglobal.cpp:77 -msgid "Embeddable editor component" -msgstr "एम्बेडेड संपादक अवयव" - -#: utils/kateglobal.cpp:78 -#, fuzzy -#| msgid "(c) 2000-2005 The Kate Authors" -msgid "(c) 2000-2014 The Kate Authors" -msgstr "(c) 2000-2005 केएटीई के लेखकगण" - -#: utils/kateglobal.cpp:102 -msgid "Christoph Cullmann" -msgstr "क्रिस्टोफ कलमान" - -#: utils/kateglobal.cpp:102 -msgid "Maintainer" -msgstr "मेंटेनर" - -#: utils/kateglobal.cpp:103 -msgid "Dominik Haumann" -msgstr "डोमिनिक हाउमेन" - -#: utils/kateglobal.cpp:103 utils/kateglobal.cpp:104 utils/kateglobal.cpp:105 -#: utils/kateglobal.cpp:108 utils/kateglobal.cpp:111 utils/kateglobal.cpp:116 -msgid "Core Developer" -msgstr "कोर डेवलपर" - -#: utils/kateglobal.cpp:104 -msgid "Milian Wolff" -msgstr "" - -#: utils/kateglobal.cpp:105 -msgid "Joseph Wenninger" -msgstr "जोसफ वेननिंगर" - -#: utils/kateglobal.cpp:106 -msgid "Erlend Hamberg" -msgstr "" - -#: utils/kateglobal.cpp:107 -msgid "Bernhard Beschow" -msgstr "" - -#: utils/kateglobal.cpp:107 utils/kateglobal.cpp:123 -msgid "Developer" -msgstr "डेवलपर" - -#: utils/kateglobal.cpp:108 -msgid "Anders Lund" -msgstr "ऑन्देर्स लुंद" - -#: utils/kateglobal.cpp:109 -msgid "Michel Ludwig" -msgstr "" - -#: utils/kateglobal.cpp:109 -#, fuzzy -#| msgid "Spellcheck" -msgid "On-the-fly spell checking" -msgstr "वर्तनी जाँच" - -#: utils/kateglobal.cpp:110 -msgid "Pascal Létourneau" -msgstr "" - -#: utils/kateglobal.cpp:110 -msgid "Large scale bug fixing" -msgstr "" - -#: utils/kateglobal.cpp:111 -msgid "Hamish Rodda" -msgstr "हामिश रोदा" - -#: utils/kateglobal.cpp:112 -msgid "Waldo Bastian" -msgstr "वाल्दो बास्तियान" - -#: utils/kateglobal.cpp:112 -msgid "The cool buffersystem" -msgstr "द कूल बफर सिस्टम" - -#: utils/kateglobal.cpp:113 -msgid "Charles Samuels" -msgstr "चार्ल्स सेमुएल्स" - -#: utils/kateglobal.cpp:113 -msgid "The Editing Commands" -msgstr "संपादन कमांड्स" - -#: utils/kateglobal.cpp:114 -msgid "Matt Newell" -msgstr "मैट न्यूवेल" - -#: utils/kateglobal.cpp:114 -msgid "Testing, ..." -msgstr "जांच किया जा रहा है..." - -#: utils/kateglobal.cpp:115 -msgid "Michael Bartl" -msgstr "माइकल बार्तेल" - -#: utils/kateglobal.cpp:115 -msgid "Former Core Developer" -msgstr "पूर्व कोर डेवलपर" - -#: utils/kateglobal.cpp:116 -msgid "Michael McCallum" -msgstr "माइकल मॅककालम" - -#: utils/kateglobal.cpp:117 -msgid "Michael Koch" -msgstr "माइकल कोच" - -#: utils/kateglobal.cpp:117 -msgid "KWrite port to KParts" -msgstr "के-राइट पोर्ट टू के-पार्ट्स" - -#: utils/kateglobal.cpp:118 -msgid "Christian Gebauer" -msgstr "क्रिश्चियन गेबे" - -#: utils/kateglobal.cpp:119 -msgid "Simon Hausmann" -msgstr "साइमन हाउसमेन" - -#: utils/kateglobal.cpp:120 -msgid "Glen Parker" -msgstr "ग्लेन पार्कर" - -#: utils/kateglobal.cpp:120 -msgid "KWrite Undo History, Kspell integration" -msgstr "के-राइट अनडू इतिहास, के-स्पेल इंटीग्रेशन" - -#: utils/kateglobal.cpp:121 -msgid "Scott Manson" -msgstr "स्कॉट मैंसन" - -#: utils/kateglobal.cpp:121 -msgid "KWrite XML Syntax highlighting support" -msgstr "के-राइट एक्सएमएल सिंटेक्स हाइलाइटिंग आधार" - -#: utils/kateglobal.cpp:122 -msgid "John Firebaugh" -msgstr "जॉन फायरबाग" - -#: utils/kateglobal.cpp:122 -msgid "Patches and more" -msgstr "पैचेस एंड मोर" - -#: utils/kateglobal.cpp:123 -msgid "Andreas Kling" -msgstr "आंद्रेयास क्लिंग" - -#: utils/kateglobal.cpp:124 -msgid "Mirko Stocker" -msgstr "" - -#: utils/kateglobal.cpp:124 -msgid "Various bugfixes" -msgstr "" - -#: utils/kateglobal.cpp:125 -#, fuzzy -#| msgid "Matt Newell" -msgid "Matthew Woehlke" -msgstr "मैट न्यूवेल" - -#: utils/kateglobal.cpp:125 -msgid "Selection, KColorScheme integration" -msgstr "" - -#: utils/kateglobal.cpp:126 -msgid "Sebastian Pipping" -msgstr "" - -#: utils/kateglobal.cpp:126 -msgid "Search bar back- and front-end" -msgstr "" - -#: utils/kateglobal.cpp:127 -#, fuzzy -#| msgid "Jochen Wilhemly" -msgid "Jochen Wilhelmy" -msgstr "जोहेन विल्हेमी" - -#: utils/kateglobal.cpp:127 -#, fuzzy -#| msgid "KWrite Author" -msgid "Original KWrite Author" -msgstr "के-राइट लेखक" - -#: utils/kateglobal.cpp:128 -msgid "Gerald Senarclens de Grancy" -msgstr "" - -#: utils/kateglobal.cpp:128 -#, fuzzy -#| msgid "Quake Script" -msgid "QA and Scripting" -msgstr "क्वेक स्क्रिप्ट" - -#: utils/kateglobal.cpp:130 -msgid "Matteo Merli" -msgstr "मेतियो मेरली" - -#: utils/kateglobal.cpp:130 -msgid "Highlighting for RPM Spec-Files, Perl, Diff and more" -msgstr "आरपीएम स्पेक फ़ाइलें, पर्ल, डिफ़ तथा मोर के लिए उभारें" - -#: utils/kateglobal.cpp:131 -msgid "Rocky Scaletta" -msgstr "रॉकी स्कालेता" - -#: utils/kateglobal.cpp:131 -msgid "Highlighting for VHDL" -msgstr "वीएचडीएल के लिए उभारें" - -#: utils/kateglobal.cpp:132 -msgid "Yury Lebedev" -msgstr "यूरी लेबेदेव" - -#: utils/kateglobal.cpp:132 -msgid "Highlighting for SQL" -msgstr "एसक्यूएल के लिए उभारें" - -#: utils/kateglobal.cpp:133 -msgid "Chris Ross" -msgstr "क्रिस रॉस" - -#: utils/kateglobal.cpp:133 -msgid "Highlighting for Ferite" -msgstr "फेराइट के लिए उभारें" - -#: utils/kateglobal.cpp:134 -msgid "Nick Roux" -msgstr "निक रॉक्स" - -#: utils/kateglobal.cpp:134 -msgid "Highlighting for ILERPG" -msgstr "ILERPG के लिए उभारें" - -#: utils/kateglobal.cpp:135 -msgid "Carsten Niehaus" -msgstr "कार्सटन निहाउस" - -#: utils/kateglobal.cpp:135 -msgid "Highlighting for LaTeX" -msgstr "लेटेक्स के लिए उभारें" - -#: utils/kateglobal.cpp:136 -msgid "Per Wigren" -msgstr "पर विग्रेन" - -#: utils/kateglobal.cpp:136 -msgid "Highlighting for Makefiles, Python" -msgstr "मेकफाइल्स, पायथन के लिए उभारें" - -#: utils/kateglobal.cpp:137 -msgid "Jan Fritz" -msgstr "जान फ्रित्ज़" - -#: utils/kateglobal.cpp:137 -msgid "Highlighting for Python" -msgstr "पायथन के लिए उभारें" - -#: utils/kateglobal.cpp:138 -msgid "Daniel Naber" -msgstr "डेनियल नेबर" - -#: utils/kateglobal.cpp:139 -msgid "Roland Pabel" -msgstr "रोलेण्ड पेबेल" - -#: utils/kateglobal.cpp:139 -msgid "Highlighting for Scheme" -msgstr "योजना के लिए उभारें" - -#: utils/kateglobal.cpp:140 -msgid "Cristi Dumitrescu" -msgstr "क्रिस्टी दुमित्रेस्कू" - -#: utils/kateglobal.cpp:140 -msgid "PHP Keyword/Datatype list" -msgstr "PHP कीवर्ड/डाटाटाइप सूची" - -#: utils/kateglobal.cpp:141 -msgid "Carsten Pfeiffer" -msgstr "कार्स्टेन फेइफर" - -#: utils/kateglobal.cpp:141 -msgid "Very nice help" -msgstr "बहुत अच्छी मदद" - -#: utils/kateglobal.cpp:142 -msgid "Bruno Massa" -msgstr "" - -#: utils/kateglobal.cpp:142 -#, fuzzy -#| msgid "Highlighting for LaTeX" -msgid "Highlighting for Lua" -msgstr "लेटेक्स के लिए उभारें" - -#: utils/kateglobal.cpp:144 -msgid "All people who have contributed and I have forgotten to mention" -msgstr "सभी लोग जिन्होंने सहयोग किया और मैं उल्लेख करना भूल गया" - -#: utils/kateglobal.cpp:146 -#, fuzzy -#| msgid "Your names" -msgctxt "NAME OF TRANSLATORS" -msgid "Your names" -msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर" - -#: utils/kateglobal.cpp:146 -#, fuzzy -#| msgid "Your emails" -msgctxt "EMAIL OF TRANSLATORS" -msgid "Your emails" -msgstr "raviratlami@aol.in" - -#: utils/kateglobal.cpp:258 -msgid "Configure" -msgstr "कॉन्फ़िगर करें" - -#: utils/katesedcmd.cpp:264 -#, fuzzy, kde-format -#| msgid "Text to replace with" -msgid "replace with %1?" -msgstr "पाठ जिसे बदलना है" - -#: utils/katesedcmd.cpp:270 -#, fuzzy, kde-format -msgctxt "%2 is the translation of the next message" -msgid "1 replacement done on %2" -msgid_plural "%1 replacements done on %2" -msgstr[0] "" -"1 बदल दिया.\n" -"%n बदल दिए." -msgstr[1] "बदलें" - -#: utils/katesedcmd.cpp:272 -#, fuzzy, kde-format -#| msgid "Inline" -msgctxt "substituted into the previous message" -msgid "1 line" -msgid_plural "%1 lines" -msgstr[0] "इनलाइन" -msgstr[1] "इनलाइन" - -#: utils/templateinterface.cpp:63 -msgid "" -"The template needs information about you, which is stored in your address " -"book.\n" -"However, the required plugin could not be loaded.\n" -"\n" -"Please install the KDEPIM/Kontact package for your system." -msgstr "" - -#: variableeditor/katehelpbutton.cpp:32 -msgid "Kate Handbook." -msgstr "" - -#: variableeditor/variableeditor.cpp:189 -#, fuzzy -#| msgid "Struct" -msgid "true" -msgstr "सट्रक्ट" - -#: variableeditor/variableeditor.cpp:190 -msgid "false" -msgstr "" - -#: variableeditor/variableeditor.cpp:326 -msgctxt "value for variable remove-trailing-spaces" -msgid "none" -msgstr "" - -#: variableeditor/variableeditor.cpp:327 -#, fuzzy -#| msgid "Scroll Line Up" -msgctxt "value for variable remove-trailing-spaces" -msgid "modified" -msgstr "पंक्ति ऊपर स्क्रॉल करें" - -#: variableeditor/variableeditor.cpp:328 -msgctxt "value for variale remove-trailing-spaces" -msgid "all" -msgstr "" - -#: variableeditor/variablelineedit.cpp:60 -msgid "Show list of valid variables." -msgstr "" - -#: variableeditor/variablelineedit.cpp:137 -#, fuzzy -#| msgid "The number of spaces to indent with." -msgctxt "short translation please" -msgid "Set the number of autocenter lines." -msgstr "स्पेसेस की संख्या जिनसे हाशिया भराी जाना है" - -#: variableeditor/variablelineedit.cpp:142 -msgctxt "short translation please" -msgid "Auto insert asterisk in doxygen comments." -msgstr "" - -#: variableeditor/variablelineedit.cpp:147 -#, fuzzy -#| msgid "S&elected Background Color..." -msgctxt "short translation please" -msgid "Set the document background color." -msgstr "चयनित पृष्ठभूमि का रंग... (&e)" - -#: variableeditor/variablelineedit.cpp:152 -#, fuzzy -msgctxt "short translation please" -msgid "Pressing backspace in leading whitespace unindents." -msgstr "पैराग्राफ में व्रैप पंक्तियों के बीच रिक्त स्थानों के पिक्सल" - -#: variableeditor/variablelineedit.cpp:160 -#, fuzzy -#| msgid "Bl&ock Selection Mode" -msgctxt "short translation please" -msgid "Enable block selection mode." -msgstr "ब्लाक चयन मोड (&o)" - -#: variableeditor/variablelineedit.cpp:165 -msgctxt "short translation please" -msgid "Enable the byte order marker when saving unicode files." -msgstr "" - -#: variableeditor/variablelineedit.cpp:170 -msgctxt "short translation please" -msgid "Set the color for the bracket highlight." -msgstr "" - -#: variableeditor/variablelineedit.cpp:175 -#, fuzzy -#| msgid "<p>Sets the background color of the editing area.</p>" -msgctxt "short translation please" -msgid "Set the background color for the current line." -msgstr "<p>संपादन क्षेत्र के पृष्ठभूमि रंग नियत करे.</p>" - -#: variableeditor/variablelineedit.cpp:181 -msgctxt "short translation please" -msgid "Set the default dictionary used for spell checking." -msgstr "" - -#: variableeditor/variablelineedit.cpp:186 -#, fuzzy -#| msgid "Enable static &word wrap" -msgctxt "short translation please" -msgid "Enable dynamic word wrap of long lines." -msgstr "स्थिर शब्द रैप सक्षम करें (&w)" - -#: variableeditor/variablelineedit.cpp:191 -#, fuzzy -#| msgid "Select to End of Line" -msgctxt "short translation please" -msgid "Sets the end of line mode." -msgstr "पंक्ति के अंत चुनें" - -#: variableeditor/variablelineedit.cpp:196 -msgctxt "short translation please" -msgid "Enable folding markers in the editor border." -msgstr "" - -#: variableeditor/variablelineedit.cpp:202 -#, fuzzy -#| msgid "Select the entire text of the current document." -msgctxt "short translation please" -msgid "Set the point size of the document font." -msgstr "मौज़ूदा दस्तावेज़ का संपूर्ण पाठ चुनें" - -#: variableeditor/variablelineedit.cpp:207 -#, fuzzy -#| msgid "Select the entire text of the current document." -msgctxt "short translation please" -msgid "Set the font of the document." -msgstr "मौज़ूदा दस्तावेज़ का संपूर्ण पाठ चुनें" - -#: variableeditor/variablelineedit.cpp:222 -#, fuzzy -#| msgid "Kate Syntax Highlighting Parser" -msgctxt "short translation please" -msgid "Set the syntax highlighting." -msgstr "के-एटीई सिंटेक्स हाईलाइटिंग पारसर" - -#: variableeditor/variablelineedit.cpp:227 -msgctxt "short translation please" -msgid "Set the icon bar color." -msgstr "" - -#: variableeditor/variablelineedit.cpp:232 -msgctxt "short translation please" -msgid "Enable the icon border in the editor view." -msgstr "" - -#: variableeditor/variablelineedit.cpp:237 -#, fuzzy -msgctxt "short translation please" -msgid "Set the auto indentation style." -msgstr "स्नेप लकीरें दिखाएँ" - -#: variableeditor/variablelineedit.cpp:242 -#, fuzzy -msgctxt "short translation please" -msgid "Adjust indentation of text pasted from the clipboard." -msgstr "क्लिपबोर्ड की विषय को नहीं चिपका सकते है ." - -#: variableeditor/variablelineedit.cpp:248 -msgctxt "short translation please" -msgid "Set the indentation depth for each indent level." -msgstr "" - -#: variableeditor/variablelineedit.cpp:253 -msgctxt "short translation please" -msgid "Allow odd indentation level (no multiple of indent width)." -msgstr "" - -#: variableeditor/variablelineedit.cpp:258 -#, fuzzy -#| msgid "Show &line numbers" -msgctxt "short translation please" -msgid "Show line numbers." -msgstr "पंक्ति क्रमांक दिखाएँ (&l)" - -#: variableeditor/variablelineedit.cpp:263 -msgctxt "short translation please" -msgid "Insert newline at end of file on save." -msgstr "" - -#: variableeditor/variablelineedit.cpp:268 -msgctxt "short translation please" -msgid "Enable overwrite mode in the document." -msgstr "" - -#: variableeditor/variablelineedit.cpp:273 -msgctxt "short translation please" -msgid "Enable persistent text selection." -msgstr "" - -#: variableeditor/variablelineedit.cpp:278 -#, fuzzy -#| msgid "&Replace tabs with spaces" -msgctxt "short translation please" -msgid "Replace tabs with spaces when saving the document." -msgstr "टैब्स को स्पेसेस से बदलें (&R)" - -#: variableeditor/variablelineedit.cpp:283 -#, fuzzy -#| msgid "&Replace tabs with spaces" -msgctxt "short translation please" -msgid "Replace tabs with spaces." -msgstr "टैब्स को स्पेसेस से बदलें (&R)" - -#: variableeditor/variablelineedit.cpp:288 -#, fuzzy -msgctxt "short translation please" -msgid "Remove trailing spaces when saving the document." -msgstr "सभी लीडिंग व ट्रेलिंग स्पेसेज़ को स्ट्रिंग एक्सप्रेशन से मिटाता है." - -#: variableeditor/variablelineedit.cpp:297 -#, fuzzy -#| msgid "Font & Color Schemas" -msgctxt "short translation please" -msgid "Set the color scheme." -msgstr "फ़ॉन्ट व रंग प्रसंग" - -#: variableeditor/variablelineedit.cpp:302 -msgctxt "short translation please" -msgid "Set the text selection color." -msgstr "" - -#: variableeditor/variablelineedit.cpp:307 -#, fuzzy -#| msgid "Highlight trailing &spaces" -msgctxt "short translation please" -msgid "Visualize tabs and trailing spaces." -msgstr "ट्रेलिंग स्थान उभारें (&s)" - -#: variableeditor/variablelineedit.cpp:312 -#, fuzzy -#| msgid "Word Completion" -msgctxt "short translation please" -msgid "Enable smart home navigation." -msgstr "शब्द पूर्णता" - -#: variableeditor/variablelineedit.cpp:317 -#, fuzzy -#| msgid "&Tab key indents" -msgctxt "short translation please" -msgid "Pressing TAB key indents." -msgstr "टैब कुंजी हाशिए (&T)" - -#: variableeditor/variablelineedit.cpp:323 -msgctxt "short translation please" -msgid "Set the tab display width." -msgstr "" - -#: variableeditor/variablelineedit.cpp:329 -#, fuzzy -#| msgid "" -#| "Sets the number of undo/redo steps to record. More steps uses more memory." -msgctxt "short translation please" -msgid "Set the number of undo steps to remember (0 equals infinity)." -msgstr "" -"रद्द करें/फिर से करें पग की संख्या रेकॉर्ड के लिए नियत करे. ज्यादा पग ज्यादा मेमोरी इस्तेमाल " -"करेंगे." - -#: variableeditor/variablelineedit.cpp:335 -msgctxt "short translation please" -msgid "Set the word wrap column." -msgstr "" - -#: variableeditor/variablelineedit.cpp:340 -#, fuzzy -#| msgid "S&elected Background Color..." -msgctxt "short translation please" -msgid "Set the word wrap marker color." -msgstr "चयनित पृष्ठभूमि का रंग... (&e)" - -#: variableeditor/variablelineedit.cpp:345 -msgctxt "short translation please" -msgid "Enable word wrap while typing text." -msgstr "" - -#: view/katestatusbar.cpp:83 -msgid "Current cursor position. Doubleclick to go to specific line." -msgstr "" - -#: view/katestatusbar.cpp:93 -msgid "Insert mode and VI input mode indicator" -msgstr "" - -#: view/katestatusbar.cpp:98 -#, kde-format -msgid "Soft Tabs: %1" -msgstr "" - -#: view/katestatusbar.cpp:99 -#, kde-format -msgid "Soft Tabs: %1 (%2)" -msgstr "" - -#: view/katestatusbar.cpp:100 -#, fuzzy, kde-format -#| msgid " Line: %1" -msgid "Tab Size: %1" -msgstr "पंक्ति: %1" - -#: view/katestatusbar.cpp:101 -#, kde-format -msgid "Indent/Tab: %1/%2" -msgstr "" - -#: view/katestatusbar.cpp:113 -msgid "Show Tabs As" -msgstr "" - -#: view/katestatusbar.cpp:119 -#, fuzzy -msgid "Indentation Width" -msgstr "अनुकूलतम चौड़ाई (~O)" - -#: view/katestatusbar.cpp:128 -msgid "Mixed Tabs (Spaces + Tabs)" -msgstr "" - -#: view/katestatusbar.cpp:132 -msgid "Hard Tabs (Tabs)" -msgstr "" - -#: view/katestatusbar.cpp:136 -msgid "Soft Tabs (Spaces)" -msgstr "" - -#: view/katestatusbar.cpp:152 -#, fuzzy -#| msgid "E&ncoding" -msgid "Encoding" -msgstr "एनकोडिंग (&n)" - -#: view/katestatusbar.cpp:163 -#, fuzzy -#| msgid "Kate Syntax Highlighting Parser" -msgid "Syntax highlighting" -msgstr "के-एटीई सिंटेक्स हाईलाइटिंग पारसर" - -#: view/katestatusbar.cpp:238 -#, kde-format -msgid "<em>[BLOCK]</em> %1" -msgstr "" - -#: view/katestatusbar.cpp:248 -#, fuzzy, kde-format -#| msgid " Line: %1 Col: %2 " -msgid "Line %1, Column %2" -msgstr "पंक्ति: %1 स्तम्भ: %2 " - -#: view/katestatusbar.cpp:271 -msgid "Meaning of current icon: Document was modified since it was loaded" -msgstr "" - -#: view/katestatusbar.cpp:276 -#, fuzzy -#| msgid "The file '%1' was modified by another program." -msgid "" -"Meaning of current icon: Document was modified or deleted by another program" -msgstr "फ़ाइल '%1' डिस्क में अन्य प्रोग्राम द्वारा परिवर्धित किया गया है." - -#: view/katestatusbar.cpp:287 -msgid "Meaning of current icon: Document was not modified since it was loaded" -msgstr "" - -#: view/katestatusbar.cpp:337 view/katestatusbar.cpp:357 -#, fuzzy -#| msgid "Other" -msgid "Other..." -msgstr "अन्य" - -#: view/katestatusbar.cpp:359 -#, fuzzy, kde-format -#| msgid "Other" -msgid "Other (%1)" -msgid_plural "Other (%1)" -msgstr[0] "अन्य" -msgstr[1] "अन्य" - -#: view/katestatusbar.cpp:369 -#, fuzzy -#| msgid "Tab wi&dth:" -msgid "Tab width" -msgstr "टैब चौड़ाई: (&d)" - -#: view/katestatusbar.cpp:369 view/katestatusbar.cpp:380 -msgid "[1-16]" -msgstr "" - -#: view/katestatusbar.cpp:380 -#, fuzzy -msgid "Indentation width" -msgstr "अनुकूलतम चौड़ाई (~O)" - -#: view/kateview.cpp:321 -msgid "Cut the selected text and move it to the clipboard" -msgstr "चुने गए पाठ काटें तथा इसे क्लिपबोर्ड में ले जाएँ" - -#: view/kateview.cpp:324 -msgid "Paste previously copied or cut clipboard contents" -msgstr "पिछली नक़ल या काटी क्लिपबोर्ड वस्तु चिपकाएँ" - -#: view/kateview.cpp:327 -msgid "" -"Use this command to copy the currently selected text to the system clipboard." -msgstr "इस कमांड का उपयोग मौज़ूदा चुने गए पाठ को तंत्र क्लिपबोर्ड में नक़ल करने के लिए करें." - -#: view/kateview.cpp:329 -msgid "Clipboard &History" -msgstr "" - -#: view/kateview.cpp:334 -msgid "Save the current document" -msgstr "मौज़ूदा दस्तावेज़ सहेजें" - -#: view/kateview.cpp:337 -msgid "Revert the most recent editing actions" -msgstr "अति मौज़ूदा संपादन क्रियाओं को लौटाएँ" - -#: view/kateview.cpp:340 -msgid "Revert the most recent undo operation" -msgstr "अति वर्तमान अनडू क्रियाओं को लौटाएँ" - -#: view/kateview.cpp:343 -#, fuzzy -#| msgid "Scripts" -msgid "&Scripts" -msgstr "स्क्रिप्ट्स" - -#: view/kateview.cpp:347 -#, fuzzy -#| msgid "Word Wrap" -msgid "Apply &Word Wrap" -msgstr "वर्ड रैप" - -#: view/kateview.cpp:348 -msgid "" -"Use this command to wrap all lines of the current document which are longer " -"than the width of the current view, to fit into this view.<br /><br /> This " -"is a static word wrap, meaning it is not updated when the view is resized." -msgstr "" - -#: view/kateview.cpp:354 -msgid "&Clean Indentation" -msgstr "हाशिए साफ करें (&C)" - -#: view/kateview.cpp:355 -msgid "" -"Use this to clean the indentation of a selected block of text (only tabs/" -"only spaces).<br /><br />You can configure whether tabs should be honored " -"and used or replaced with spaces, in the configuration dialog." -msgstr "" - -#: view/kateview.cpp:360 -msgid "&Align" -msgstr "पंक्तिबद्ध (&A)" - -#: view/kateview.cpp:361 -msgid "" -"Use this to align the current line or block of text to its proper indent " -"level." -msgstr "" - -#: view/kateview.cpp:365 -msgid "C&omment" -msgstr "कमेंट (&o)" - -#: view/kateview.cpp:367 -msgid "" -"This command comments out the current line or a selected block of text.<br /" -"><br />The characters for single/multiple line comments are defined within " -"the language's highlighting." -msgstr "" - -#: view/kateview.cpp:372 -msgid "Unco&mment" -msgstr "अनकमेंट (&m)" - -#: view/kateview.cpp:374 -msgid "" -"This command removes comments from the current line or a selected block of " -"text.<br /><br />The characters for single/multiple line comments are " -"defined within the language's highlighting." -msgstr "" - -#: view/kateview.cpp:379 -#, fuzzy -#| msgid "Comment" -msgid "Toggle Comment" -msgstr "टिप्पणी" - -#: view/kateview.cpp:382 -msgid "&Read Only Mode" -msgstr "सिर्फ पढ़ने लायक मोड (&R)" - -#: view/kateview.cpp:383 -msgid "Lock/unlock the document for writing" -msgstr "दस्तावेज़ को लिखने के लिए ताला लगाएँ/खोलें" - -#: view/kateview.cpp:389 -msgid "Uppercase" -msgstr "अपरकेस" - -#: view/kateview.cpp:391 -msgid "" -"Convert the selection to uppercase, or the character to the right of the " -"cursor if no text is selected." -msgstr "" -"चयन को, या यदि कोई पाठ चुना नहीं गया है तो संकेतक के दाँए तरफ के अक्षर को अपरकेस में बदलें." - -#: view/kateview.cpp:396 -msgid "Lowercase" -msgstr "लोअरकेस" - -#: view/kateview.cpp:398 -msgid "" -"Convert the selection to lowercase, or the character to the right of the " -"cursor if no text is selected." -msgstr "" -"चयन को, या यदि कोई पाठ चुना नहीं गया है तो संकेतक के दाँए तरफ के अक्षर को लोअरकेस में " -"बदलें." - -#: view/kateview.cpp:403 -msgid "Capitalize" -msgstr "केपिटलाइज़" - -#: view/kateview.cpp:405 -msgid "" -"Capitalize the selection, or the word under the cursor if no text is " -"selected." -msgstr "चयन को, या यदि कोई पाठ चुना नहीं गया है तो संकेतक अंदर के शब्द को केपिटल में बदलें." - -#: view/kateview.cpp:410 -msgid "Join Lines" -msgstr "पंक्तियाँ बढ़ाएँ" - -#: view/kateview.cpp:415 -msgid "Invoke Code Completion" -msgstr "कोड पूर्णता लाएं" - -#: view/kateview.cpp:416 -msgid "" -"Manually invoke command completion, usually by using a shortcut bound to " -"this action." -msgstr "" - -#: view/kateview.cpp:428 -msgid "Print the current document." -msgstr "मौज़ूदा दस्तावेज़ छापें" - -#: view/kateview.cpp:431 -#, fuzzy -#| msgid "Print the current document." -msgid "Show print preview of current document" -msgstr "मौज़ूदा दस्तावेज़ छापें" - -#: view/kateview.cpp:435 -msgid "Reloa&d" -msgstr "फिर से लोड (&d)" - -#: view/kateview.cpp:437 -msgid "Reload the current document from disk." -msgstr "मौज़ूदा दस्तावेज़ डिस्क से फिर से लोड करें" - -#: view/kateview.cpp:441 -msgid "Save the current document to disk, with a name of your choice." -msgstr "मौज़ूदा दस्तावेज़ डिस्क में सहेजें, अपने पसन्दीदा नाम के साथ" - -#: view/kateview.cpp:445 -#, fuzzy -#| msgid "&Save File As..." -msgid "Save &Copy As..." -msgstr "फ़ाइल ऐसे सहेजें... (&S)" - -#: view/kateview.cpp:446 -#, fuzzy -#| msgid "Reload the current document from disk." -msgid "Save a copy of the current document to disk." -msgstr "मौज़ूदा दस्तावेज़ डिस्क से फिर से लोड करें" - -#: view/kateview.cpp:450 -msgid "" -"This command opens a dialog and lets you choose a line that you want the " -"cursor to move to." -msgstr "" -"यह कमांड एक संवाद खोलता है जो आपको चुनने देता है कि किस पंक्ति पर आप संकेतक को ले जाना " -"चाहते हैं." - -#: view/kateview.cpp:453 -#, fuzzy -#| msgid "Move to Previous Line" -msgid "Move to Previous Modified Line" -msgstr "पिछली पंक्ति पर जाएँ" - -#: view/kateview.cpp:454 -#, fuzzy -#| msgid "Move to Matching Bracket" -msgid "Move upwards to the previous modified line." -msgstr "मैचिंग ब्रेकेट में जाएँ" - -#: view/kateview.cpp:458 -#, fuzzy -#| msgid "Move to Next Line" -msgid "Move to Next Modified Line" -msgstr "अगली पंक्ति पर जाएं" - -#: view/kateview.cpp:459 -msgid "Move downwards to the next modified line." -msgstr "" - -#: view/kateview.cpp:463 -msgid "&Configure Editor..." -msgstr "संपादक कॉन्फ़िगर करें... (&C)" - -#: view/kateview.cpp:464 -msgid "Configure various aspects of this editor." -msgstr "इस संपादक के विविध पहलू कॉन्फ़िगर करें" - -#: view/kateview.cpp:467 -msgid "&Mode" -msgstr "मोड (&M)" - -#: view/kateview.cpp:469 -msgid "" -"Here you can choose which mode should be used for the current document. This " -"will influence the highlighting and folding being used, for example." -msgstr "" - -#: view/kateview.cpp:472 -msgid "&Highlighting" -msgstr "उभारना (&H)" - -#: view/kateview.cpp:474 -msgid "Here you can choose how the current document should be highlighted." -msgstr "यहाँ आप चुन सकते हैं कि मौज़ूदा दस्तावेज़ किस प्रकार उभारा जाए" - -#: view/kateview.cpp:477 -msgid "&Schema" -msgstr "योजना (&S)" - -#: view/kateview.cpp:482 -msgid "&Indentation" -msgstr "हाशिया (&I)" - -#: view/kateview.cpp:486 -msgid "Select the entire text of the current document." -msgstr "मौज़ूदा दस्तावेज़ का संपूर्ण पाठ चुनें" - -#: view/kateview.cpp:489 -msgid "" -"If you have selected something within the current document, this will no " -"longer be selected." -msgstr "यदि आपने मौज़ूदा दस्तावेज़ के भीतर कुछ चुना है, यह आगे चुना हुआ नहीं रहेगा." - -#: view/kateview.cpp:493 -msgid "Enlarge Font" -msgstr "फ़ॉन्ट बड़ा करें" - -#: view/kateview.cpp:495 -msgid "This increases the display font size." -msgstr "यह प्रदर्शित फ़ॉन्ट आकार को बढ़ाता है" - -#: view/kateview.cpp:500 -msgid "Shrink Font" -msgstr "फ़ॉन्ट छोटा करें" - -#: view/kateview.cpp:502 -msgid "This decreases the display font size." -msgstr "यह प्रदर्शित फ़ॉन्ट आकार को घटाता है" - -#: view/kateview.cpp:505 -msgid "Bl&ock Selection Mode" -msgstr "ब्लाक चयन मोड (&o)" - -#: view/kateview.cpp:508 -msgid "" -"This command allows switching between the normal (line based) selection mode " -"and the block selection mode." -msgstr "" -"यह कमांड सामान्य (पंक्ति आधारित) चयन मोड तथा ब्लाक चयन मोड के बीच अदला बदली " -"स्वीकारता है." - -#: view/kateview.cpp:511 -msgid "Overwr&ite Mode" -msgstr "मिटाकर लिखें मोड (&i)" - -#: view/kateview.cpp:514 -msgid "" -"Choose whether you want the text you type to be inserted or to overwrite " -"existing text." -msgstr "" -"चुनें कि आपने जो पाठ टाइप किया है वह शामिल किया जाए या मौज़ूदा पाठ के ऊपर मिटाकर " -"लिखा जाए." - -#: view/kateview.cpp:524 -msgid "Dynamic Word Wrap Indicators" -msgstr "गतिशील वर्ड रैप सूचक (यदि लागू हो)" - -#: view/kateview.cpp:526 -msgid "Choose when the Dynamic Word Wrap Indicators should be displayed" -msgstr "चुनें कि कब गतिशील वर्ड व्रेब इंडिकेटर्स दिखें" - -#: view/kateview.cpp:530 -msgid "&Off" -msgstr "बन्द (&O)" - -#: view/kateview.cpp:531 -msgid "Follow &Line Numbers" -msgstr "पंक्ति क्रमांक अनुसरण करें (&L)" - -#: view/kateview.cpp:532 -msgid "&Always On" -msgstr "हमेशा चालू (&A)" - -#: view/kateview.cpp:536 -msgid "Show Folding &Markers" -msgstr "फोल्डिंग निशान दिखाएँ (यदि लागू हो) (&M)" - -#: view/kateview.cpp:539 -msgid "" -"You can choose if the codefolding marks should be shown, if codefolding is " -"possible." -msgstr "" -"आप चुन सकते हैं कि कोडफोल्डिंग मार्क्स दिखाए जाएं या नहीं, यदि कोड फोल्डिंग संभव हो." - -#: view/kateview.cpp:542 -msgid "Show &Icon Border" -msgstr "प्रतीक किनारा दिखाएँ (&I)" - -#: view/kateview.cpp:545 -msgid "" -"Show/hide the icon border.<br /><br />The icon border shows bookmark " -"symbols, for instance." -msgstr "" -"प्रतीक किनारा छुपाएँ/दिखाएँ.<br /><br /> उदाहरण के लिए, प्रतीक किनारा पसंदीदा " -"निशान दिखाता है." - -#: view/kateview.cpp:548 -msgid "Show &Line Numbers" -msgstr "पंक्ति क्रमांक दिखाएँ (&L)" - -#: view/kateview.cpp:551 -msgid "Show/hide the line numbers on the left hand side of the view." -msgstr "बाएँ हाथ तरफ के दृश्य पर पंक्ति क्रमांक छुपाएँ/दिखाएँ." - -#: view/kateview.cpp:554 -msgid "Show Scroll&bar Marks" -msgstr "स्क्रॉल पट्टी चिह्न दिखाएँ (&b)" - -#: view/kateview.cpp:556 -#, fuzzy -#| msgid "" -#| "Show/hide the marks on the vertical scrollbar.<br /><br />The marks, for " -#| "instance, show bookmarks." -msgid "" -"Show/hide the marks on the vertical scrollbar.<br /><br />The marks show " -"bookmarks, for instance." -msgstr "" -"खड़े स्क्रॉल पट्टी पर चिह्न छुपाएँ/दिखाएँ.<br /><br />चिह्न उदाहरण के लिए, पसंद को " -"दिखाता है." - -#: view/kateview.cpp:559 -#, fuzzy -#| msgid "Show Scroll&bar Marks" -msgid "Show Scrollbar Mini-Map" -msgstr "स्क्रॉल पट्टी चिह्न दिखाएँ (&b)" - -#: view/kateview.cpp:561 -#, fuzzy -#| msgid "" -#| "Show/hide the marks on the vertical scrollbar.<br /><br />The marks, for " -#| "instance, show bookmarks." -msgid "" -"Show/hide the mini-map on the vertical scrollbar.<br /><br />The mini-map " -"shows an overview of the whole document." -msgstr "" -"खड़े स्क्रॉल पट्टी पर चिह्न छुपाएँ/दिखाएँ.<br /><br />चिह्न उदाहरण के लिए, पसंद को " -"दिखाता है." - -#: view/kateview.cpp:570 -msgid "Show Static &Word Wrap Marker" -msgstr "स्थिर वर्ड रैप मार्कर दिखाएँ (&W)" - -#: view/kateview.cpp:573 -msgid "" -"Show/hide the Word Wrap Marker, a vertical line drawn at the word wrap " -"column as defined in the editing properties" -msgstr "" -"वर्ड रैप निशान छुपाएँ/दिखाएँ, वर्ड रैप स्तम्भ पर खड़ी पंक्ति बनेगी जैसा कि संपादन गुणों में " -"पारिभाषित है" - -#: view/kateview.cpp:577 -msgid "Show Non-Printable Spaces" -msgstr "" - -#: view/kateview.cpp:579 -msgid "Show/hide bounding box around non-printable spaces" -msgstr "" - -#: view/kateview.cpp:583 -msgid "Switch to Command Line" -msgstr "कमांड लाइन में बदलें" - -#: view/kateview.cpp:585 -msgid "Show/hide the command line on the bottom of the view." -msgstr "दृश्य के तल पर कमांड पंक्ति दिखाएँ/छुपाएँ." - -#: view/kateview.cpp:588 -msgid "Input Modes" -msgstr "" - -#: view/kateview.cpp:594 -#, kde-format -msgid "Activate/deactivate %1" -msgstr "" - -#: view/kateview.cpp:600 -msgid "&End of Line" -msgstr "पंक्ति का अंत (&E)" - -#: view/kateview.cpp:602 -msgid "Choose which line endings should be used, when you save the document" -msgstr "जब आप दस्तावेज़ सहेजेंगे, चुनें कि कौन सी अंतिम पंक्ति उपयोग की जाए" - -#: view/kateview.cpp:604 -#, fuzzy -#| msgid "UNIX" -msgctxt "@item:inmenu End of Line" -msgid "&UNIX" -msgstr "युनिक्स" - -#: view/kateview.cpp:605 -#, fuzzy -#| msgid "DOS/Windows" -msgctxt "@item:inmenu End of Line" -msgid "&Windows/DOS" -msgstr "डॉस/विंडोज़" - -#: view/kateview.cpp:606 -#, fuzzy -#| msgid "Macintosh" -msgctxt "@item:inmenu End of Line" -msgid "&Macintosh" -msgstr "मैकिंटोश" - -#: view/kateview.cpp:611 -msgid "Add &Byte Order Mark (BOM)" -msgstr "" - -#: view/kateview.cpp:614 -msgid "" -"Enable/disable adding of byte order markers for UTF-8/UTF-16 encoded files " -"while saving" -msgstr "" - -#: view/kateview.cpp:617 -msgid "E&ncoding" -msgstr "एनकोडिंग (&n)" - -#: view/kateview.cpp:621 -msgid "Look up the first occurrence of a piece of text or regular expression." -msgstr "पाठ के एक खण्ड या रेगुलर एक्सप्रेशन की प्रथम उपस्थिति देखें" - -#: view/kateview.cpp:625 -#, fuzzy -#| msgid "Selected" -msgid "Find Selected" -msgstr "चुना गया" - -#: view/kateview.cpp:627 -msgid "Finds next occurrence of selected text." -msgstr "" - -#: view/kateview.cpp:631 -#, fuzzy -#| msgid "Selected" -msgid "Find Selected Backwards" -msgstr "चुना गया" - -#: view/kateview.cpp:633 -#, fuzzy -#| msgid "Look up the previous occurrence of the search phrase." -msgid "Finds previous occurrence of selected text." -msgstr "खोज वाक्यांश की पिछली उपस्थिति देखें" - -#: view/kateview.cpp:637 -msgid "Look up the next occurrence of the search phrase." -msgstr "खोज वाक्यांश की अगली उपस्थिति देखें" - -#: view/kateview.cpp:641 -msgid "Look up the previous occurrence of the search phrase." -msgstr "खोज वाक्यांश की पिछली उपस्थिति देखें" - -#: view/kateview.cpp:645 -msgid "" -"Look up a piece of text or regular expression and replace the result with " -"some given text." -msgstr "" -"पाठ के एक खण्ड या रेगुलर एक्सप्रेशन की उपस्थिति देखें तथा परिणाम को दिए गए पाठ से बदलें." - -#: view/kateview.cpp:648 -#, fuzzy -msgid "Automatic Spell Checking" -msgstr "रेखा के अंत में अक्षरें" - -#: view/kateview.cpp:649 -msgid "Enable/disable automatic spell checking" -msgstr "" - -#: view/kateview.cpp:655 -#, fuzzy -#| msgid "Choose Editor..." -msgid "Change Dictionary..." -msgstr "संपादक चुने..." - -#: view/kateview.cpp:656 -msgid "Change the dictionary that is used for spell checking." -msgstr "" - -#: view/kateview.cpp:660 -msgid "Clear Dictionary Ranges" -msgstr "" - -#: view/kateview.cpp:662 -msgid "" -"Remove all the separate dictionary ranges that were set for spell checking." -msgstr "" - -#: view/kateview.cpp:668 -msgid "Copy as &HTML" -msgstr "एचटीएमएल रूप में नकल करें... (&H)" - -#: view/kateview.cpp:669 -msgid "" -"Use this command to copy the currently selected text as HTML to the system " -"clipboard." -msgstr "" -"इस कमांड का उपयोग मौज़ूदा चुने गए पाठ को एचटीएमएल के रूप में तंत्र क्लिपबोर्ड में नक़ल करने के " -"लिए करें." - -#: view/kateview.cpp:672 -#, fuzzy -#| msgid "Export File as HTML" -msgid "E&xport as HTML..." -msgstr "फ़ाइल को एचटीएमएल के रूप में निर्यात करें" - -#: view/kateview.cpp:673 -msgid "" -"This command allows you to export the current document with all highlighting " -"information into a HTML document." -msgstr "" -"यह कमांड आपको मौज़ूदा दस्तावेज़ को निर्यात करने देता है, सभी जानकारियों को उभार कर एक " -"एचटीएमएल दस्तावेज़ में." - -#: view/kateview.cpp:711 -msgid "Move Word Left" -msgstr "शब्द बाएँ खिसकाएँ" - -#: view/kateview.cpp:717 -msgid "Select Character Left" -msgstr "बायाँ अक्षर चुनें" - -#: view/kateview.cpp:723 -msgid "Select Word Left" -msgstr "बायाँ शब्द चुनें" - -#: view/kateview.cpp:729 -msgid "Move Word Right" -msgstr "शब्द दाएँ खिसकाएँ" - -#: view/kateview.cpp:735 -msgid "Select Character Right" -msgstr "दायाँ अक्षर चुनें" - -#: view/kateview.cpp:741 -msgid "Select Word Right" -msgstr "दायाँ शब्द चुनें" - -#: view/kateview.cpp:747 -msgid "Move to Beginning of Line" -msgstr "पंक्ति के प्रारंभ में जाएँ" - -#: view/kateview.cpp:753 -msgid "Move to Beginning of Document" -msgstr "दस्तावेज़ के प्रारंभ में जाएँ" - -#: view/kateview.cpp:759 -msgid "Select to Beginning of Line" -msgstr "पंक्ति का प्रारंभ चुनें" - -#: view/kateview.cpp:765 -msgid "Select to Beginning of Document" -msgstr "दस्तावेज़ का प्रारंभ चुनें" - -#: view/kateview.cpp:771 -msgid "Move to End of Line" -msgstr "पंक्ति के अंत में जाएँ" - -#: view/kateview.cpp:777 -msgid "Move to End of Document" -msgstr "दस्तावेज़ के अंत में जाएँ" - -#: view/kateview.cpp:783 -msgid "Select to End of Line" -msgstr "पंक्ति के अंत चुनें" - -#: view/kateview.cpp:789 -msgid "Select to End of Document" -msgstr "दस्तावेज़ के अंत चुनें" - -#: view/kateview.cpp:795 -msgid "Select to Previous Line" -msgstr "पिछली पंक्ति चुनें" - -#: view/kateview.cpp:801 -msgid "Scroll Line Up" -msgstr "पंक्ति ऊपर स्क्रॉल करें" - -#: view/kateview.cpp:807 -msgid "Move to Next Line" -msgstr "अगली पंक्ति पर जाएं" - -#: view/kateview.cpp:813 -msgid "Move to Previous Line" -msgstr "पिछली पंक्ति पर जाएँ" - -#: view/kateview.cpp:819 -#, fuzzy -#| msgid "Move Word Right" -msgid "Move Cursor Right" -msgstr "शब्द दाएँ खिसकाएँ" - -#: view/kateview.cpp:825 -#, fuzzy -#| msgid "Move Word Left" -msgid "Move Cursor Left" -msgstr "शब्द बाएँ खिसकाएँ" - -#: view/kateview.cpp:831 -msgid "Select to Next Line" -msgstr "अगली पंक्ति चुनें" - -#: view/kateview.cpp:837 -msgid "Scroll Line Down" -msgstr "पंक्ति नीचे स्क्रॉल करें" - -#: view/kateview.cpp:843 -msgid "Scroll Page Up" -msgstr "पृष्ठ ऊपर स्क्रॉल करें" - -#: view/kateview.cpp:849 -msgid "Select Page Up" -msgstr "ऊपर का पृष्ठ चुनें" - -#: view/kateview.cpp:855 -msgid "Move to Top of View" -msgstr "दृश्य के शीर्ष में जाएँ" - -#: view/kateview.cpp:861 -msgid "Select to Top of View" -msgstr "दृश्य के शीर्ष को चुनें" - -#: view/kateview.cpp:867 -msgid "Scroll Page Down" -msgstr "पृष्ठ नीचे स्क्रॉल करें" - -#: view/kateview.cpp:873 -msgid "Select Page Down" -msgstr "नीचे का पृष्ठ चयन करें" - -#: view/kateview.cpp:879 -msgid "Move to Bottom of View" -msgstr "दृश्य के तल में जाएँ" - -#: view/kateview.cpp:885 -msgid "Select to Bottom of View" -msgstr "दृश्य के तल को चुनें" - -#: view/kateview.cpp:891 -msgid "Move to Matching Bracket" -msgstr "मैचिंग ब्रेकेट में जाएँ" - -#: view/kateview.cpp:897 -msgid "Select to Matching Bracket" -msgstr "मैचिंग ब्रेकेट चुनें" - -#: view/kateview.cpp:905 -msgid "Transpose Characters" -msgstr "अक्षरों को ट्रांसपोज़ करें" - -#: view/kateview.cpp:911 -msgid "Delete Line" -msgstr "पंक्ति मिटाएँ" - -#: view/kateview.cpp:917 -msgid "Delete Word Left" -msgstr "बायाँ शब्द मिटाएँ" - -#: view/kateview.cpp:923 -msgid "Delete Word Right" -msgstr "दायाँ शब्द मिटाएँ" - -#: view/kateview.cpp:929 -msgid "Delete Next Character" -msgstr "अगला अक्षर मिटाएं" - -#: view/kateview.cpp:935 -msgid "Backspace" -msgstr "बेकस्पेस" - -#: view/kateview.cpp:944 -#, fuzzy -msgid "Insert Tab" -msgstr "हाशिया (&I)" - -#: view/kateview.cpp:949 -#, fuzzy -#| msgid "Indent current &line" -msgid "Insert Smart Newline" -msgstr "मौज़ूदा पंक्ति में हाशिया लगाएँ (&l)" - -#: view/kateview.cpp:950 -msgid "" -"Insert newline including leading characters of the current line which are " -"not letters or numbers." -msgstr "" - -#: view/kateview.cpp:960 -msgid "&Indent" -msgstr "हाशिया (&I)" - -#: view/kateview.cpp:961 -msgid "" -"Use this to indent a selected block of text.<br /><br />You can configure " -"whether tabs should be honored and used or replaced with spaces, in the " -"configuration dialog." -msgstr "" - -#: view/kateview.cpp:968 -msgid "&Unindent" -msgstr "हाशिया हटाएँ (&U)" - -#: view/kateview.cpp:969 -msgid "Use this to unindent a selected block of text." -msgstr "चुने गए पाठ के खण्ड को हाशिया हटाने के लिए इसका इस्तेमाल करें" - -#: view/kateview.cpp:989 -#, fuzzy -#| msgid "Collapse Toplevel" -msgid "Fold Toplevel Nodes" -msgstr "टॉपलेवल कोलेप्स करें" - -#: view/kateview.cpp:1007 -#, fuzzy -#| msgid "Current line:" -msgid "Fold Current Node" -msgstr "मौज़ूदा पंक्ति:" - -#: view/kateview.cpp:1011 -msgid "Unfold Current Node" -msgstr "" - -#: view/kateview.cpp:1115 -#, kde-format -msgid "(R/O) %1" -msgstr "" - -#: view/kateviewhelpers.cpp:197 view/kateviewhelpers.cpp:244 -#: view/kateviewhelpers.cpp:685 -#, kde-format -msgctxt "from line - to line" -msgid "<center>%1<br/>—<br/>%2</center>" -msgstr "" - -#: view/kateviewhelpers.cpp:859 -msgid "Available Commands" -msgstr "उपलब्ध कमांड्स" - -#: view/kateviewhelpers.cpp:861 -#, fuzzy -msgid "" -"<p>For help on individual commands, do <code>'help <command>'</code></" -"p>" -msgstr "" -"किसी विशेष कमांड के बारे में जानने के लिए \"/help <command>\" का प्रयोग करें ।\n" -"इस प्रसंग में यह सभी कमांड उपलब्ध है :\n" - -#: view/kateviewhelpers.cpp:869 -#, kde-format -msgid "No help for '%1'" -msgstr "'%1' के लिए कोई मदद नहीं" - -#: view/kateviewhelpers.cpp:872 -#, kde-format -msgid "No such command <b>%1</b>" -msgstr "ऐसा कोई कमांड नहीं: <b>%1</b>" - -#: view/kateviewhelpers.cpp:878 -msgid "" -"<p>This is the Katepart <b>command line</b>.<br />Syntax: <code><b>command " -"[ arguments ]</b></code><br />For a list of available commands, enter " -"<code><b>help list</b></code><br />For help for individual commands, enter " -"<code><b>help <command></b></code></p>" -msgstr "" - -#: view/kateviewhelpers.cpp:966 vimode/kateviemulatedcommandbar.cpp:1158 -#, kde-format -msgid "Error: No range allowed for command \"%1\"." -msgstr "" - -#: view/kateviewhelpers.cpp:979 vimode/kateviemulatedcommandbar.cpp:1165 -msgid "Success: " -msgstr "सफलता:" - -#: view/kateviewhelpers.cpp:993 vimode/kateviemulatedcommandbar.cpp:1174 -#, kde-format -msgid "Command \"%1\" failed." -msgstr "कमांड \"%1\" असफल." - -#: view/kateviewhelpers.cpp:997 vimode/kateviemulatedcommandbar.cpp:1178 -#, kde-format -msgid "No such command: \"%1\"" -msgstr "ऐसा कोई कमांड नहीं: \"%1\"" - -#: view/kateviewhelpers.cpp:2015 view/kateviewhelpers.cpp:2016 -#, kde-format -msgid "Mark Type %1" -msgstr "मार्क टाइप %1" - -#: view/kateviewhelpers.cpp:2038 -msgid "Set Default Mark Type" -msgstr "डिफ़ॉल्ट मार्क टाइप नियत करें" - -#: view/kateviewhelpers.cpp:2097 -msgid "Disable Annotation Bar" -msgstr "" - -#: vimode/kateviappcommands.cpp:73 -#, fuzzy -#| msgid "Document to open" -msgid "All documents written to disk" -msgstr "खोलने के लिए दस्तावेज़" - -#: vimode/kateviappcommands.cpp:76 vimode/katevicmds.cpp:311 -#, fuzzy -#| msgid "Document to open" -msgid "Document written to disk" -msgstr "खोलने के लिए दस्तावेज़" - -#: vimode/kateviappcommands.cpp:193 -msgid "" -"<p><b>w/wa — write document(s) to disk</b></p><p>Usage: <tt><b>w[a]</" -"b></tt></p><p>Writes the current document(s) to disk. It can be called in " -"two ways:<br /> <tt>w</tt> — writes the current document to disk<br /> " -"<tt>wa</tt> — writes all documents to disk.</p><p>If no file name is " -"associated with the document, a file dialog will be shown.</p>" -msgstr "" - -#: vimode/kateviappcommands.cpp:203 -msgid "" -"<p><b>q/qa/wq/wqa — [write and] quit</b></p><p>Usage: <tt><b>[w]q[a]</" -"b></tt></p><p>Quits the application. If <tt>w</tt> is prepended, it also " -"writes the document(s) to disk. This command can be called in several ways:" -"<br /> <tt>q</tt> — closes the current view.<br /> <tt>qa</tt> — " -"closes all views, effectively quitting the application.<br /> <tt>wq</tt> " -"— writes the current document to disk and closes its view.<br /> " -"<tt>wqa</tt> — writes all documents to disk and quits.</p><p>In all " -"cases, if the view being closed is the last view, the application quits. If " -"no file name is associated with the document and it should be written to " -"disk, a file dialog will be shown.</p>" -msgstr "" - -#: vimode/kateviappcommands.cpp:217 -msgid "" -"<p><b>x/xa — write and quit</b></p><p>Usage: <tt><b>x[a]</b></tt></" -"p><p>Saves document(s) and quits (e<b>x</b>its). This command can be called " -"in two ways:<br /> <tt>x</tt> — closes the current view.<br /> <tt>xa</" -"tt> — closes all views, effectively quitting the application.</p><p>In " -"all cases, if the view being closed is the last view, the application quits. " -"If no file name is associated with the document and it should be written to " -"disk, a file dialog will be shown.</p><p>Unlike the 'w' commands, this " -"command only writes the document if it is modified.</p>" -msgstr "" - -#: vimode/kateviappcommands.cpp:230 -msgid "" -"<p><b>sp,split— Split horizontally the current view into two</b></" -"p><p>Usage: <tt><b>sp[lit]</b></tt></p><p>The result is two views on the " -"same document.</p>" -msgstr "" - -#: vimode/kateviappcommands.cpp:235 -msgid "" -"<p><b>vs,vsplit— Split vertically the current view into two</b></" -"p><p>Usage: <tt><b>vs[plit]</b></tt></p><p>The result is two views on the " -"same document.</p>" -msgstr "" - -#: vimode/kateviappcommands.cpp:240 -msgid "" -"<p><b>[v]new — split view and create new document</b></p><p>Usage: " -"<tt><b>[v]new</b></tt></p><p>Splits the current view and opens a new " -"document in the new view. This command can be called in two ways:<br /> " -"<tt>new</tt> — splits the view horizontally and opens a new document." -"<br /> <tt>vnew</tt> — splits the view vertically and opens a new " -"document.<br /></p>" -msgstr "" - -#: vimode/kateviappcommands.cpp:249 -msgid "" -"<p><b>e[dit] — reload current document</b></p><p>Usage: <tt><b>e[dit]</" -"b></tt></p><p>Starts <b>e</b>diting the current document again. This is " -"useful to re-edit the current file, when it has been changed by another " -"program.</p>" -msgstr "" - -#: vimode/kateviappcommands.cpp:432 -msgid "" -"<p><b>b,buffer — Edit document N from the document list</b></" -"p><p>Usage: <tt><b>b[uffer] [N]</b></tt></p>" -msgstr "" - -#: vimode/kateviappcommands.cpp:437 -msgid "" -"<p><b>bp,bprev — previous buffer</b></p><p>Usage: <tt><b>bp[revious] " -"[N]</b></tt></p><p>Goes to <b>[N]</b>th previous document (\"<b>b</b>uffer" -"\") in document list. </p><p> <b>[N]</b> defaults to one. </p><p>Wraps " -"around the start of the document list.</p>" -msgstr "" - -#: vimode/kateviappcommands.cpp:445 -msgid "" -"<p><b>bn,bnext — switch to next document</b></p><p>Usage: <tt><b>bn" -"[ext] [N]</b></tt></p><p>Goes to <b>[N]</b>th next document (\"<b>b</b>uffer" -"\") in document list.<b>[N]</b> defaults to one. </p><p>Wraps around the end " -"of the document list.</p>" -msgstr "" - -#: vimode/kateviappcommands.cpp:453 -msgid "" -"<p><b>bf,bfirst — first document</b></p><p>Usage: <tt><b>bf[irst]</b></" -"tt></p><p>Goes to the <b>f</b>irst document (\"<b>b</b>uffer\") in document " -"list.</p>" -msgstr "" - -#: vimode/kateviappcommands.cpp:459 -msgid "" -"<p><b>bl,blast — last document</b></p><p>Usage: <tt><b>bl[ast]</b></" -"tt></p><p>Goes to the <b>l</b>ast document (\"<b>b</b>uffer\") in document " -"list.</p>" -msgstr "" - -#: vimode/kateviappcommands.cpp:464 -msgid "<p><b>ls</b></p><p>list current buffers<p>" -msgstr "" - -#: vimode/katevicmds.cpp:69 -#, fuzzy, kde-format -#| msgid "Missing argument. Usage: %1 <value>" -msgid "Missing argument. Usage: %1 <from>" -msgstr "छूटा आर्गुमेंट. उपयोग: %1 <value>" - -#: vimode/katevicmds.cpp:76 -#, kde-format -msgid "No mapping found for \"%1\"" -msgstr "" - -#: vimode/katevicmds.cpp:79 -#, kde-format -msgid "\"%1\" is mapped to \"%2\"" -msgstr "" - -#: vimode/katevicmds.cpp:85 -#, fuzzy, kde-format -#| msgid "Missing argument. Usage: %1 <value>" -msgid "Missing argument(s). Usage: %1 <from> [<to>]" -msgstr "छूटा आर्गुमेंट. उपयोग: %1 <value>" - -#: vimode/katevicmds.cpp:153 vimode/katevicmds.cpp:170 -#, fuzzy -#| msgid "Arguments" -msgid "Wrong arguments" -msgstr "आर्गुमेंट्स" - -#: vimode/katevicmds.cpp:322 -msgid "" -"<p><b>w/wa — write document(s) to disk</b></p><p>Usage: <tt><b>w[a]</" -"b></tt></p><p>Writes the current document(s) to disk. It can be called in " -"two ways:<br /> <tt>w</tt> — writes the current document to disk<br /> " -"<tt>wa</tt> — writes all document to disk.</p><p>If no file name is " -"associated with the document, a file dialog will be shown.</p>" -msgstr "" - -#: vimode/kateviinputmodeconfigtab.cpp:207 -#, fuzzy -#| msgid "Unable to open %1" -msgid "Unable to open the config file for reading." -msgstr "%1 खोलने में अक्षम" - -#: vimode/kateviinputmodeconfigtab.cpp:207 -#, fuzzy -#| msgid "Unable to open %1" -msgid "Unable to open file" -msgstr "%1 खोलने में अक्षम" - -#: vimode/kateviinputmodemanager.cpp:772 -#, fuzzy, kde-format -#| msgid "Mark Type %1" -msgid "Mark set: %1" -msgstr "मार्क टाइप %1" - -#: vimode/kateviinputmodemanager.cpp:814 -#, fuzzy -#| msgid "Go to the next bookmark." -msgid "There are no more chars for the next bookmark." -msgstr "अगले पसंदीदा पर जाएँ" - -#: vimode/kateviinputmodemanager.cpp:880 -msgid "VI: INSERT MODE" -msgstr "" - -#: vimode/kateviinputmodemanager.cpp:883 -msgid "VI: NORMAL MODE" -msgstr "" - -#: vimode/kateviinputmodemanager.cpp:886 -msgid "VI: VISUAL" -msgstr "" - -#: vimode/kateviinputmodemanager.cpp:889 -msgid "VI: VISUAL BLOCK" -msgstr "" - -#: vimode/kateviinputmodemanager.cpp:892 -msgid "VI: VISUAL LINE" -msgstr "" - -#: vimode/kateviinputmodemanager.cpp:895 -msgid "VI: REPLACE" -msgstr "" - -#: vimode/kateviinsertmode.cpp:270 vimode/katevimodebase.cpp:941 -#: vimode/katevinormalmode.cpp:3709 -#, kde-format -msgid "Nothing in register %1" -msgstr "" - -#: vimode/katevinormalmode.cpp:1627 -#, kde-format -msgid "'%1' %2, Hex %3, Octal %4" -msgstr "" - -#: vimode/katevinormalmode.cpp:2449 -#, fuzzy, kde-format -#| msgid "Mark Type %1" -msgid "Mark not set: %1" -msgstr "मार्क टाइप %1" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkViCommandsOverride) -#: vimode/viinputmodeconfigwidget.ui:35 -msgid "" -"When selected, vi commands will override Kate's built-in commands. For " -"example: Ctrl+R will redo, and override the standard action (showing the " -"search and replace dialog)." -msgstr "" - -#. i18n: ectx: property (text), widget (QCheckBox, chkViCommandsOverride) -#: vimode/viinputmodeconfigwidget.ui:38 -msgid "Let Vi commands override Kate shortcuts" -msgstr "" - -#. i18n: ectx: property (whatsThis), widget (QCheckBox, chkViRelLineNumbers) -#: vimode/viinputmodeconfigwidget.ui:45 -#, fuzzy -#| msgid "Show/hide the line numbers on the left hand side of the view." -msgid "" -"Show the line number relative to the line with the cursor in front of each " -"line." -msgstr "बाएँ हाथ तरफ के दृश्य पर पंक्ति क्रमांक छुपाएँ/दिखाएँ." - -#. i18n: ectx: property (text), widget (QCheckBox, chkViRelLineNumbers) -#: vimode/viinputmodeconfigwidget.ui:48 -#, fuzzy -#| msgid "Print &line numbers" -msgid "Display relative line numbers" -msgstr "पंक्ति क्रमांक छापें (&l)" - -#. i18n: ectx: property (whatsThis), widget (QGroupBox, groupBox) -#: vimode/viinputmodeconfigwidget.ui:63 -msgid "" -"Key mapping is used to change the meaning of typed keys. This allows you to " -"move commands to other keys or make special keypresses for doing a series of " -"commands.\n" -"\n" -"Example:\n" -"\"<F2>\" → \"I-- <esc>\"\n" -"\n" -"This will prepend \"-- \" to a line when pressing F2." -msgstr "" - -#. i18n: ectx: property (title), widget (QGroupBox, groupBox) -#: vimode/viinputmodeconfigwidget.ui:66 -msgid "Key Mapping" -msgstr "" - -#. i18n: ectx: attribute (title), widget (QWidget, normalTab) -#: vimode/viinputmodeconfigwidget.ui:76 -#, fuzzy -#| msgid "Normal Text" -msgid "Normal mode" -msgstr "सामान्य पाठ" - -#. i18n: ectx: property (text), widget (QTableWidget, tblNormalModeMappings) -#. i18n: ectx: property (text), widget (QTableWidget, tblInsertModeMappings) -#. i18n: ectx: property (text), widget (QTableWidget, tblVisualModeMappings) -#: vimode/viinputmodeconfigwidget.ui:100 vimode/viinputmodeconfigwidget.ui:138 -#: vimode/viinputmodeconfigwidget.ui:176 -#, fuzzy -#| msgid "Replace" -msgid "Replacement" -msgstr "बदलें" - -#. i18n: ectx: property (text), widget (QTableWidget, tblNormalModeMappings) -#. i18n: ectx: property (text), widget (QTableWidget, tblInsertModeMappings) -#. i18n: ectx: property (text), widget (QTableWidget, tblVisualModeMappings) -#: vimode/viinputmodeconfigwidget.ui:105 vimode/viinputmodeconfigwidget.ui:143 -#: vimode/viinputmodeconfigwidget.ui:181 -msgid "Recursive?" -msgstr "" - -#. i18n: ectx: attribute (title), widget (QWidget, insertTab) -#: vimode/viinputmodeconfigwidget.ui:114 -#, fuzzy -msgid "Insert mode" -msgstr "हाशिया (&I)" - -#. i18n: ectx: attribute (title), widget (QWidget, visualTab) -#: vimode/viinputmodeconfigwidget.ui:152 -#, fuzzy -#| msgid "Normal Text" -msgid "Visual mode" -msgstr "सामान्य पाठ" - -#. i18n: ectx: property (text), widget (QPushButton, btnRemoveSelectedRows) -#: vimode/viinputmodeconfigwidget.ui:195 -#, fuzzy -#| msgid "Selected" -msgid "Remove selected" -msgstr "चुना गया" - -#. i18n: ectx: property (text), widget (QPushButton, btnAddNewRow) -#: vimode/viinputmodeconfigwidget.ui:202 -msgid "Add new mapping" -msgstr "" - -#. i18n: ectx: property (toolTip), widget (QPushButton, btnImportNormal) -#: vimode/viinputmodeconfigwidget.ui:209 -msgid "" -"Read a vimrc file and attempt to import mappings specified with the \"[n]" -"noremap\" command." -msgstr "" - -#. i18n: ectx: property (text), widget (QPushButton, btnImportNormal) -#: vimode/viinputmodeconfigwidget.ui:212 -msgid "Import from vimrc file" -msgstr "" - -#, fuzzy -#~| msgid "CMake" -#~ msgctxt "Language" -#~ msgid "CMake" -#~ msgstr "सी-मेक" - -#, fuzzy -#~| msgid "Move to Matching Bracket" -#~ msgid "Matching Bracket" -#~ msgstr "मैचिंग ब्रेकेट में जाएँ" - -#~ msgid "Other" -#~ msgstr "अन्य" - -#, fuzzy -#~| msgid "C++" -#~ msgctxt "Language" -#~ msgid "C++" -#~ msgstr "सी++" - -#, fuzzy -#~| msgid " characters" -#~ msgctxt "Wrap words at" -#~ msgid " character" -#~ msgid_plural " characters" -#~ msgstr[0] "अक्षर" -#~ msgstr[1] "अक्षर" - -#~ msgid "Editor Plugins" -#~ msgstr "इतिहास प्लगइन" - -#~ msgid "Do not use config file" -#~ msgstr "कॉन्फ़िग फ़ाइल इस्तेमाल नहीं करें" - -#~ msgid "Text Area Background" -#~ msgstr "पाठ क्षेत्र पृष्ठभूमि" - -#~ msgid "Normal text:" -#~ msgstr "सामान्य पाठ:" - -#~ msgid "Selected text:" -#~ msgstr "चुना गया पाठ:" - -#~ msgid "" -#~ "<p>Sets the background color of the selection.</p><p>To set the text " -#~ "color for selected text, use the \"<b>Configure Highlighting</b>\" dialog." -#~ "</p>" -#~ msgstr "" -#~ "<p>चुने गए का पृष्ठभूमि रंग नियत करता है.</p><p>चुने गए पाठ का पाठ रंग नियत करने के " -#~ "लिए इस्तेमाल करें \"<b>कॉन्फ़िगर उभारें</b>\" संवाद.</p>" - -#~ msgid "Current line:" -#~ msgstr "मौज़ूदा पंक्ति:" - -#~ msgid "<p>Select the marker type you want to change.</p>" -#~ msgstr "<p>मार्कर क़िस्म जिसे आप बदलना चाहते हैं उसे चुनें.</p>" - -#~ msgid "" -#~ "<p>Sets the background color of the selected marker type.</p><p><b>Note</" -#~ "b>: The marker color is displayed lightly because of transparency.</p>" -#~ msgstr "" -#~ "<p>चुने गए मार्कर क़िस्म का पृष्ठभूमि रंग सेट करता है.</p><p><b>Note</b>: पारदर्शी " -#~ "होने के कारण मार्कर का रंग हल्का दिखेगा.</p>" - -#~ msgid "Additional Elements" -#~ msgstr "अतिरिक्त तत्व" - -#~ msgid "Left border background:" -#~ msgstr "बायाँ किनारा पृष्ठभूमि:" - -#~ msgid "Line numbers:" -#~ msgstr "पंक्ति क्रमांक:" - -#~ msgid "Bracket highlight:" -#~ msgstr "ब्रेकेट उभारें:" - -#~ msgid "Word wrap markers:" -#~ msgstr "वर्ड रैप निशान:" - -#~ msgid "Tab and space markers:" -#~ msgstr "टैब तथा स्पेस चिह्नक:" - -#, fuzzy -#~| msgid "Namespace" -#~ msgid "Na&mespace:" -#~ msgstr "नेमस्पेस" - -#, fuzzy -#~| msgid "License:" -#~ msgid "&License:" -#~ msgstr "लाइसेंस:" - -#, fuzzy -#~| msgid "Author:" -#~ msgid "&Authors:" -#~ msgstr "लेखकः" - -#, fuzzy -#~| msgid "&Filetype:" -#~ msgid "&File types:" -#~ msgstr "फ़ाइल-क़िस्म: (&F)" - -#, fuzzy -#~| msgid "&Help" -#~ msgid "Help" -#~ msgstr "मदद (&H)" - -#, fuzzy -#~| msgid "&Prefix:" -#~ msgid "Display &Prefix:" -#~ msgstr "उपसर्गः (&P)" - -#, fuzzy -#~| msgid "Arguments" -#~ msgid "Display &Arguments:" -#~ msgstr "आर्गुमेंट्स" - -#, fuzzy -#~| msgid "Shortcuts" -#~ msgid "Shortcut:" -#~ msgstr "शॉर्टकट्स" - -#, fuzzy -#~| msgid "Scripts" -#~ msgid "S&cripts" -#~ msgstr "स्क्रिप्ट्स" - -#, fuzzy -#~| msgid "Edit Entry" -#~ msgid "<empty repository>" -#~ msgstr "प्रविष्टि संपादन करें" - -#, fuzzy -#~| msgid "" -#~| "The file '%1' could not be opened: it is not a normal file, it is a " -#~| "folder." -#~ msgid "Output file '%1' could not be opened for writing" -#~ msgstr "फ़ाइल '%1' खोला नहीं जा सकता: यह सामान्य फ़ाइल नहीं है, यह एक फ़ोल्डर है." - -#, fuzzy -#~| msgid "Edit Entry" -#~ msgid "Cannot open snippet repository %1." -#~ msgstr "प्रविष्टि संपादन करें" - -#, fuzzy -#~| msgid "Hide completions with the following attributes:" -#~ msgid "Applies to all filetypes" -#~ msgstr "पूर्णता को निम्न गुणों के साथ छुपाएँ:" - -#, fuzzy -#~| msgid "Hide completions with the following attributes:" -#~ msgid "Applies to the following filetypes: %1" -#~ msgstr "पूर्णता को निम्न गुणों के साथ छुपाएँ:" - -#, fuzzy -#~| msgid "&Section:" -#~ msgid "Add Repository" -#~ msgstr "खण्ड: (&S)" - -#, fuzzy -#~| msgid "Edit Entry" -#~ msgid "Edit Repository" -#~ msgstr "प्रविष्टि संपादन करें" - -#, fuzzy -#~| msgid "Remove entry" -#~ msgid "Remove Repository" -#~ msgstr "प्रविष्टि मिटाएँ" - -#, fuzzy -#~| msgid "Edit Entry" -#~ msgid "Edit Snippet" -#~ msgstr "प्रविष्टि संपादन करें" - -#, fuzzy -#~| msgid "Remove entry" -#~ msgid "Remove Snippet" -#~ msgstr "प्रविष्टि मिटाएँ" - -#, fuzzy -#~| msgid "Insert: %1" -#~ msgid "Snippet: %1" -#~ msgstr "प्रविष्ट करें: %1" - -#, fuzzy -#~| msgid "Filtering" -#~ msgid "Filter..." -#~ msgstr "फ़िल्टर किया जा रहा है" - -#~ msgid "Extensions Manager" -#~ msgstr "एक्सटेंशन्स प्रबंधक" - -#, fuzzy -#~| msgid "Remove entry" -#~ msgid "Create Snippet" -#~ msgstr "प्रविष्टि मिटाएँ" - -#~ msgid "OVR" -#~ msgstr "मिटाकर लिखें" - -#~ msgid "INS" -#~ msgstr "प्रविष्ट" - -#, fuzzy -#~| msgid "Move Word Left" -#~ msgid "Move Left" -#~ msgstr "शब्द बाएँ खिसकाएँ" - -#, fuzzy -#~| msgid "Move Word Right" -#~ msgid "Move Right" -#~ msgstr "शब्द दाएँ खिसकाएँ" - -#, fuzzy -#~| msgid "Scroll Line Up" -#~ msgid "Move Up" -#~ msgstr "पंक्ति ऊपर स्क्रॉल करें" - -#, fuzzy -#~| msgid "Scroll Line Down" -#~ msgid "Move Down" -#~ msgstr "पंक्ति नीचे स्क्रॉल करें" - -#, fuzzy -#~| msgid "Execution" -#~ msgid "Execute" -#~ msgstr "चलाना" - -#, fuzzy -#~| msgid "Show/hide the command line on the bottom of the view." -#~ msgid "Show/hide the JavaScript Console on the bottom of the view." -#~ msgstr "दृश्य के तल पर कमांड पंक्ति दिखाएँ/छुपाएँ." - -#, fuzzy -#~| msgid "Always On" -#~ msgid "Always on" -#~ msgstr "हमेशा चालू" - -#, fuzzy -#~ msgid "Sorry, but Kate is not able to replace newlines, yet" -#~ msgstr "माफ करें, यूआईडी से एचटीएमएल को निर्यात अब तक समर्थित नहीं है" - -#, fuzzy -#~| msgid "Print the current document." -#~ msgid "Modify the current snippet" -#~ msgstr "मौज़ूदा दस्तावेज़ छापें" - -#, fuzzy -#~| msgid "Create a new file type." -#~ msgid "Create a new repository file" -#~ msgstr "नया फ़ाइल क़िस्म तैयार करें" - -#, fuzzy -#~| msgid "Remove entry" -#~ msgid "Kate Snippets" -#~ msgstr "प्रविष्टि मिटाएँ" - -#, fuzzy -#~| msgid "Remove entry" -#~ msgid "New Snippet" -#~ msgstr "प्रविष्टि मिटाएँ" - -#, fuzzy -#~| msgid "&Filetype:" -#~ msgid "all file types" -#~ msgstr "फ़ाइल-क़िस्म: (&F)" - -#, fuzzy -#~| msgid "Namespace" -#~ msgid "No file specified" -#~ msgstr "नेमस्पेस" - -#, fuzzy -#~| msgid "" -#~| "The file '%1' could not be opened: it is not a normal file, it is a " -#~| "folder." -#~ msgid "File could not be copied to repository" -#~ msgstr "फ़ाइल '%1' खोला नहीं जा सकता: यह सामान्य फ़ाइल नहीं है, यह एक फ़ोल्डर है." - -#, fuzzy -#~| msgid "Edit Entry" -#~ msgid "Snippet Repository:" -#~ msgstr "प्रविष्टि संपादन करें" - -#, fuzzy -#~| msgid "Insert File..." -#~ msgid "New Snippet File..." -#~ msgstr "फ़ाइल घुसाएं..." - -#, fuzzy -#~| msgid "Remove entry" -#~ msgid "Get New Snippets..." -#~ msgstr "प्रविष्टि मिटाएँ" - -#, fuzzy -#~| msgid "Remove entry" -#~ msgid "Kate Part Snippets" -#~ msgstr "प्रविष्टि मिटाएँ" - -#, fuzzy -#~| msgid "&Highlighting" -#~ msgid "&Keep highlighting" -#~ msgstr "उभारना (&H)" - -#~ msgid "R/O" -#~ msgstr " आर/ओ " - -#, fuzzy -#~| msgid "Expand Toplevel" -#~ msgid "Unfold Toplevel Nodes" -#~ msgstr "टॉपलेवल एक्सपांड करें" - -#~ msgid "Show &folding markers (if available)" -#~ msgstr "फोल्डिंग निशान दिखाएँ (यदि लागू हो) (&f)" - -#~ msgid "Plugins" -#~ msgstr "प्लगइन्स" - -#, fuzzy -#~| msgid "Move Word Left" -#~ msgid "Programmer's Move Word Left" -#~ msgstr "शब्द बाएँ खिसकाएँ" - -#, fuzzy -#~| msgid "Select Word Left" -#~ msgid "Programmer's Select Word Left" -#~ msgstr "बायाँ शब्द चुनें" - -#, fuzzy -#~| msgid "Move Word Right" -#~ msgid "Programmer's Move Word Right" -#~ msgstr "शब्द दाएँ खिसकाएँ" - -#, fuzzy -#~| msgid "Select Word Right" -#~ msgid "Programmer's Select Word Right" -#~ msgstr "दायाँ शब्द चुनें" - -#, fuzzy -#~| msgid "Prolog" -#~ msgctxt "Language" -#~ msgid "Prolog" -#~ msgstr "प्रोलॉग" - -#~ msgid "" -#~ "Selections will be overwritten by typed text and will be lost on cursor " -#~ "movement." -#~ msgstr "" -#~ "चुने गए पर टाइप किए हुए पाठ द्वारा मिटाकर लिख दिया जाएगा तथा संकेतक के चलने पर " -#~ "मिट जाएगा." - -#~ msgid "&Normal" -#~ msgstr "सामान्य (&N)" - -#~ msgid "Selections will stay even after cursor movement and typing." -#~ msgstr "संकेतक के चलने पर तथा टाइप करने पर चयनित तब भी रहेगा " - -#, fuzzy -#~| msgid "Cursor & Selection" -#~ msgid "Cursor && Selection" -#~ msgstr "संकेतक व चयन" - -#, fuzzy -#~| msgid "&Word Wrap Document" -#~ msgid "Close document" -#~ msgstr "वर्ड रैप दस्तावेज़ (&W)" - -#~ msgid "" -#~ "When the user types a left bracket ([,(, or {) KateView automatically " -#~ "enters the right bracket (}, ), or ]) to the right of the cursor." -#~ msgstr "" -#~ "जब उपयोक्ता बाँया कोष्ठक टाइप करता है ([,(, या {) के-एटीईव्यू स्वतः ही संकेतक के दाँए " -#~ "तरफ दाँया कोष्ठक (}, ), या ]) भर देता है." - -#~ msgid "Auto &brackets" -#~ msgstr "स्वचलित ब्रेकेट्स (&b)" - -#, fuzzy -#~| msgid "E&ncoding" -#~ msgid "Broken Encoding" -#~ msgstr "एनकोडिंग (&n)" - -#~ msgid "The file %1 is a binary, saving it will result in a corrupt file." -#~ msgstr "फ़ाइल %1 द्विचर है, इसे सहेजने से यह खराब हो जाएगा." - -#~ msgid "Trying to Save Binary File" -#~ msgstr "बाइनरी फ़ाइल को सहेजने की कोशिश की जा रही है" - -#~ msgid "Wrap c&ursor" -#~ msgstr "रैप संकेतक (&u)" - -#, fuzzy -#~ msgid "" -#~ "If this is enabled, the editor will remove any trailing whitespace on " -#~ "lines that are changed through editing." -#~ msgstr "यदि यह विकल्प चुना जाता है, हर नया दृश्य बाएँ हाथ तरफ पंक्ति क्रमांक दिखाएगा." - -#, fuzzy -#~ msgid "Remove &trailing spaces while editing" -#~ msgstr "सभी लीडिंग व ट्रेलिंग स्पेसेज़ को स्ट्रिंग एक्सप्रेशन से मिटाता है." - -#, fuzzy -#~ msgid "" -#~ "The editor will automatically eliminate extra spaces at the ends of lines " -#~ "of text while saving the file. This change is only visible after a save " -#~ "if you reload the file." -#~ msgstr "के-एटीईव्यू स्वतः ही पाठ पंक्ति के अंत के अतिरिक्त स्पेसेस को मिटा देगा" - -#, fuzzy -#~ msgctxt "short translation please" -#~ msgid "Remove trailing spaces when editing a line." -#~ msgstr "सभी लीडिंग व ट्रेलिंग स्पेसेज़ को स्ट्रिंग एक्सप्रेशन से मिटाता है." - -#~ msgid "Overwrite" -#~ msgstr "मिटाकर लिखें" - -#, fuzzy -#~| msgid "&Stop" -#~ msgid "Stop" -#~ msgstr "रूकें (&S)" - -#, fuzzy -#~| msgid "Colors" -#~ msgctxt "@title:column the color name" -#~ msgid "Color Role" -#~ msgstr "रंग" - -#, fuzzy -#~| msgid "Colors" -#~ msgctxt "@title:column a color button" -#~ msgid "Color" -#~ msgstr "रंग" - -#, fuzzy -#~| msgid "Normal &Color..." -#~ msgid "Export HlColors..." -#~ msgstr "सामान्य रंग (&C)" - -#, fuzzy -#~| msgid "Normal &Color..." -#~ msgid "Import HlColors..." -#~ msgstr "सामान्य रंग (&C)" - -#~ msgid "Template Background" -#~ msgstr "टेम्प्लेट पृष्ठभूमि" - -#~ msgid "Collapse One Local Level" -#~ msgstr "एक स्थानीय स्तर कोलेप्स करें" - -#~ msgid "Expand One Local Level" -#~ msgstr "एक स्थानीय स्तर एक्सपांड करें" - -#, fuzzy -#~| msgid "Collapse Toplevel" -#~ msgid "Collapse Level 1" -#~ msgstr "टॉपलेवल कोलेप्स करें" - -#, fuzzy -#~| msgid "Collapse Toplevel" -#~ msgid "Collapse Level 2" -#~ msgstr "टॉपलेवल कोलेप्स करें" - -#, fuzzy -#~| msgid "Collapse Toplevel" -#~ msgid "Collapse Level 3" -#~ msgstr "टॉपलेवल कोलेप्स करें" - -#, fuzzy -#~| msgid "Collapse Toplevel" -#~ msgid "Collapse Level 4" -#~ msgstr "टॉपलेवल कोलेप्स करें" - -#, fuzzy -#~| msgid "Collapse Toplevel" -#~ msgid "Collapse Level 5" -#~ msgstr "टॉपलेवल कोलेप्स करें" - -#, fuzzy -#~| msgid "Collapse Toplevel" -#~ msgid "Collapse Level 6" -#~ msgstr "टॉपलेवल कोलेप्स करें" - -#, fuzzy -#~| msgid "Collapse Toplevel" -#~ msgid "Collapse Level 7" -#~ msgstr "टॉपलेवल कोलेप्स करें" - -#, fuzzy -#~| msgid "Collapse Toplevel" -#~ msgid "Collapse Level 8" -#~ msgstr "टॉपलेवल कोलेप्स करें" - -#, fuzzy -#~| msgid "Collapse Toplevel" -#~ msgid "Collapse Level 9" -#~ msgstr "टॉपलेवल कोलेप्स करें" - -#, fuzzy -#~| msgid "Expand Toplevel" -#~ msgid "Expand Level 1" -#~ msgstr "टॉपलेवल एक्सपांड करें" - -#, fuzzy -#~| msgid "Expand Toplevel" -#~ msgid "Expand Level 2" -#~ msgstr "टॉपलेवल एक्सपांड करें" - -#, fuzzy -#~| msgid "Expand Toplevel" -#~ msgid "Expand Level 3" -#~ msgstr "टॉपलेवल एक्सपांड करें" - -#, fuzzy -#~| msgid "Expand Toplevel" -#~ msgid "Expand Level 4" -#~ msgstr "टॉपलेवल एक्सपांड करें" - -#, fuzzy -#~| msgid "Expand Toplevel" -#~ msgid "Expand Level 5" -#~ msgstr "टॉपलेवल एक्सपांड करें" - -#, fuzzy -#~| msgid "Expand Toplevel" -#~ msgid "Expand Level 6" -#~ msgstr "टॉपलेवल एक्सपांड करें" - -#, fuzzy -#~| msgid "Expand Toplevel" -#~ msgid "Expand Level 7" -#~ msgstr "टॉपलेवल एक्सपांड करें" - -#, fuzzy -#~| msgid "Expand Toplevel" -#~ msgid "Expand Level 8" -#~ msgstr "टॉपलेवल एक्सपांड करें" - -#, fuzzy -#~| msgid "Expand Toplevel" -#~ msgid "Expand Level 9" -#~ msgstr "टॉपलेवल एक्सपांड करें" - -#, fuzzy -#~| msgid "Collapse Toplevel" -#~ msgid "&Collapse" -#~ msgstr "टॉपलेवल कोलेप्स करें" - -#, fuzzy -#~| msgid "Automatic Completion Popup" -#~ msgid "&Auto completion enabled" -#~ msgstr "स्वचालित पूर्णता पॉपअप" - -#, fuzzy -#~| msgid "&Format:" -#~ msgid "Form" -#~ msgstr "फॉर्मेट: (&F)" - -#, fuzzy -#~ msgid "" -#~ "A KDE text-editor component could not be found;\n" -#~ "please check your KDE installation." -#~ msgstr "" -#~ "केडीई पाठ संपादक अवयव पाया नहीं जा सका!\n" -#~ "कृपया अपना केडीई संस्थापन जाँचें" - -#~ msgid "Use this to close the current document" -#~ msgstr "मौज़ूदा दस्तावेज़ को बन्द करने के लिए इसका इस्तेमाल करें" - -#~ msgid "Use this command to create a new document" -#~ msgstr "नया दस्तावेज़ खोलने के लिए इस कमांड इस्तेमाल करें" - -#~ msgid "Use this command to open an existing document for editing" -#~ msgstr "मौज़ूदा दस्तावेज़ को संपादन के लिए खोलने के लिए इस कमांड इस्तेमाल करें" - -#~ msgid "" -#~ "This lists files which you have opened recently, and allows you to easily " -#~ "open them again." -#~ msgstr "" -#~ "आपने जो हालिया फ़ाइलें खोली हैं उनकी सूची बताता है, तथा आपको इन्हें आसानी से फिर से " -#~ "खोलने देता है" - -#~ msgid "&New Window" -#~ msgstr "नया विंडो (&N)" - -#~ msgid "Create another view containing the current document" -#~ msgstr "मौज़ूदा दस्तावेज़ लिए हुए नया दृश्य बनाएँ" - -#~ msgid "Choose Editor..." -#~ msgstr "संपादक चुने..." - -#, fuzzy -#~| msgid "Override the system wide setting for the default editing component" -#~ msgid "Override the system-wide setting for the default editing component" -#~ msgstr "डिफ़ॉल्ट संपादन अवयव के लिए सिस्टम वाइड सेटिंग बदलें" - -#~ msgid "Close the current document view" -#~ msgstr "मौज़ूदा दस्तावेज़ दृश्य बंद करें" - -#~ msgid "Use this command to show or hide the view's statusbar" -#~ msgstr "इस कमांड का उपयोग दृश्य की स्थिति पट्टी को दिखाने या छुपाने के लिए करें" - -#~ msgid "Sho&w Path" -#~ msgstr "पथ दिखाएँ (&w)" - -#~ msgid "Show the complete document path in the window caption" -#~ msgstr "विंडो शीर्षक में दस्तावेज़ का पूर्ण पथ दिखाएँ" - -#~ msgid "Configure the application's keyboard shortcut assignments." -#~ msgstr "अनुप्रयोग के कुंजीपट शॉर्टकट एसाइनमेंट कॉन्फ़िगर करें" - -#~ msgid "Configure which items should appear in the toolbar(s)." -#~ msgstr "कॉन्फ़िगर करें कि कौन सी वस्तु औज़ार पट्टियों में प्रकट होंगी" - -#~ msgid "&About Editor Component" -#~ msgstr "संपादक अवयव के बारे में (&A)" - -#~ msgid " INS " -#~ msgstr "प्रविष्ट " - -#~ msgid " LINE " -#~ msgstr " लाइन" - -#~ msgid "Open File" -#~ msgstr "फ़ाइल खोलें" - -#~ msgid "" -#~ "The given file could not be read, check if it exists or if it is readable " -#~ "for the current user." -#~ msgstr "" -#~ "दी गई फ़ाइल पढ़ी नहीं जा सकी, देखें कि यह उपलब्ध है, या मौज़ूदा उपयोक्ता द्वारा पढ़ने " -#~ "लायक है." - -#~ msgid " BLOCK " -#~ msgstr " ब्लॉक" - -#~ msgid "Read the contents of stdin" -#~ msgstr "stdin के विषयवस्तुओं को पढ़ें." - -#~ msgid "Set encoding for the file to open" -#~ msgstr "फ़ाइल खोलने के लिए एनकोडिंग नियत करें" - -#~ msgid "Navigate to this line" -#~ msgstr "इस पंक्ति पर नेविगेट करें" - -#~ msgid "Navigate to this column" -#~ msgstr "इस स्तम्भ पर नेविगेट करें" - -#~ msgid "KWrite" -#~ msgstr "के-राइट" - -#~ msgid "KWrite - Text Editor" -#~ msgstr "के-राइट पाठ संपादक" - -#~ msgid "(c) 2000-2005 The Kate Authors" -#~ msgstr "(c) 2000-2005 केएटीई के लेखकगण" - -#~ msgid "Choose Editor Component" -#~ msgstr "संपादक अवयव चुनें" - -#, fuzzy -#~ msgid "Directory containing tests, basedir and output directories." -#~ msgstr "DIM sRoot As String REM ' फ़ाइल इन तथा आउटपुट की रुट डिरेक्ट्री" - -#~ msgid "Do not suppress debug output" -#~ msgstr "डिबग आउटपुट सप्रेस नहीं करें" - -#, fuzzy -#~ msgid "Regenerate baseline (instead of checking)" -#~ msgstr "श्रृंखला जांच प्रयोग करें (~q)" - -#, fuzzy -#~ msgid "Keep output files even on success" -#~ msgstr "सफल होने पर फ़ाइलों को सूची में से मिटा दें" - -#, fuzzy -#~ msgid "Save failures of this testrun as failure snapshot <snapshot>" -#~ msgstr "यह इस रुप में सहेजे जाने वाले फ़ाइल का नाम है." - -#~ msgid "Show the window while running tests" -#~ msgstr "जब जांच चल रहा हो तो विंडो दिखाएँ" - -#, fuzzy -#~ msgid "Only run a single test. Multiple options allowed." -#~ msgstr "मल्टीपल इंस्टैंसेज़ स्वीकार्य नहीं हैं. यह इंस्टैंस समाप्त होगा." - -#, fuzzy -#~ msgid "Put output in <directory> instead of <base_dir>/output" -#~ msgstr "आउटपुट डाटा स्थानीय एनकोडिंग में, बजाए UTF-8 के" - -#, fuzzy -#~ msgid "" -#~ "Relative path to testcase, or directory of testcases to be run " -#~ "(equivalent to -t)." -#~ msgstr "" -#~ "<p>%1 मौजूद नहीं है, या यह डिरेक्ट्री नहीं है या इस पर लिखा नहीं जा सकता.</p>" - -#, fuzzy -#~ msgid "TestRegression" -#~ msgstr "नियमित एक्सप्रेशन जाँचें" - -#, fuzzy -#~ msgid "Regression tester for kate" -#~ msgstr "Comment=के-एटीई के लिए पायथन ब्राउज़र प्लगइन" - -#~ msgid "Error: " -#~ msgstr "त्रुटि:" - -#~ msgid "&Insert spaces instead of tabulators" -#~ msgstr "टेबुलेटर के बजाए स्पेसेस प्रविष्ट करें (&I)" - -#, fuzzy -#~| msgid "&View Difference" -#~ msgid "View Differences" -#~ msgstr "भिन्नता देखें (&V)" - -#, fuzzy -#~| msgid "Disabled" -#~ msgctxt "Encodings menu" -#~ msgid "Disabled" -#~ msgstr "अक्षम" - -#~ msgid "Binary File Opened" -#~ msgstr "द्विचर फ़ाइल खोला गया" - -#~ msgid "Broken UTF-8 File Opened" -#~ msgstr "खंडित यूटीएफ़-8 फ़ाइल खोला" - -#, fuzzy -#~| msgid "General" -#~ msgid "Universal" -#~ msgstr "सामान्य" - -#~ msgid "&Word Wrap Document" -#~ msgstr "वर्ड रैप दस्तावेज़ (&W)" - -#, fuzzy -#~| msgid "Modifiy search behavior" -#~ msgid "Modify search behavior" -#~ msgstr "खोज व्यवहार परिवर्धित करें" - -#, fuzzy -#~| msgid "Options" -#~ msgid "&Options" -#~ msgstr "विकल्प" - -#~ msgid "From &cursor" -#~ msgstr "संकेतक से (&c)" - -#~ msgid "Hi&ghlight all" -#~ msgstr "सभी उभारें (&g)" - -#, fuzzy -#~| msgid "(c) 2000-2005 The Kate Authors" -#~ msgid "(c) 2000-2008 The Kate Authors" -#~ msgstr "(c) 2000-2005 केएटीई के लेखकगण" - -#~ msgid "Developer & Highlight wizard" -#~ msgstr "डेवलपर तथा हाइलाइट विज़ार्ड" - -#~ msgid "Unable to read file: '%1'" -#~ msgstr " फ़ाइल: '%1' को पढ़ने में अक्षम." - -#, fuzzy -#~ msgid "Failed to start interpreter for script %1, command %2" -#~ msgstr "इस लछ्य के लिए डिबगिंग सर्वर को प्रारंभ नहीं किया जा सका" - -#~ msgid "Success" -#~ msgstr "सफलता" - -#~ msgid "Move Character Right" -#~ msgstr "अक्षर को दायाँ खिसकाएँ" - -#~ msgid "Move Character Left" -#~ msgstr "अक्षर को बायाँ खिसकाएँ" - -#~ msgid "&Overwrite" -#~ msgstr "मिटाकर लिखें (&O)" - -#, fuzzy -#~| msgid "Regular Expression" -#~ msgid "Regular expression\t(Alt+4)" -#~ msgstr "नियमित (रेगुलर) एक्सप्रेशन." - -#~ msgid "Case Sensitive" -#~ msgstr "केस सेंसिटिव" - -#~ msgid "&Dynamic word wrap" -#~ msgstr "गतिशील वर्ड रैप (&D)" - -#, fuzzy -#~| msgid "(c) 2000-2005 The Kate Authors" -#~ msgid "(c) 2000-2007 The Kate Authors" -#~ msgstr "(c) 2000-2005 केएटीई के लेखकगण" - -#~ msgid "Line must be at least 1" -#~ msgstr "पंक्ति कम से कम 1 होना चाहिए" - -#~ msgid "There is not that many lines in this document" -#~ msgstr "इस दस्तावेज़ में उतनी पंक्तियाँ नहीं हैं" - -#, fuzzy -#~ msgid "Add special item to search pattern" -#~ msgstr "क्या आप इस वस्तु को मौज़ूदा सूची में या संकलन सूची में जोड़ना चाहते हैं?" - -#, fuzzy -#~ msgid "" -#~ "Resolve placeholders (\\0 to \\9) and escape sequences (\\n, \\t, ..)" -#~ msgstr "छपाई दायरा संपादित करने व देखने के लिए" - -#, fuzzy -#~ msgid "Add special item to replacement text" -#~ msgstr "वस्तु को चुनें जिसमें आप शीर्षक जोड़ना चाहते हैं." - -#~ msgid "Highlight all matches" -#~ msgstr "सभी मिलानों को उभारें" - -#~ msgid "Match case" -#~ msgstr "केस मिलाएँ" - -#, fuzzy -#~ msgid "Start search from cursor, not document start" -#~ msgstr "आपके दस्तावेज़ से स्लाइड को मिटाया नहीं गया है." - -#~ msgid "From cursor" -#~ msgstr "संकेतक से" - -#, fuzzy -#~ msgid "Search/replace within the current selection only" -#~ msgstr "सिर्फ वर्तमान शीट निर्यात किया जा सकता है." - -#~ msgid "Selection only " -#~ msgstr "सिर्फ चयन" - -#~ msgid "Shortcuts Configuration" -#~ msgstr "शॉर्टकट्स कॉन्फ़िगरेशन" - -#~ msgid "No encoding header" -#~ msgstr "कोई एनकोडिंग हेडर नहीं" - -#~ msgid "" -#~ "The spelling program could not be started. Please make sure you have set " -#~ "the correct spelling program and that it is properly configured and in " -#~ "your PATH." -#~ msgstr "" -#~ "स्पेलिंग प्रोग्राम चालू नहीं किया जा सका. कृपया सुनिश्चित हों कि वर्तनी जाँचक प्रोग्राम " -#~ "उचित प्रकार कॉन्फ़िगर्ड है तथा आपके पथ में है." - -#~ msgid "The spelling program seems to have crashed." -#~ msgstr "प्रतीत होता है कि स्पेलिंग प्रोग्राम क्रैश हो गया है." - -#~ msgid "unknown" -#~ msgstr "अज्ञात" - -#, fuzzy -#~ msgid "Context '%1': Incorrect number of arguments in '%2'" -#~ msgstr "डिफ़ संवाद में कॉन्टेक्स्ट पंक्तियों की संख्याः (&N)" - -#, fuzzy -#~ msgid "Exception, line %1: %2" -#~ msgstr "रेखा की रंग" - -#~ msgid "Could not access view." -#~ msgstr "दृश्य पर पहुँच नहीं सकता" - -#~ msgid "Could not access lookup object." -#~ msgstr "लुकअप वस्तु पर पहुँच नहीं सकता." - -#, fuzzy -#~ msgid "Exception: Unable to find function '%1': %2" -#~ msgstr "इनक्लूड फ़ाइल: \"%s\" ढूंढने में अक्षम" - -#, fuzzy -#~ msgid "Exception in line %1: %2" -#~ msgstr "%1में %2 पर पंक्ति %3 पर" - -#~ msgid "Sort: None" -#~ msgstr "छांटें: नहीं" - -#~ msgid "Filter: None" -#~ msgstr "फ़िल्टर: नहीं" - -#~ msgid "Setup" -#~ msgstr "सेटअप" - -#~ msgid "&Maximum undo steps:" -#~ msgstr "अधिकतम अनडू कदम: (&M)" - -#~ msgid " Static" -#~ msgstr "स्थिर" - -#~ msgid "Print syntax &guide" -#~ msgstr "सिंटेक्स मार्गदर्शक छापें (&g)" - -#~ msgid "Print &selected text only" -#~ msgstr "सिर्फ चुने गए पाठ छापें (&s)" - -#~ msgid "" -#~ "<p>This option is only available if some text is selected in the document." -#~ "</p><p>If available and enabled, only the selected text is printed.</p>" -#~ msgstr "" -#~ "<p>यह विकल्प तभी उपलब्ध होगा जब दस्तावेज़ में कोई पाठ चयन किया गया होगा.</" -#~ "p><p>यदि उपलब्ध होगा और सक्षम होगा, सिर्फ चुना गया पाठ मुद्रित होगा.</p>" - -#~ msgid "Print %1" -#~ msgstr "छापें %1" - -#~ msgid "Nowhere" -#~ msgstr "कहीं नहीं" - -#~ msgid "Selection, then Current Word" -#~ msgstr "चयन, फिर मौज़ूदा शब्द" - -#~ msgid "Current Word Only" -#~ msgstr "सिर्फ मौज़ूदा शब्द" - -#~ msgid "Current Word, then Selection" -#~ msgstr "मौज़ूदा शब्द, फिर चयन" - -#~ msgid "Smart search t&ext from:" -#~ msgstr "स्मार्ट खोज पाठ से: (&e)" - -#~ msgid "Clear &Bookmark" -#~ msgstr "पसंदीदा साफ करें (&B)" - -#~ msgid "(c) 2000-2004 The Kate Authors" -#~ msgstr "(c) 2000-2004 केएटीई के लेखकगण" - -#~ msgid "" -#~ "_: NAME OF TRANSLATORS\n" -#~ "Your names" -#~ msgstr "रविशंकर श्रीवास्तव" - -#~ msgid "" -#~ "_: EMAIL OF TRANSLATORS\n" -#~ "Your emails" -#~ msgstr "raviratlami@yahoo.com , http://www.geocities.com/raviratlami/" - -#~ msgid "Search string '%1' not found!" -#~ msgstr "खोज पंक्ति '%1' नहीं मिली!" - -#~ msgid "Find" -#~ msgstr "ढूंढें" - -#~ msgid "" -#~ "_n: %n replacement made.\n" -#~ "%n replacements made." -#~ msgstr "" -#~ "%n बदल दिया\n" -#~ "%n बदल दिए" - -#~ msgid "End of document reached." -#~ msgstr "दस्तावेज़ का अंत आ पंहुचा." - -#~ msgid "Beginning of document reached." -#~ msgstr "दस्तावेज़ का प्रारंभ आ पहुँचा." - -#~ msgid "End of selection reached." -#~ msgstr "चुने गए का अंत आ पंहुचा." - -#~ msgid "Beginning of selection reached." -#~ msgstr "चुने गए का प्रारंभ आ पहुँचा." - -#~ msgid "Continue from the beginning?" -#~ msgstr "प्रारंभ से जारी रखें?" - -#~ msgid "Replace Confirmation" -#~ msgstr "बदलने के लिए पुष्टिकरण" - -#~ msgid "Re&place && Close" -#~ msgstr "बदलें तथा बन्द करें (&p)" - -#~ msgid "Found an occurrence of your search term. What do you want to do?" -#~ msgstr "आपका ढूंढा गया वाक्यांश मिला. आप क्या करना चाहेंगे?" - -#~ msgid "Usage: find[:[bcersw]] PATTERN" -#~ msgstr "उपयोग: find[:[bcersw]] पैटर्न" - -#~ msgid "Usage: ifind[:[bcrs]] PATTERN" -#~ msgstr "उपयोग: ifind[:[bcrs]] पैटर्न" - -#~ msgid "Usage: replace[:[bceprsw]] PATTERN [REPLACEMENT]" -#~ msgstr "उपयोग: replace[:[bceprsw]] PATTERN [REPLACEMENT]" - -#~ msgid "<p>Usage: <code>find[:bcersw] PATTERN</code></p>" -#~ msgstr "<p>उपयोग: <code>find[:bcersw] PATTERN</code></p>" - -#~ msgid "<p>Usage: <code>replace[:bceprsw] PATTERN REPLACEMENT</code></p>" -#~ msgstr "<p>उपयोग: <code>replace[:bceprsw] PATTERN REPLACEMENT</code></p>" - -#~ msgid "" -#~ "<br><b>e</b> - Search in selected text only<br><b>w</b> - Search whole " -#~ "words only" -#~ msgstr "<br><b>e</b> - सिर्फ चयनित पाठ में ढूंढें<br><b>w</b> - सिर्फ पूर्ण शब्द ढूंढें" - -#, fuzzy -#~ msgid "Cursor & Selection Behavior" -#~ msgstr "चयन बर्ताव" - -#~ msgid "Indentation Rules" -#~ msgstr "जगह छोड़ने के नियम" - -#~ msgid "Filetype Specific Settings" -#~ msgstr "फ़ाइल क़िस्म विशिष्ट विन्यास" - -#~ msgid "Plugin Manager" -#~ msgstr "प्लगइन प्रबंधक" - -#~ msgid "" -#~ "The file %1 could not be loaded completely, as there is not enough " -#~ "temporary disk storage for it." -#~ msgstr "" -#~ "फ़ाइल %1 पूरी तरह लोड नहीं किया जा सका, चूंकि वहाँ पर अस्थाई डिस्क भंडारण में पर्याप्त " -#~ "जगह नहीं है." - -#~ msgid "" -#~ "This file could not be loaded correctly due to lack of temporary disk " -#~ "space. Saving it could cause data loss.\n" -#~ "\n" -#~ "Do you really want to save it?" -#~ msgstr "" -#~ "अस्थायी डिस्क जगह पूरी न होने से यह फ़ाइल उचित प्रकार से लोड नहीं हो सकी. इसे सहेजने " -#~ "पर डाटा नुकसान संभावित है.\n" -#~ "\n" -#~ "क्या आप वास्तव में इसे सहेजना चाहेंगे?" - -#~ msgid "N&ame:" -#~ msgstr "नाम: (&a)" - -#~ msgid "Prio&rity:" -#~ msgstr "प्राथमिकता: (&r)" - -#~ msgid "Automatic Indentation" -#~ msgstr "स्वचलित जगह छोड़ना" - -#~ msgid "Configure..." -#~ msgstr "कॉन्फ़िगर..." - -#~ msgid "Insert leading Doxygen \"*\" when typing" -#~ msgstr "जब टाइप कर रहे हों तो लीडिंग डॉक्सीजन \"*\" प्रविष्ट करें" - -#~ msgid "Indentation with Spaces" -#~ msgstr "फ़ासलों के साथ हाशिए" - -#~ msgid "Use &spaces instead of tabs to indent" -#~ msgstr "हाशिया के लिए टैब्स के बजाए स्पेसेस इस्तेमाल करें (&s)" - -#~ msgid "Number of spaces:" -#~ msgstr "स्पेसेस की संख्या:" - -#~ msgid "Keep indent &profile" -#~ msgstr "हाशिया प्रोफ़ाइल रखें (&p)" - -#~ msgid "Keys to Use" -#~ msgstr "उपयोग में कुंजियाँ" - -#~ msgid "Tab Key Mode if Nothing Selected" -#~ msgstr "यदि कुछ चुने गए नहीं है तो टैब की मोड" - -#~ msgid "Insert indent &characters" -#~ msgstr "हाशिया तथा अक्षर जोड़ें (&c)" - -#~ msgid "I&nsert tab character" -#~ msgstr "टैब अक्षर जोड़ें (&n)" - -#~ msgid "Check this if you want to indent with spaces rather than tabs." -#~ msgstr "इसे चेक करें यदि आप स्पेस के साथ हाशिया चाहते हैं बजाए टैब्स के." - -#~ msgid "" -#~ "Indentations of more than the selected number of spaces will not be " -#~ "shortened." -#~ msgstr "चुने गए स्पेसेस संख्या से ज्यादा हाशिए कम नहीं किए जाएंगे." - -#~ msgid "" -#~ "This allows the <b>Tab</b> key to be used to increase the indentation " -#~ "level." -#~ msgstr "यह <b>टैब</b>कुंजी के द्वारा हाशिए का स्तर बढ़ाने देता है." - -#~ msgid "" -#~ "This allows the <b>Backspace</b> key to be used to decrease the " -#~ "indentation level." -#~ msgstr "यह <b>बैकस्पेस</b>कुंजी के द्वारा हाशिए का स्तर कम करने देता है." - -#, fuzzy -#~ msgid "Configure Indenter" -#~ msgstr "संपादक कॉन्फ़िगर करें... (&C)" - -#, fuzzy -#~ msgid "&Show tabulators" -#~ msgstr "टैब दिखाएँ (&S)" - -#~ msgid "Collapse toplevel folding nodes" -#~ msgstr "टॉपलेवल फोल्डिंग नोड्स कोलेप्स करें" - -#~ msgid "Memory Usage" -#~ msgstr "मेमोरी उपयोग" - -#, fuzzy -#~ msgid "Maximum loaded &blocks per file:" -#~ msgstr "प्रति फ़ाइल अधिकतम लोडेड ब्लॉक्स: <b>%1</b>" - -#~ msgid "Check this if you want backups of local files when saving" -#~ msgstr "इसे चेक करें यदि आप सहेजते समय स्थानीय फ़ाइलों का बैकअप चाहते हैं" - -#~ msgid "Check this if you want backups of remote files when saving" -#~ msgstr "इसे चेक करें यदि आप सहेजते समय रिमोट फ़ाइलों का बैकअप चाहते हैं" - -#~ msgid "Configure %1" -#~ msgstr "कॉन्फ़िगर करें %1" - -#~ msgid "Do&wnload..." -#~ msgstr "डाउनलोड... (&w)" - -#~ msgid "" -#~ "Choose a <em>Syntax Highlight mode</em> from this list to view its " -#~ "properties below." -#~ msgstr "चुनें एक <em>सिंटेक्स उभार मोड</em> इस सूची से निम्न गुण देखने के लिए." - -#~ msgid "" -#~ "The list of file extensions used to determine which files to highlight " -#~ "using the current syntax highlight mode." -#~ msgstr "" -#~ "मौज़ूदा सिंटेक्स उभार मोड के उपयोग से किन फ़ाइलों को उभारा जाना है उन फ़ाइल एक्सटेंशन " -#~ "की सूची." - -#~ msgid "" -#~ "Display a dialog with a list of all available mime types to choose from." -#~ "<p>The <strong>File Extensions</strong> entry will automatically be " -#~ "edited as well." -#~ msgstr "" -#~ "सभी उपलब्ध माइम क़िस्म की सूची से चुनने के लिए एक संवाद दिखाए.<p> <strong>फ़ाइल " -#~ "एक्सटेंशन्स</strong> प्रविष्टि स्वचलित संपादित होगी ही." - -#~ msgid "" -#~ "Click this button to download new or updated syntax highlight " -#~ "descriptions from the Kate website." -#~ msgstr "" -#~ "के-एटीई वेब साइट से नया या अद्यतन सिंटेक्स उभार वर्णन डाउनलोड करने के लिए इस बटन पर " -#~ "क्लिक करें." - -#~ msgid "" -#~ "Select the MimeTypes you want highlighted using the '%1' syntax highlight " -#~ "rules.\n" -#~ "Please note that this will automatically edit the associated file " -#~ "extensions as well." -#~ msgstr "" -#~ "सिंटेक्स उभार नियम '%1' के उपयोग से उभारने के लिए माइम क़िस्म चुनें.\n" -#~ "कृपया नोट करें कि यह स्वचलित रूप से संबंधित फ़ाइल एक्सटेंशन को भी संपादित करेगा ही." - -#~ msgid "Go to Line" -#~ msgstr "पंक्ति पर जाएँ" - -#~ msgid "&Filetype" -#~ msgstr "फ़ाइल-क़िस्म (&F)" - -#~ msgid "Hide Folding &Markers" -#~ msgstr "फोल्डिंग निशान छुपाएँ (&M)" - -#~ msgid "Hide &Icon Border" -#~ msgstr "प्रतीक किनारा छुपाएँ (&I)" - -#~ msgid "Hide &Line Numbers" -#~ msgstr "पंक्ति क्रमांक छुपाएँ (&L)" - -#~ msgid "Hide Scroll&bar Marks" -#~ msgstr "स्क्रॉल पट्टी चिह्न छुपाएँ (&b)" - -#~ msgid "Hide Static &Word Wrap Marker" -#~ msgstr "स्थिर वर्ड रैप मार्कर छुपाएँ (&W)" - -#~ msgid "Show the code folding region tree" -#~ msgstr "कोड फोल्डिंग रीजन ट्री दिखाएँ" - -#~ msgid "Basic template code test" -#~ msgstr "मूल टेम्पलेट कोड जाँच" - -#~ msgid " OVR " -#~ msgstr "मिटाकर" - -#~ msgid " Col: %1" -#~ msgstr "स्तम्भ: %1" - -#~ msgid " NORM " -#~ msgstr "सामान्य" - -#~ msgid "Overwrite the file" -#~ msgstr "फ़ाइल को मिटाकर लिखें" - -#~ msgid "Python Style" -#~ msgstr "पायथन शैली" - -#~ msgid "S&S C Style" -#~ msgstr "एसएण्डएस सी शैली (&S)" - -#, fuzzy -#~ msgid "Variable Based Indenter" -#~ msgstr "वेरिएबल आधारित इंडेंटर" - -#~ msgid "Mode must be at least 0." -#~ msgstr "मोड कम से कम 0 होना चाहिए" - -#, fuzzy -#~ msgid "" -#~ "_n: 1 replacement done\n" -#~ "%n replacements done" -#~ msgstr "" -#~ "_n: 1 बदल दिया\n" -#~ "%n बदले गए" - -#~ msgid "" -#~ "_: Language\n" -#~ "ABC" -#~ msgstr "एबीसी" - -#~ msgid "" -#~ "_: Language\n" -#~ "Ada" -#~ msgstr "एडा" - -#~ msgid "" -#~ "_: Language Section\n" -#~ "Sources" -#~ msgstr "स्रोत" - -#~ msgid "" -#~ "_: Language\n" -#~ "AHDL" -#~ msgstr "एएचडीएल" - -#~ msgid "" -#~ "_: Language Section\n" -#~ "Hardware" -#~ msgstr "हार्डवेयर" - -#~ msgid "" -#~ "_: Language\n" -#~ "Alerts" -#~ msgstr "अलर्ट्स" - -#~ msgid "" -#~ "_: Language\n" -#~ "ANSI C89" -#~ msgstr "एएनएसआई सी89" - -#, fuzzy -#~ msgid "" -#~ "_: Language\n" -#~ "Apache Configuration" -#~ msgstr "कॉन्फ़िगरेशन" - -#~ msgid "" -#~ "_: Language Section\n" -#~ "Configuration" -#~ msgstr "कॉन्फ़िगरेशन" - -#~ msgid "" -#~ "_: Language\n" -#~ "AVR Assembler" -#~ msgstr "एवीआर असेंबलर" - -#~ msgid "" -#~ "_: Language Section\n" -#~ "Assembler" -#~ msgstr "असेंबलर" - -#~ msgid "" -#~ "_: Language\n" -#~ "Asm6502" -#~ msgstr "एएसएम६५०२" - -#~ msgid "" -#~ "_: Language\n" -#~ "ASP" -#~ msgstr "एएसपी" - -#~ msgid "" -#~ "_: Language Section\n" -#~ "Markup" -#~ msgstr "मार्कअप" - -#~ msgid "" -#~ "_: Language\n" -#~ "AWK" -#~ msgstr "ऑक" - -#~ msgid "" -#~ "_: Language Section\n" -#~ "Scripts" -#~ msgstr "स्क्रिप्ट्स" - -#~ msgid "" -#~ "_: Language\n" -#~ "Bash" -#~ msgstr "बॉश" - -#~ msgid "" -#~ "_: Language\n" -#~ "BibTeX" -#~ msgstr "बिब-टेक्स" - -#~ msgid "" -#~ "_: Language\n" -#~ "C" -#~ msgstr "सी" - -#~ msgid "" -#~ "_: Language\n" -#~ "Cg" -#~ msgstr "सीजी" - -#~ msgid "" -#~ "_: Language\n" -#~ "CGiS" -#~ msgstr "सीजीआईएस" - -#~ msgid "" -#~ "_: Language\n" -#~ "ChangeLog" -#~ msgstr "चेंज-लॉग" - -#~ msgid "" -#~ "_: Language\n" -#~ "Cisco" -#~ msgstr "किस्को" - -#~ msgid "" -#~ "_: Language\n" -#~ "Clipper" -#~ msgstr "क्लिपर" - -#~ msgid "" -#~ "_: Language\n" -#~ "CMake" -#~ msgstr "सीमेक" - -#~ msgid "" -#~ "_: Language\n" -#~ "ColdFusion" -#~ msgstr "कोल्ड-फ़्यूज़न" - -#~ msgid "" -#~ "_: Language\n" -#~ "Common Lisp" -#~ msgstr "कॉमन लिस्प" - -#~ msgid "" -#~ "_: Language\n" -#~ "Component-Pascal" -#~ msgstr "कम्पोनेंट-पॉस्कल" - -#~ msgid "" -#~ "_: Language\n" -#~ "C++" -#~ msgstr "सी++" - -#~ msgid "" -#~ "_: Language\n" -#~ "C#" -#~ msgstr "सी#" - -#~ msgid "" -#~ "_: Language\n" -#~ "CSS" -#~ msgstr "सीएसएस" - -#~ msgid "" -#~ "_: Language\n" -#~ "CUE Sheet" -#~ msgstr "क्यू शीट" - -#~ msgid "" -#~ "_: Language\n" -#~ "D" -#~ msgstr "डी" - -#~ msgid "" -#~ "_: Language\n" -#~ "Debian Control" -#~ msgstr "डेबियन नियंत्रण" - -#~ msgid "" -#~ "_: Language\n" -#~ ".desktop" -#~ msgstr ".डेस्कटॉप" - -#~ msgid "" -#~ "_: Language\n" -#~ "Diff" -#~ msgstr "डिफ़" - -#~ msgid "" -#~ "_: Language\n" -#~ "Doxygen" -#~ msgstr "डॉक्सीज़न" - -#~ msgid "" -#~ "_: Language\n" -#~ "E Language" -#~ msgstr "ई भाषा" - -#~ msgid "" -#~ "_: Language\n" -#~ "Eiffel" -#~ msgstr "इफ़ेल" - -#, fuzzy -#~ msgid "" -#~ "_: Language\n" -#~ "Email" -#~ msgstr "इफ़ेल" - -#~ msgid "" -#~ "_: Language\n" -#~ "Euphoria" -#~ msgstr "यूफ़ोरिया" - -#~ msgid "" -#~ "_: Language\n" -#~ "ferite" -#~ msgstr "फ़ेराइट" - -#~ msgid "" -#~ "_: Language\n" -#~ "4GL" -#~ msgstr "4जीएल" - -#~ msgid "" -#~ "_: Language Section\n" -#~ "Database" -#~ msgstr "डाटाबेस" - -#~ msgid "" -#~ "_: Language\n" -#~ "4GL-PER" -#~ msgstr "4जीएल-पीईआर" - -#~ msgid "" -#~ "_: Language\n" -#~ "Fortran" -#~ msgstr "फ़ोरट्रॉन" - -#, fuzzy -#~ msgid "" -#~ "_: Language\n" -#~ "fstab" -#~ msgstr "साइलेब" - -#~ msgid "" -#~ "_: Language\n" -#~ "GDL" -#~ msgstr "जीडीएल" - -#~ msgid "" -#~ "_: Language Section\n" -#~ "Scientific" -#~ msgstr "साइंटिफ़िक" - -#~ msgid "" -#~ "_: Language\n" -#~ "GLSL" -#~ msgstr "जीएलएसएल" - -#~ msgid "" -#~ "_: Language\n" -#~ "GNU Assembler" -#~ msgstr "जीएनयू असेंबलर" - -#~ msgid "" -#~ "_: Language\n" -#~ "Haskell" -#~ msgstr "हास्केल" - -#~ msgid "" -#~ "_: Language\n" -#~ "HTML" -#~ msgstr "एचटीएमएल" - -#~ msgid "" -#~ "_: Language\n" -#~ "Quake Script" -#~ msgstr "क्वैक स्क्रिप्ट" - -#~ msgid "" -#~ "_: Language\n" -#~ "IDL" -#~ msgstr "आईडीएल" - -#~ msgid "" -#~ "_: Language\n" -#~ "ILERPG" -#~ msgstr "आईएलईआरपीजी" - -#~ msgid "" -#~ "_: Language\n" -#~ "Inform" -#~ msgstr "इन्फॉर्म" - -#, fuzzy -#~ msgid "" -#~ "_: Language\n" -#~ "INI Files" -#~ msgstr "अलर्ट्स" - -#~ msgid "" -#~ "_: Language\n" -#~ "Java" -#~ msgstr "जावा" - -#~ msgid "" -#~ "_: Language\n" -#~ "Javadoc" -#~ msgstr "जावाडॉक" - -#~ msgid "" -#~ "_: Language\n" -#~ "JavaScript" -#~ msgstr "जावा स्क्रिप्ट" - -#~ msgid "" -#~ "_: Language\n" -#~ "JSP" -#~ msgstr "जेएसपी" - -#~ msgid "" -#~ "_: Language\n" -#~ "KBasic" -#~ msgstr "के-बेसिक" - -#~ msgid "" -#~ "_: Language\n" -#~ "LaTeX" -#~ msgstr "लेटेक्स" - -#~ msgid "" -#~ "_: Language\n" -#~ "LDIF" -#~ msgstr "एलडीआईएफ़" - -#~ msgid "" -#~ "_: Language\n" -#~ "Lex/Flex" -#~ msgstr "लेक्स/फ्लैक्स" - -#~ msgid "" -#~ "_: Language\n" -#~ "LilyPond" -#~ msgstr "लिलीपाण्ड" - -#~ msgid "" -#~ "_: Language\n" -#~ "Logtalk" -#~ msgstr "लागटाक" - -#~ msgid "" -#~ "_: Language\n" -#~ "LPC" -#~ msgstr "एलपीसी" - -#~ msgid "" -#~ "_: Language\n" -#~ "Lua" -#~ msgstr "ल्यूआ" - -#, fuzzy -#~ msgid "" -#~ "_: Language\n" -#~ "M3U" -#~ msgstr "एसएमएल" - -#~ msgid "" -#~ "_: Language\n" -#~ "MAB-DB" -#~ msgstr "एमएबी-डीबी" - -#~ msgid "" -#~ "_: Language\n" -#~ "Makefile" -#~ msgstr "मेकफ़ाइल" - -#~ msgid "" -#~ "_: Language\n" -#~ "Mason" -#~ msgstr "मेसन" - -#~ msgid "" -#~ "_: Language\n" -#~ "Matlab" -#~ msgstr "मेटलेब" - -#, fuzzy -#~ msgid "" -#~ "_: Language\n" -#~ "Wikimedia" -#~ msgstr "पाइक" - -#~ msgid "" -#~ "_: Language\n" -#~ "MIPS Assembler" -#~ msgstr "एमआईपीएस असेंबलर" - -#~ msgid "" -#~ "_: Language\n" -#~ "Modula-2" -#~ msgstr "मॉड्यूला-२" - -#~ msgid "" -#~ "_: Language\n" -#~ "Objective-C" -#~ msgstr "ऑब्जेक्टिव-सी" - -#~ msgid "" -#~ "_: Language\n" -#~ "Objective Caml" -#~ msgstr "ऑब्जेक्टिव सीएएमएल" - -#~ msgid "" -#~ "_: Language\n" -#~ "Octave" -#~ msgstr "ऑक्टैव" - -#~ msgid "" -#~ "_: Language\n" -#~ "Pascal" -#~ msgstr "पॉस्कल" - -#~ msgid "" -#~ "_: Language\n" -#~ "Perl" -#~ msgstr "पर्ल" - -#~ msgid "" -#~ "_: Language\n" -#~ "PHP/PHP" -#~ msgstr "पीएचपी/पीएचपी" - -#~ msgid "" -#~ "_: Language\n" -#~ "PicAsm" -#~ msgstr "पिक-एएसएम" - -#~ msgid "" -#~ "_: Language\n" -#~ "Pike" -#~ msgstr "पाइक" - -#~ msgid "" -#~ "_: Language\n" -#~ "PostScript" -#~ msgstr "पोस्ट-स्क्रिप्ट" - -#~ msgid "" -#~ "_: Language\n" -#~ "POV-Ray" -#~ msgstr "पोव-रे" - -#, fuzzy -#~ msgid "" -#~ "_: Language\n" -#~ "progress" -#~ msgstr "प्रोग्रेस" - -#~ msgid "" -#~ "_: Language\n" -#~ "Prolog" -#~ msgstr "प्रोलॉग" - -#~ msgid "" -#~ "_: Language\n" -#~ "PureBasic" -#~ msgstr "प्योर-बेसिक" - -#~ msgid "" -#~ "_: Language\n" -#~ "Python" -#~ msgstr "पॉयथन" - -#~ msgid "" -#~ "_: Language\n" -#~ "R Script" -#~ msgstr "आर स्क्रिप्ट" - -#~ msgid "" -#~ "_: Language\n" -#~ "REXX" -#~ msgstr "रेक्स" - -#~ msgid "" -#~ "_: Language\n" -#~ "RPM Spec" -#~ msgstr "आरपीएम -स्पेक" - -#~ msgid "" -#~ "_: Language\n" -#~ "RSI IDL" -#~ msgstr "आरएसआई आईडीएल" - -#~ msgid "" -#~ "_: Language\n" -#~ "Ruby" -#~ msgstr "रूबी" - -#~ msgid "" -#~ "_: Language\n" -#~ "Sather" -#~ msgstr "सादेर" - -#~ msgid "" -#~ "_: Language\n" -#~ "Scheme" -#~ msgstr "स्कीम" - -#~ msgid "" -#~ "_: Language\n" -#~ "scilab" -#~ msgstr "साइलेब" - -#~ msgid "" -#~ "_: Language\n" -#~ "SGML" -#~ msgstr "एसजीएमएल" - -#~ msgid "" -#~ "_: Language\n" -#~ "Sieve" -#~ msgstr "सीव" - -#~ msgid "" -#~ "_: Language\n" -#~ "SML" -#~ msgstr "एसएमएल" - -#, fuzzy -#~ msgid "" -#~ "_: Language\n" -#~ "Spice" -#~ msgstr "सीव" - -#~ msgid "" -#~ "_: Language\n" -#~ "SQL (PostgreSQL)" -#~ msgstr "एसक्यूएल (पोस्टग्रे-एसक्यूएल)" - -#~ msgid "" -#~ "_: Language\n" -#~ "SQL" -#~ msgstr "एसक्यूएल" - -#~ msgid "" -#~ "_: Language\n" -#~ "Stata" -#~ msgstr "स्टाटा" - -#~ msgid "" -#~ "_: Language\n" -#~ "Tcl/Tk" -#~ msgstr "टीसीएल/टीके" - -#~ msgid "" -#~ "_: Language\n" -#~ "TI Basic" -#~ msgstr "टीआई बेसिक" - -#~ msgid "" -#~ "_: Language\n" -#~ "txt2tags" -#~ msgstr "टीएक्सटी2टैग्स" - -#~ msgid "" -#~ "_: Language\n" -#~ "UnrealScript" -#~ msgstr "अनरीयल-स्क्रिप्ट" - -#~ msgid "" -#~ "_: Language\n" -#~ "Velocity" -#~ msgstr "वेलॉसिटी" - -#~ msgid "" -#~ "_: Language\n" -#~ "Verilog" -#~ msgstr "वेरीलॉग" - -#~ msgid "" -#~ "_: Language\n" -#~ "VHDL" -#~ msgstr "वीएचडीएल" - -#~ msgid "" -#~ "_: Language\n" -#~ "VRML" -#~ msgstr "वीआरएमएल" - -#~ msgid "" -#~ "_: Language\n" -#~ "WINE Config" -#~ msgstr "वाइन कॉन्फ़िग" - -#~ msgid "" -#~ "_: Language\n" -#~ "xHarbour" -#~ msgstr "एक्स हार्बर" - -#~ msgid "" -#~ "_: Language\n" -#~ "XML" -#~ msgstr "एक्सएमएल" - -#~ msgid "" -#~ "_: Language\n" -#~ "xslt" -#~ msgstr "एक्एसएलटी" - -#~ msgid "" -#~ "_: Language\n" -#~ "yacas" -#~ msgstr "याकास" - -#~ msgid "Word Completion Plugin" -#~ msgstr "वर्ड कम्प्लीशन प्लगिन" - -#~ msgid "Configure the Word Completion Plugin" -#~ msgstr "वर्ड कम्प्लीशन प्लगिन को कॉन्फ़िगर करें" - -#~ msgid "Pop Up Completion List" -#~ msgstr "पॉप अप पूर्णता सूची" - -#, fuzzy -#~ msgid "Automatically &show completion list" -#~ msgstr "पूर्णता सूची को स्वचालित दिखाएँ" - -#~ msgid "Choose File to Insert" -#~ msgstr "फ़ाइल घुसाने के लिए चुनें" - -#~ msgid "" -#~ "Failed to load file:\n" -#~ "\n" -#~ msgstr "" -#~ "फ़ाइल लोड करने में असफल:\n" -#~ "\n" - -#~ msgid "Insert File Error" -#~ msgstr "फ़ाइल त्रुटि जोड़ें" - -#~ msgid "" -#~ "<p>The file <strong>%1</strong> does not exist or is not readable, " -#~ "aborting." -#~ msgstr "<p>फ़ाइल <strong>%1</strong> उपलब्ध नहीं है, या पढ़ने योग्य नहीं है. छोड़ा." - -#~ msgid "<p>Unable to open file <strong>%1</strong>, aborting." -#~ msgstr "<p>फ़ाइल खोलने में अक्षम <strong>%1</strong>, छोड़ा." - -#~ msgid "<p>File <strong>%1</strong> had no contents." -#~ msgstr "<p>फ़ाइल <strong>%1</strong> में कुछ भी विषय-वस्तु नहीं है" - -#~ msgid "Data Tools" -#~ msgstr "डाटा टूल्स" - -#~ msgid "(not available)" -#~ msgstr "(उपलब्ध नहीं)" - -#~ msgid "" -#~ "Data tools are only available when text is selected, or when the right " -#~ "mouse button is clicked over a word. If no data tools are offered even " -#~ "when text is selected, you need to install them. Some data tools are part " -#~ "of the KOffice package." -#~ msgstr "" -#~ "डाटा औज़ार केवल तभी उपलब्ध होंगे जब पाठ चुना गया हो ,या दायाँ माउस बटन किसी शब्द " -#~ "पर क्लिक किया हो । अगर पाठ चयन करने पर भी डाटा औज़ार उपलब्ध न हो तो आपको उसे " -#~ "स्थापित करना होगा । कुछ डाटा औज़ार के-ऑफिस पैकेज के भाग हैं." - -#~ msgid "Search Incrementally" -#~ msgstr "बढ़ते क्रम में ढूंढें" - -#~ msgid "Search Incrementally Backwards" -#~ msgstr "पीछे की ओर से बढ़ते क्रम में ढूंढें" - -#~ msgid "I-Search:" -#~ msgstr "आई-ढूंढें:" - -#~ msgid "Search" -#~ msgstr "ढूंढें" - -#~ msgid "From Beginning" -#~ msgstr "प्रारंभ से जारी रखें?" - -#~ msgid "" -#~ "_: Incremental Search\n" -#~ "I-Search:" -#~ msgstr "आई-खोज:" - -#~ msgid "" -#~ "_: Incremental Search found no match\n" -#~ "Failing I-Search:" -#~ msgstr "असफल आई-खोज:" - -#~ msgid "" -#~ "_: Incremental Search in the reverse direction\n" -#~ "I-Search Backward:" -#~ msgstr "आई-खोज पीछे की ओर से:" - -#~ msgid "Failing I-Search Backward:" -#~ msgstr "आई-खोज पीछे की तरफ से असफल:" - -#~ msgid "" -#~ "_: Incremental Search has passed the end of the document\n" -#~ "Wrapped I-Search:" -#~ msgstr "रैप्ड आई-खोज:" - -#~ msgid "Failing Wrapped I-Search:" -#~ msgstr "रैप्ड आई-खोज असफल:" - -#~ msgid "Wrapped I-Search Backward:" -#~ msgstr "रैप्ड आई-खोज पीछे की ओर से: " - -#~ msgid "Failing Wrapped I-Search Backward:" -#~ msgstr "आई-खोज पीछे की ओर से असफल:" - -#~ msgid "" -#~ "_: Incremental Search has passed both the end of the document and the " -#~ "original starting position\n" -#~ "Overwrapped I-Search:" -#~ msgstr "ओवररैप्ड आई-खोज:" - -#~ msgid "Failing Overwrapped I-Search:" -#~ msgstr "ओवररैप्ड आई-खोज असफल:" - -#~ msgid "Overwrapped I-Search Backwards:" -#~ msgstr "ओवररैप्ड आई-खोज पीछे की ओर से:" - -#~ msgid "Failing Overwrapped I-Search Backward:" -#~ msgstr "ओवररैप्ड आई-खोज पीछे की ओर से असफल:" - -#~ msgid "Error: unknown i-search state!" -#~ msgstr "त्रुटिः अज्ञात आई-खोज स्थिति!" - -#~ msgid "Next Incremental Search Match" -#~ msgstr "अगला बढ़ते क्रम में खोज जोड़ी" - -#~ msgid "Previous Incremental Search Match" -#~ msgstr "पिछला बढ़ते क्रम में खोज जोड़ी" - -#~ msgid "AutoBookmarks" -#~ msgstr "स्वचालित-पसंद" - -#~ msgid "Configure AutoBookmarks" -#~ msgstr "स्वचालित-पसंद कॉन्फ़िगर करें" - -#~ msgid "&Pattern:" -#~ msgstr "पैटर्न: (&P)" - -#~ msgid "<p>A regular expression. Matching lines will be bookmarked.</p>" -#~ msgstr "<p>एक रेगुलर एक्सप्रेशन. जोड़ मिलती पंक्तियों को पुस्तचिह्नित किया जाएगा.</p>" - -#~ msgid "" -#~ "<p>If enabled, the pattern matching will be case sensitive, otherwise not." -#~ "</p>" -#~ msgstr "" -#~ "<p>यदि सक्षम किया जाता है, पैटर्न जोड़ मिलाना केस सेंसिटिव होगा, अन्यथा नहीं.</p>" - -#~ msgid "&File mask:" -#~ msgstr "फ़ाइल मास्क: (&F)" - -#~ msgid "" -#~ "Select the MimeTypes for this pattern.\n" -#~ "Please note that this will automatically edit the associated file " -#~ "extensions as well." -#~ msgstr "" -#~ "इस पैटर्न के लिए माइम क़िस्म चुनें.\n" -#~ "कृपया टीप लें कि यह स्वचलित ही सम्बद्ध फ़ाइल एक्सटेंशन का संपादन भी कर देगा." - -#~ msgid "&Patterns" -#~ msgstr "पैटर्न (&P)" - -#~ msgid "Pattern" -#~ msgstr "पैटर्न" - -#~ msgid "Mime Types" -#~ msgstr "माइम क़िस्म" - -#~ msgid "Press this button to create a new autobookmark entity." -#~ msgstr "नया स्वचालित-पसंद एंटिटी बनाने के लिए इस बटन को दबाएँ." - -#~ msgid "Press this button to delete the currently selected entity." -#~ msgstr "मौज़ूदा चुनी गई एंटिटी मिटाने के लिए इस बटन को दबाएँ." - -#~ msgid "&Edit..." -#~ msgstr "संपादन (&E)" - -#~ msgid "Press this button to edit the currently selected entity." -#~ msgstr "मौज़ूदा चुनी गई एंटिटी का संपादन करने के लिए इस बटन को दबाएँ." - -#~ msgid "Spell Checker Behavior" -#~ msgstr "वर्तनी जांच बर्ताव" - -#~ msgid "&HTML..." -#~ msgstr "एचटीएमएल... (&H)" - -#~ msgid "View Defaults" -#~ msgstr "डिफ़ॉल्ट दिखाएँ" - -#~ msgid "Replace &tabs with spaces" -#~ msgstr "टैब्स को स्पेसेस से बदलें (&t)" - -#~ msgid "Increase Font Sizes" -#~ msgstr "फ़ॉन्ट आकार बढ़ाएँ" - -#~ msgid "Decrease Font Sizes" -#~ msgstr "फ़ॉन्ट आकार घटाएँ" - -#~ msgid "when the word is" -#~ msgstr "जब शब्द हो" - -#~ msgid "characters long." -#~ msgstr "अक्षर लंबा." diff -Nru kde-l10n-hi-4.12.97/messages/frameworks/kwalletd.po kde-l10n-hi-4.13.0/messages/frameworks/kwalletd.po --- kde-l10n-hi-4.12.97/messages/frameworks/kwalletd.po 2014-03-21 04:12:46.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/frameworks/kwalletd.po 1970-01-01 00:00:00.000000000 +0000 @@ -1,597 +0,0 @@ -# translation of kwalletd.po to Hindi -# Copyright (C) YEAR This_file_is_part_of_KDE -# This file is distributed under the same license as the PACKAGE package. -# -# Rajesh Ranjan <rajesh672@gmail.com>, 2010. -# G Karunakar <karunakar@indlinux.org>, 2012. -msgid "" -msgstr "" -"Project-Id-Version: kwalletd\n" -"Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-21 01:53+0000\n" -"PO-Revision-Date: 2012-07-02 16:09+0530\n" -"Last-Translator: G Karunakar <karunakar@indlinux.org>\n" -"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" -"Language: hi\n" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" -"X-Generator: Lokalize 1.2\n" -"Plural-Forms: nplurals=2; plural=(n!=1);\n" -"\n" - -msgctxt "NAME OF TRANSLATORS" -msgid "Your names" -msgstr "जी. करूणाकर" - -msgctxt "EMAIL OF TRANSLATORS" -msgid "Your emails" -msgstr "karunakar@indlinux.org" - -#: backend/backendpersisthandler.cpp:504 -#, kde-format -msgid "" -"<qt>Error when attempting to initialize OpenPGP while attempting to save the " -"wallet <b>%1</b>. Error code is <b>%2</b>. Please fix your system " -"configuration, then try again!</qt>" -msgstr "" - -#: backend/backendpersisthandler.cpp:512 -#, kde-format -msgid "" -"<qt>Error when attempting to initialize OpenPGP while attempting to save the " -"wallet <b>%1</b>. Please fix your system configuration, then try again!</qt>" -msgstr "" - -#: backend/backendpersisthandler.cpp:563 -#, kde-format -msgid "" -"<qt>Encryption error while attempting to save the wallet <b>%1</b>. Error " -"code is <b>%2 (%3)</b>. Please fix your system configuration, then try again!" -"</qt>" -msgstr "" - -#: backend/backendpersisthandler.cpp:575 -#, kde-format -msgid "" -"<qt>File handling error while attempting to save the wallet <b>%1</b>. Error " -"was <b>%2</b>. Please fix your system configuration, then try again!</qt>" -msgstr "" - -#: backend/backendpersisthandler.cpp:588 -#, kde-format -msgid "" -"<qt>Error when attempting to initialize OpenPGP while attempting to open the " -"wallet <b>%1</b>. Error code is <b>%2</b>. Please fix your system " -"configuration, then try again!</qt>" -msgstr "" - -#: backend/backendpersisthandler.cpp:606 -#, kde-format -msgid "" -"<qt>Error when attempting to initialize OpenPGP while attempting to open the " -"wallet <b>%1</b>. Please fix your system configuration, then try again!</qt>" -msgstr "" - -#: backend/backendpersisthandler.cpp:616 -msgid "Retry" -msgstr "" - -#: backend/backendpersisthandler.cpp:618 -#, kde-format -msgid "" -"<qt>Error when attempting to decrypt the wallet <b>%1</b> using GPG. If " -"you're using a SmartCard, please ensure it's inserted then try again." -"<br><br>GPG error was <b>%2</b></qt>" -msgstr "" - -#: backend/backendpersisthandler.cpp:619 -msgid "kwalletd GPG backend" -msgstr "" - -#: backend/backendpersisthandler.cpp:663 -#, kde-format -msgid "" -"<qt>Error when attempting to open the wallet <b>%1</b>. The wallet was " -"encrypted using the GPG Key ID <b>%2</b> but this key was not found on your " -"system.</qt>" -msgstr "" - -#: backend/kwalletbackend.cc:256 -msgid "Already open." -msgstr "पहले ही खुला है." - -#: backend/kwalletbackend.cc:258 -msgid "Error opening file." -msgstr "फ़ाइल को खोलने में त्रुटि." - -#: backend/kwalletbackend.cc:260 -msgid "Not a wallet file." -msgstr "वॉलेट फ़ाइल नहीं है." - -#: backend/kwalletbackend.cc:262 -msgid "Unsupported file format revision." -msgstr "असमर्थित फ़ाइल फॉर्मेट रिवीज़न." - -#: backend/kwalletbackend.cc:264 -msgid "Unknown encryption scheme." -msgstr "अज्ञात एनक्रिप्शन योजना." - -#: backend/kwalletbackend.cc:266 -msgid "Corrupt file?" -msgstr "फ़ाइल खराब है?" - -#: backend/kwalletbackend.cc:268 -msgid "Error validating wallet integrity. Possibly corrupted." -msgstr "वॉलेट की सत्यता सत्यापित करने के दौरान त्रुटि. संभवतः खराब है." - -#: backend/kwalletbackend.cc:272 -msgid "Read error - possibly incorrect password." -msgstr "पढ़ने में त्रुटि- संभवत: गलत पासवर्ड." - -#: backend/kwalletbackend.cc:274 -msgid "Decryption error." -msgstr "डीक्रिप्शन त्रुटि." - -#: backend/kwalletbackend.cc:443 -#, kde-format -msgid "" -"Failed to sync wallet <b>%1</b> to disk. Error codes are:\n" -"RC <b>%2</b>\n" -"SF <b>%3</b>. Please file a BUG report using this information to bugs.kde.org" -msgstr "" - -#. i18n: ectx: property (text), widget (QPushButton, _allowOnce) -#: kbetterthankdialogbase.ui:50 -msgid "Allow &Once" -msgstr "एक बार स्वीकारें (&O)" - -#. i18n: ectx: property (text), widget (QPushButton, _allowAlways) -#: kbetterthankdialogbase.ui:60 -msgid "Allow &Always" -msgstr "हमेशा स्वीकारें (&A)" - -#. i18n: ectx: property (text), widget (QPushButton, _deny) -#: kbetterthankdialogbase.ui:67 -msgid "&Deny" -msgstr "नकारें (&D)" - -#. i18n: ectx: property (text), widget (QPushButton, _denyForever) -#: kbetterthankdialogbase.ui:74 -msgid "Deny &Forever" -msgstr "नकारें सर्वदा (&F)" - -#: knewwalletdialog.cpp:64 -#, fuzzy, kde-format -#| msgid "" -#| "<qt>KDE has requested to create a new wallet named '<b>%1</b>'. Please " -#| "choose a password for this wallet, or cancel to deny the application's " -#| "request.</qt>" -msgid "" -"<qt>KDE has requested to create a new wallet named '<b>%1</b>'. This is used " -"to store sensitive data in a secure fashion. Please choose the new wallet's " -"type below or click cancel to deny the application's request.</qt>" -msgstr "" -"<qt>केडीई ने '<b>%1</b>' नाम से एक नए वॉलेट बनाने के लिए निवेदन किया है. कृपया इस " -"वॉलेट के लिए पासवर्ड चुनें या अनुप्रयोग के निवेदन को ठुकराने के लिए रद्द करें.</qt>" - -#: knewwalletdialog.cpp:66 -#, fuzzy, kde-format -#| msgid "" -#| "<qt>The application '<b>%1</b>' has requested to create a new wallet " -#| "named '<b>%2</b>'. Please choose a password for this wallet, or cancel to " -#| "deny the application's request.</qt>" -msgid "" -"<qt>The application '<b>%1</b>' has requested to create a new wallet named " -"'<b>%2</b>'. This is used to store sensitive data in a secure fashion. " -"Please choose the new wallet's type below or click cancel to deny the " -"application's request.</qt>" -msgstr "" -"<qt>अनुप्रयोग '<b>%1</b>' ने '<b>%2</b>' नाम से एक नया वॉलेट के लिए निवेदन किया है. " -"कृपया इस वॉलेट के लिए पासवर्ड चुनें या अनुप्रयोग के निवेदन को नकारने के लिए रद्द करें.</qt>" - -#: knewwalletdialog.cpp:127 knewwalletdialog.cpp:133 kwalletwizard.cpp:160 -#: kwalletwizard.cpp:164 -msgid "" -"The QGpgME library failed to initialize for the OpenPGP protocol. Please " -"check your system's configuration then try again." -msgstr "" - -#: knewwalletdialog.cpp:153 -msgid "" -"Seems that your system has no keys suitable for encryption. Please set-up at " -"least an encryption key, then try again." -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, label) -#: knewwalletdialoggpg.ui:17 -msgid "Please select the signing key from the list below:" -msgstr "" - -#. i18n: ectx: property (text), widget (QTableWidget, listCertificates) -#: knewwalletdialoggpg.ui:52 -msgid "Name" -msgstr "" - -#. i18n: ectx: property (text), widget (QTableWidget, listCertificates) -#: knewwalletdialoggpg.ui:57 -msgid "E-Mail" -msgstr "" - -#. i18n: ectx: property (text), widget (QTableWidget, listCertificates) -#: knewwalletdialoggpg.ui:62 -msgid "Key-ID" -msgstr "" - -#. i18n: ectx: property (comment), widget (KTitleWidget, ktitlewidget) -#: knewwalletdialogintro.ui:17 kwalletwizardpageintro.ui:17 -msgid "The KDE Wallet System" -msgstr "केडीई बटुआ तंत्र" - -#. i18n: ectx: property (text), widget (QLabel, labelIntro) -#: knewwalletdialogintro.ui:30 -#, no-c-format, kde-format -msgid "" -"<html><head/><body><p>The application '<span style=\" font-weight:600;\">%1</" -"span>' has requested to open the KDE wallet. This is used to store sensitive " -"data in a secure fashion. Please choose the new wallet's type below or click " -"cancel to deny the application's request.</p></body></html>" -msgstr "" - -#. i18n: ectx: property (text), widget (QRadioButton, _radioBlowfish) -#. i18n: ectx: property (text), widget (QRadioButton, radioBlowfish) -#: knewwalletdialogintro.ui:66 kwalletwizardpagepasswordgpg.ui:68 -msgid "Classic, blowfish encrypted file" -msgstr "" - -#. i18n: ectx: property (text), widget (QRadioButton, _radioGpg) -#. i18n: ectx: property (text), widget (QRadioButton, radioGpg) -#: knewwalletdialogintro.ui:73 kwalletwizardpagepasswordgpg.ui:55 -msgid "Use GPG encryption, for better protection" -msgstr "" - -#: kwalletd.cpp:427 kwalletd.cpp:541 kwalletd.cpp:631 kwalletd.cpp:731 -#: kwalletd.cpp:834 kwalletd.cpp:853 kwalletd.cpp:862 kwalletd.cpp:867 -#: kwalletd.cpp:1384 main.cpp:47 main.cpp:53 main.cpp:55 -msgid "KDE Wallet Service" -msgstr "केडीई बटुआ सेवा" - -#: kwalletd.cpp:534 -#, kde-format -msgid "" -"<qt>KDE has requested to open the wallet '<b>%1</b>'. Please enter the " -"password for this wallet below.</qt>" -msgstr "" -"<qt>केडीई ने वॉलेट '<b>%1</b>' को खोलने के लिए निवेदन किया है. कृपया इस वॉलेट के लिए " -"पासवर्ड भरें.</qt>" - -#: kwalletd.cpp:536 -#, kde-format -msgid "" -"<qt>The application '<b>%1</b>' has requested to open the wallet '<b>%2</" -"b>'. Please enter the password for this wallet below.</qt>" -msgstr "" -"<qt>अनुप्रयोग '<b>%1</b>' ने वॉलेट '<b>%2</b>' को खोलने के लिए आवेदन किया है. इस " -"वॉलेट के लिए नीचे पासवर्ड भरें.</qt>" - -#: kwalletd.cpp:551 -msgctxt "Text of a button to ignore the open-wallet notification" -msgid "Ignore" -msgstr "नज़रअंदाज़ करें" - -#: kwalletd.cpp:553 -#, kde-format -msgid "<b>KDE</b> has requested to open a wallet (%1)." -msgstr "<b>केडीई</b> ने वॉलेट (%1) खोलने के लिए निवेदन किया है." - -#: kwalletd.cpp:556 -msgctxt "" -"Text of a button for switching to the (unnamed) application requesting a " -"password" -msgid "Switch there" -msgstr "स्विच करें" - -#: kwalletd.cpp:558 -#, kde-format -msgid "<b>%1</b> has requested to open a wallet (%2)." -msgstr "<b>%1</b> ने वॉलेट (%2) खोलने के लिए निवेदन किया है." - -#: kwalletd.cpp:561 -#, kde-format -msgctxt "" -"Text of a button for switching to the application requesting a password" -msgid "Switch to %1" -msgstr "%1 पर स्विच करें" - -#: kwalletd.cpp:576 kwalletd.cpp:641 -#, kde-format -msgid "" -"<qt>Error opening the wallet '<b>%1</b>'. Please try again.<br />(Error code " -"%2: %3)</qt>" -msgstr "" -"<qt>वॉलेट '<b>%1</b>' को खोलने में त्रुटि. कृपया फिर कोशिश करें.<br />(त्रुटि कोड %2: " -"%3)</qt>" - -#: kwalletd.cpp:620 -msgid "" -"KDE has requested to open the wallet. This is used to store sensitive data " -"in a secure fashion. Please enter a password to use with this wallet or " -"click cancel to deny the application's request." -msgstr "" - -#: kwalletd.cpp:622 -#, kde-format -msgid "" -"<qt>The application '<b>%1</b>' has requested to open the KDE wallet. This " -"is used to store sensitive data in a secure fashion. Please enter a password " -"to use with this wallet or click cancel to deny the application's request.</" -"qt>" -msgstr "" - -#: kwalletd.cpp:626 -#, kde-format -msgid "" -"<qt>KDE has requested to create a new wallet named '<b>%1</b>'. Please " -"choose a password for this wallet, or cancel to deny the application's " -"request.</qt>" -msgstr "" -"<qt>केडीई ने '<b>%1</b>' नाम से एक नए वॉलेट बनाने के लिए निवेदन किया है. कृपया इस " -"वॉलेट के लिए पासवर्ड चुनें या अनुप्रयोग के निवेदन को ठुकराने के लिए रद्द करें.</qt>" - -#: kwalletd.cpp:628 -#, kde-format -msgid "" -"<qt>The application '<b>%1</b>' has requested to create a new wallet named " -"'<b>%2</b>'. Please choose a password for this wallet, or cancel to deny the " -"application's request.</qt>" -msgstr "" -"<qt>अनुप्रयोग '<b>%1</b>' ने '<b>%2</b>' नाम से एक नया वॉलेट के लिए निवेदन किया है. " -"कृपया इस वॉलेट के लिए पासवर्ड चुनें या अनुप्रयोग के निवेदन को नकारने के लिए रद्द करें.</qt>" - -#: kwalletd.cpp:733 -#, kde-format -msgid "<qt>KDE has requested access to the open wallet '<b>%1</b>'.</qt>" -msgstr "<qt>केडीई ने वॉलेट '<b>%1</b>' को खोलने के लिए निवेदन किया है.</qt>" - -#: kwalletd.cpp:735 -#, kde-format -msgid "" -"<qt>The application '<b>%1</b>' has requested access to the open wallet '<b>" -"%2</b>'.</qt>" -msgstr "" -"<qt>अनुप्रयोग '<b>%1</b>' ने वॉलेट '<b>%2</b>' को खोलने के लिए निवेदन किया है.</qt>" - -#: kwalletd.cpp:834 -msgid "" -"Unable to open wallet. The wallet must be opened in order to change the " -"password." -msgstr "बटुआ खोलने में असफल. पासवर्ड बदलने के लिए बटुआ खोला जाना आवश्यक है." - -#: kwalletd.cpp:848 -#, kde-format -msgid "" -"<qt>The <b>%1</b> wallet is encrypted using GPG key <b>%2</b>. Please use " -"<b>GPG</b> tools (such as <b>kleopatra</b>) to change the passphrase " -"associated to that key.</qt>" -msgstr "" - -#: kwalletd.cpp:852 -#, kde-format -msgid "<qt>Please choose a new password for the wallet '<b>%1</b>'.</qt>" -msgstr "<qt>वॉलेट '<b>%1</b>' के लिए कृपया नया पासवर्ड चुनें.</qt>" - -#: kwalletd.cpp:862 -msgid "Error re-encrypting the wallet. Password was not changed." -msgstr "बटुआ को फिर से एनक्रिप्ट करने में त्रुटि. पासवर्ड बदला नहीं गया." - -#: kwalletd.cpp:867 -msgid "Error reopening the wallet. Data may be lost." -msgstr "बटुआ को फिर से खोलने में त्रुटि. डाटा गुम हो सकता है." - -#: kwalletd.cpp:1384 -msgid "" -"There have been repeated failed attempts to gain access to a wallet. An " -"application may be misbehaving." -msgstr "" -"वहाँ पर वॉलेट पर पहुँचने की बारंबार असफल कोशिश की गई. कोई अनुप्रयोग खराब व्यवहार कर " -"रहा होगा." - -#: kwalletwizard.cpp:52 -msgid "KWallet" -msgstr "KWallet" - -#: kwalletwizard.cpp:276 -msgid "<qt>Password is empty. <b>(WARNING: Insecure)</b></qt>" -msgstr "<qt>पासवर्ड रिक्त है. <b>(चेतावनी: असुरक्षित)</b></qt>" - -#: kwalletwizard.cpp:278 -msgid "Passwords match." -msgstr "पासवर्ड के जोड़ मिलते हैं." - -#: kwalletwizard.cpp:281 -msgid "Passwords do not match." -msgstr "कूटशब्द मेल नहीं खाता है." - -#. i18n: ectx: property (text), widget (QLabel, textLabel2_3) -#: kwalletwizardpageexplanation.ui:17 -msgid "" -"<html><head/><body><p>The KDE Wallet system stores your data in a <span " -"style=\" font-style:italic;\">wallet</span> file on your local hard disk. " -"The data is only written in the encrypted form of your choice - blowfish " -"algorithm with your password as the key or using a GPG encryption key. When " -"a wallet is opened, the wallet manager application will launch and display " -"an icon in the system tray. You can use this application to manage all of " -"your wallets. It even permits you to drag wallets and wallet contents, " -"allowing you to easily copy a wallet to a remote system.</p></body></html>" -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, label_3) -#: kwalletwizardpagegpgkey.ui:24 -msgid "" -"<html><head/><body><p>The GPG-based wallet use a GPG encryption key to " -"securely encrypt data on disk. The key must be available when decrypting is " -"needed or your wallet will not be accessible. For example, if you choose a " -"SmartCard-based encryption key, the GPG system will prompt you to enter it " -"and its associated PIN when attempting to open the wallet.</p></body></html>" -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, label) -#: kwalletwizardpagegpgkey.ui:39 -msgid "Select encryption GPG key:" -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, label_2) -#: kwalletwizardpagegpgkey.ui:78 -msgid "" -"Unable to locate at least one <b>encrypting GPG key</b>. KDE Wallet needs " -"such <b>encrypting key</b> to securely store passwords or other sensitive " -"data on disk. If you still want to setup a GPG-based wallet, then cancel " -"this wizard, set-up an <b>encrypting GPG key</b>, then retry this assistant. " -"Otherwise, you may still click back, then choose a classic, blowfish " -"encrypted file format on the previous page." -msgstr "" - -#. i18n: ectx: property (text), widget (QLabel, textLabel2) -#: kwalletwizardpageintro.ui:30 -msgid "" -"Welcome to KWallet, the KDE Wallet System. KWallet allows you to store your " -"passwords and other personal information on disk in an encrypted file, " -"preventing others from viewing the information. This wizard will tell you " -"about KWallet and help you configure it for the first time." -msgstr "" - -#. i18n: ectx: property (text), widget (QRadioButton, _basic) -#: kwalletwizardpageintro.ui:69 -msgid "&Basic setup (recommended)" -msgstr "मूल व्यवस्था (अनुशंसित) (&B)" - -#. i18n: ectx: property (text), widget (QRadioButton, _advanced) -#: kwalletwizardpageintro.ui:79 -msgid "&Advanced setup" -msgstr "विस्तृत व्यवस्था (&A)" - -#. i18n: ectx: property (text), widget (QLabel, textLabel1_3) -#: kwalletwizardpageoptions.ui:16 -msgid "" -"The KDE Wallet system allows you to control the level of security of your " -"personal data. Some of these settings do impact usability. While the " -"default settings are generally acceptable for most users, you may wish to " -"change some of them. You may further tune these settings from the KWallet " -"control module." -msgstr "" - -#. i18n: ectx: property (text), widget (QCheckBox, _closeIdle) -#: kwalletwizardpageoptions.ui:48 -msgid "Automatically close idle wallets" -msgstr "निष्क्रिय बटुआ स्वचलित बन्द करें" - -#. i18n: ectx: property (text), widget (QCheckBox, _networkWallet) -#: kwalletwizardpageoptions.ui:55 -msgid "Store network passwords and local passwords in separate wallet files" -msgstr "नेटवर्क पासवर्ड्स तथा स्थानीय पासवर्ड्स अलग बटुआ फ़ाइल में भंडारित करें" - -#. i18n: ectx: property (text), widget (QLabel, textLabel3) -#: kwalletwizardpagepassword.ui:16 -msgid "" -"Various applications may attempt to use the KDE wallet to store passwords or " -"other information such as web form data and cookies. If you would like " -"these applications to use the wallet, you must enable it now and choose a " -"password. The password you choose <i>cannot</i> be recovered if it is lost, " -"and will allow anyone who knows it to obtain all the information contained " -"in the wallet." -msgstr "" - -#. i18n: ectx: property (text), widget (QCheckBox, _useWallet) -#: kwalletwizardpagepassword.ui:29 kwalletwizardpagepasswordgpg.ui:30 -msgid "Yes, I wish to use the KDE wallet to store my personal information." -msgstr "" -"हाँ, मैं केडीई वॉलेट को मेरी निजी जानकारी भंडारित करने के लिए उपयोग करना चाहता हूँ." - -#. i18n: ectx: property (text), widget (QLabel, textLabel1_3) -#: kwalletwizardpagepassword.ui:88 kwalletwizardpagepasswordgpg.ui:106 -msgid "Enter a new password:" -msgstr "एक नया पासवर्ड भरें:" - -#. i18n: ectx: property (text), widget (QLabel, textLabel2_3) -#: kwalletwizardpagepassword.ui:104 kwalletwizardpagepasswordgpg.ui:122 -msgid "Verify password:" -msgstr "पासवर्ड सत्यापित करें:" - -#. i18n: ectx: property (text), widget (QLabel, textLabel3) -#: kwalletwizardpagepasswordgpg.ui:17 -msgid "" -"<html><head/><body><p>Various applications may attempt to use the KDE wallet " -"to store passwords or other information such as web form data and cookies. " -"If you would like these applications to use the wallet, you must enable it " -"now and choose method for its encryption.</p><p>GPG method is more secure, " -"but you must have configured at least one encrypting key on your system.</" -"p><p>If you choose the classic format, be warned that the password you " -"choose <span style=\" font-style:italic;\">cannot</span> be recovered if it " -"is lost, and will allow anyone who knows it to obtain all the information " -"contained in the wallet.</p></body></html>" -msgstr "" - -#. i18n: ectx: property (title), widget (QGroupBox, _groupBox) -#: kwalletwizardpagepasswordgpg.ui:46 -msgid "What kind of encryption do you wish?" -msgstr "" - -#: main.cpp:51 -#, fuzzy -#| msgid "KWallet" -msgid "kwalletd" -msgstr "KWallet" - -#: main.cpp:57 -msgid "(C) 2002-2013, The KDE Developers" -msgstr "" - -#: main.cpp:58 -msgid "Valentin Rusu" -msgstr "" - -#: main.cpp:58 -msgid "Maintainer, GPG backend support" -msgstr "" - -#: main.cpp:59 -msgid "Michael Leupold" -msgstr "Michael Leupold" - -#: main.cpp:59 -#, fuzzy -#| msgid "Former maintainer" -msgid "Former Maintainer" -msgstr "पूर्व मेंटेनर" - -#: main.cpp:60 -msgid "George Staikos" -msgstr "जॉर्ज स्टायकॉस" - -#: main.cpp:60 -msgid "Former maintainer" -msgstr "पूर्व मेंटेनर" - -#: main.cpp:61 -msgid "Thiago Maceira" -msgstr "Thiago Maceira" - -#: main.cpp:61 -msgid "D-Bus Interface" -msgstr "D-Bus Interface" - -#~ msgid "&Open" -#~ msgstr "खोलें (&O)" - -#~ msgid "C&reate" -#~ msgstr "बनाएँ (&r)" - -#, fuzzy -#~| msgid "(C) 2002-2008 George Staikos, Michael Leupold, Thiago Maceira" -#~ msgid "" -#~ "(C) 2002-2008 George Staikos, Michael Leupold, Thiago Maceira, Valentin " -#~ "Rusu" -#~ msgstr "(C) 2002-2008 George Staikos, Michael Leupold, Thiago Maceira" - -#~ msgid "Maintainer" -#~ msgstr "मेंटेनर" diff -Nru kde-l10n-hi-4.12.97/messages/frameworks/timezones4.po kde-l10n-hi-4.13.0/messages/frameworks/timezones4.po --- kde-l10n-hi-4.12.97/messages/frameworks/timezones4.po 2014-01-26 03:20:20.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/frameworks/timezones4.po 1970-01-01 00:00:00.000000000 +0000 @@ -1,3401 +0,0 @@ -# translation of timezones4.po to Hindi -# Copyright (C) 2003, 2004, 2007 Free Software Foundation, Inc. -# -# Sanjay Khatri <sk_ind at vsnl dot net>, 2003. -# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2004. -# Ravishankar Shrivastava <raviratlami@gmail.com>, 2004. -# G Karunakar <karunakar@indlinux.org>, 2007. -msgid "" -msgstr "" -"Project-Id-Version: timezones4\n" -"Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-01-24 18:50+0000\n" -"PO-Revision-Date: 2007-08-20 02:33+0530\n" -"Last-Translator: G Karunakar <karunakar@indlinux.org>\n" -"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" -"Language: hi\n" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" -"X-Generator: KBabel 1.11.4\n" -"Plural-Forms: nplurals=2; plural=(n!=1);\n" - -#: TIMEZONES:1 -msgid "Africa/Abidjan" -msgstr "अफ्रीका/अबीदियन" - -#: TIMEZONES:2 -msgid "Africa/Accra" -msgstr "अफ्रीका/एक्रा" - -#: TIMEZONES:3 -msgid "Africa/Addis_Ababa" -msgstr "अफ्रीका/अदिस_अबाबा" - -#: TIMEZONES:4 -msgid "Africa/Algiers" -msgstr "अफ्रीका/अलगियर्स" - -#: TIMEZONES:5 -#, fuzzy -#| msgid "Africa/Asmera" -msgid "Africa/Asmara" -msgstr "अफ्रीका/असमेरा" - -#: TIMEZONES:6 -msgid "Africa/Asmera" -msgstr "अफ्रीका/असमेरा" - -#: TIMEZONES:7 -msgid "Africa/Bamako" -msgstr "अफ्रीका/बमाको" - -#: TIMEZONES:8 -msgid "Africa/Bangui" -msgstr "अफ्रीका/बानगुइ" - -#: TIMEZONES:9 -msgid "Africa/Banjul" -msgstr "अफ्रीका/बैनजुल" - -#: TIMEZONES:10 -msgid "Africa/Bissau" -msgstr "अफ्रीका/बिसाउ" - -#: TIMEZONES:11 -msgid "Africa/Blantyre" -msgstr "अफ्रीका/ब्लांटायर" - -#: TIMEZONES:12 -msgid "Africa/Brazzaville" -msgstr "अफ्रीका/ब्राज़ावेल" - -#: TIMEZONES:13 -msgid "Africa/Bujumbura" -msgstr "अफ्रीका/बुजुंबुरा" - -#: TIMEZONES:14 -msgid "Africa/Cairo" -msgstr "अफ्रीका/कायरो" - -#: TIMEZONES:15 -msgid "Africa/Casablanca" -msgstr "अफ्रीका/कैसबलंका" - -#: TIMEZONES:16 -msgid "Africa/Ceuta" -msgstr "अफ्रीका/सेउटा" - -#. i18n: comment to the previous timezone -#: TIMEZONES:18 -msgid "Ceuta & Melilla" -msgstr "" - -#: TIMEZONES:19 -msgid "Africa/Conakry" -msgstr "अफ्रीका/कोनाक्री" - -#: TIMEZONES:20 -msgid "Africa/Dakar" -msgstr "अफ्रीका/डकर" - -#: TIMEZONES:21 -msgid "Africa/Dar_es_Salaam" -msgstr "अफ्रीका/डर_एस_सलाम" - -#: TIMEZONES:22 -msgid "Africa/Djibouti" -msgstr "अफ्रीका/जिबोउटी" - -#: TIMEZONES:23 -msgid "Africa/Douala" -msgstr "अफ्रीका/डॉउला" - -#: TIMEZONES:24 -msgid "Africa/El_Aaiun" -msgstr "अफ्रीका/अल_आएउन" - -#: TIMEZONES:25 -msgid "Africa/Freetown" -msgstr "अफ्रीका/फ्रीटाउन" - -#: TIMEZONES:26 -msgid "Africa/Gaborone" -msgstr "अफ्रीका/गबोरोन" - -#: TIMEZONES:27 -msgid "Africa/Harare" -msgstr "अफ्रीका/हरारे" - -#: TIMEZONES:28 -msgid "Africa/Johannesburg" -msgstr "अफ्रीका/जॉनेसबर्ग" - -#: TIMEZONES:29 -#, fuzzy -#| msgid "Africa/Ceuta" -msgid "Africa/Juba" -msgstr "अफ्रीका/सेउटा" - -#: TIMEZONES:30 -msgid "Africa/Kampala" -msgstr "अफ्रीका/कमपाला" - -#: TIMEZONES:31 -msgid "Africa/Khartoum" -msgstr "अफ्रीका/खार्टोउम" - -#: TIMEZONES:32 -msgid "Africa/Kigali" -msgstr "अफ्रीका/किगाली" - -#: TIMEZONES:33 -msgid "Africa/Kinshasa" -msgstr "अफ्रीका/किंसहासा" - -#. i18n: comment to the previous timezone -#: TIMEZONES:35 -msgid "west Dem. Rep. of Congo" -msgstr "" - -#: TIMEZONES:36 -msgid "Africa/Lagos" -msgstr "अफ्रीका/लागोस" - -#: TIMEZONES:37 -msgid "Africa/Libreville" -msgstr "अफ्रीका/लिब्रेवेल" - -#: TIMEZONES:38 -msgid "Africa/Lome" -msgstr "अफ्रीका/लोम" - -#: TIMEZONES:39 -msgid "Africa/Luanda" -msgstr "अफ्रिका/लुआंडा" - -#: TIMEZONES:40 -msgid "Africa/Lubumbashi" -msgstr "अफ्रीका/लुबुंबाशी" - -#. i18n: comment to the previous timezone -#: TIMEZONES:42 -msgid "east Dem. Rep. of Congo" -msgstr "" - -#: TIMEZONES:43 -msgid "Africa/Lusaka" -msgstr "अफ्रीका/लुसाका" - -#: TIMEZONES:44 -msgid "Africa/Malabo" -msgstr "अफ्रीका/मालाबो" - -#: TIMEZONES:45 -msgid "Africa/Maputo" -msgstr "अफ्रीका/मपुटो" - -#: TIMEZONES:46 -msgid "Africa/Maseru" -msgstr "अफ्रीका/मासेरु" - -#: TIMEZONES:47 -msgid "Africa/Mbabane" -msgstr "अफ्रीका/बाबने" - -#: TIMEZONES:48 -msgid "Africa/Mogadishu" -msgstr "अफ्रीका/मॉगाडिशु" - -#: TIMEZONES:49 -msgid "Africa/Monrovia" -msgstr "अफ्रीका/मॉनरोविया" - -#: TIMEZONES:50 -msgid "Africa/Nairobi" -msgstr "अफ्रीका/नारौबी" - -#: TIMEZONES:51 -msgid "Africa/Ndjamena" -msgstr "अफ्रीका/जमीना" - -#: TIMEZONES:52 -msgid "Africa/Niamey" -msgstr "अफ्रीका/नियमये" - -#: TIMEZONES:53 -msgid "Africa/Nouakchott" -msgstr "अफ्रीका/नाउआकोट" - -#: TIMEZONES:54 -msgid "Africa/Ouagadougou" -msgstr "अफ्रीका/ओयूगाडॉउगॉउ" - -#: TIMEZONES:55 -msgid "Africa/Porto-Novo" -msgstr "अफ्रीका/पॉर्टो_नोवो" - -#: TIMEZONES:56 -#, fuzzy -#| msgid "Africa/Ceuta" -msgid "Africa/Pretoria" -msgstr "अफ्रीका/सेउटा" - -#: TIMEZONES:57 -msgid "Africa/Sao_Tome" -msgstr "अफ्रीका/साओ_टोम" - -#: TIMEZONES:58 -msgid "Africa/Timbuktu" -msgstr "अफ्रीका/टिम्बुक्टू" - -#: TIMEZONES:59 -msgid "Africa/Tripoli" -msgstr "अफ्रीका/ट्रिपोली" - -#: TIMEZONES:60 -msgid "Africa/Tunis" -msgstr "अफ्रीका/तुनिस" - -#: TIMEZONES:61 -msgid "Africa/Windhoek" -msgstr "अफ्रीका/विंडहोक" - -#: TIMEZONES:62 -msgid "America/Adak" -msgstr "अमेरिका/अडाक" - -#. i18n: comment to the previous timezone -#: TIMEZONES:64 TIMEZONES:121 TIMEZONES:1068 -msgid "Aleutian Islands" -msgstr "" - -#: TIMEZONES:65 -msgid "America/Anchorage" -msgstr "अमेरिका/एंकोरेज" - -#. i18n: comment to the previous timezone -#: TIMEZONES:67 TIMEZONES:1065 -msgid "Alaska Time" -msgstr "" - -#: TIMEZONES:68 -msgid "America/Anguilla" -msgstr "अमेरिका/एंगुला" - -#: TIMEZONES:69 -msgid "America/Antigua" -msgstr "अमेरिका/एंटिगुआ" - -#: TIMEZONES:70 -msgid "America/Araguaina" -msgstr "अमेरिका/अरगुयेना" - -#. i18n: comment to the previous timezone -#: TIMEZONES:72 -msgid "Tocantins" -msgstr "" - -#: TIMEZONES:73 -msgid "America/Argentina/Buenos_Aires" -msgstr "अमेरिका/अरजेटीना/बुएनॉस_एरिस" - -#. i18n: comment to the previous timezone -#: TIMEZONES:75 TIMEZONES:145 -msgid "Buenos Aires (BA, CF)" -msgstr "" - -#: TIMEZONES:76 -msgid "America/Argentina/Catamarca" -msgstr "अमेरिका/अरजेटीना/कैटामारका" - -#. i18n: comment to the previous timezone -#: TIMEZONES:78 TIMEZONES:81 TIMEZONES:161 -msgid "Catamarca (CT), Chubut (CH)" -msgstr "" - -#: TIMEZONES:79 -msgid "America/Argentina/ComodRivadavia" -msgstr "अमेरिका/अरजेटीना/कोमोडरिवाडाविया" - -#: TIMEZONES:82 -msgid "America/Argentina/Cordoba" -msgstr "अमेरिका/अरजेटीना/कॉर्डोबा" - -#. i18n: comment to the previous timezone -#: TIMEZONES:84 TIMEZONES:177 TIMEZONES:419 -msgid "most locations (CB, CC, CN, ER, FM, LP, MN, NQ, RN, SA, SE, SF)" -msgstr "" - -#. i18n: comment to the previous timezone -#: TIMEZONES:86 -msgid "most locations (CB, CC, CN, ER, FM, MN, SE, SF)" -msgstr "" - -#: TIMEZONES:87 -msgid "America/Argentina/Jujuy" -msgstr "अमेरिका/अरजेटीना/जुजुई" - -#. i18n: comment to the previous timezone -#: TIMEZONES:89 TIMEZONES:285 -msgid "Jujuy (JY)" -msgstr "" - -#: TIMEZONES:90 -msgid "America/Argentina/La_Rioja" -msgstr "अमेरिका/अरजेटीना/ला_रियोहा" - -#. i18n: comment to the previous timezone -#: TIMEZONES:92 -msgid "La Rioja (LR)" -msgstr "" - -#: TIMEZONES:93 -msgid "America/Argentina/Mendoza" -msgstr "अमेरिका/अरजेटीना/मेंडोज़ा" - -#. i18n: comment to the previous timezone -#: TIMEZONES:95 TIMEZONES:325 -msgid "Mendoza (MZ)" -msgstr "" - -#: TIMEZONES:96 -msgid "America/Argentina/Rio_Gallegos" -msgstr "अमेरिका/अरजेटीना/रियो_गेल्लेगोस" - -#. i18n: comment to the previous timezone -#: TIMEZONES:98 -msgid "Santa Cruz (SC)" -msgstr "" - -#: TIMEZONES:99 -#, fuzzy -#| msgid "America/Argentina/San_Juan" -msgid "America/Argentina/Salta" -msgstr "अमेरिका/अरजेटीना/सां_जुआँ" - -#. i18n: comment to the previous timezone -#: TIMEZONES:101 -msgid "(SA, LP, NQ, RN)" -msgstr "" - -#: TIMEZONES:102 -msgid "America/Argentina/San_Juan" -msgstr "अमेरिका/अरजेटीना/सां_जुआँ" - -#. i18n: comment to the previous timezone -#: TIMEZONES:104 -msgid "San Juan (SJ)" -msgstr "" - -#: TIMEZONES:105 -#, fuzzy -#| msgid "America/Argentina/San_Juan" -msgid "America/Argentina/San_Luis" -msgstr "अमेरिका/अरजेटीना/सां_जुआँ" - -#. i18n: comment to the previous timezone -#: TIMEZONES:107 -msgid "San Luis (SL)" -msgstr "" - -#: TIMEZONES:108 -msgid "America/Argentina/Tucuman" -msgstr "अमेरिका/अरजेटीना/टुकुमन" - -#. i18n: comment to the previous timezone -#: TIMEZONES:110 -msgid "Tucuman (TM)" -msgstr "" - -#: TIMEZONES:111 -msgid "America/Argentina/Ushuaia" -msgstr "अमेरिका/अरजेटीना/युशुइया" - -#. i18n: comment to the previous timezone -#: TIMEZONES:113 -msgid "Tierra del Fuego (TF)" -msgstr "" - -#: TIMEZONES:114 -msgid "America/Aruba" -msgstr "अमेरिका/अरुबा" - -#: TIMEZONES:115 -msgid "America/Asuncion" -msgstr "अमेरिका/असुनसन" - -#: TIMEZONES:116 -#, fuzzy -#| msgid "America/Antigua" -msgid "America/Atikokan" -msgstr "अमेरिका/एंटिगुआ" - -#. i18n: comment to the previous timezone -#: TIMEZONES:118 TIMEZONES:174 -msgid "Eastern Standard Time - Atikokan, Ontario and Southampton I, Nunavut" -msgstr "" - -#: TIMEZONES:119 -#, fuzzy -#| msgid "America/Antigua" -msgid "America/Atka" -msgstr "अमेरिका/एंटिगुआ" - -#: TIMEZONES:122 -msgid "America/Bahia" -msgstr "अमेरिका/बाहिया" - -#. i18n: comment to the previous timezone -#: TIMEZONES:124 -msgid "Bahia" -msgstr "" - -#: TIMEZONES:125 -#, fuzzy -#| msgid "America/Bahia" -msgid "America/Bahia_Banderas" -msgstr "अमेरिका/बाहिया" - -#. i18n: comment to the previous timezone -#: TIMEZONES:127 -msgid "Mexican Central Time - Bahia de Banderas" -msgstr "" - -#: TIMEZONES:128 -msgid "America/Barbados" -msgstr "अमेरिका/बारबेडोस" - -#: TIMEZONES:129 -msgid "America/Belem" -msgstr "अमेरिका/बेलेम" - -#. i18n: comment to the previous timezone -#: TIMEZONES:131 -msgid "Amapa, E Para" -msgstr "" - -#: TIMEZONES:132 -msgid "America/Belize" -msgstr "अमेरिका/बेलाइज" - -#: TIMEZONES:133 -#, fuzzy -#| msgid "America/Cancun" -msgid "America/Blanc-Sablon" -msgstr "अमेरिका/कैनकुन" - -#. i18n: comment to the previous timezone -#: TIMEZONES:135 -msgid "Atlantic Standard Time - Quebec - Lower North Shore" -msgstr "" - -#: TIMEZONES:136 -msgid "America/Boa_Vista" -msgstr "अमेरिका/बोआ_विस्टा" - -#. i18n: comment to the previous timezone -#: TIMEZONES:138 -msgid "Roraima" -msgstr "" - -#: TIMEZONES:139 -msgid "America/Bogota" -msgstr "अमेरिका/बोगोटा" - -#: TIMEZONES:140 -msgid "America/Boise" -msgstr "अमेरिका/बोइज" - -#. i18n: comment to the previous timezone -#: TIMEZONES:142 -msgid "Mountain Time - south Idaho & east Oregon" -msgstr "" - -#: TIMEZONES:143 -msgid "America/Buenos_Aires" -msgstr "अमेरिका/बुएनॉस_एरिस" - -#: TIMEZONES:146 -#, fuzzy -#| msgid "America/Cayman" -msgid "America/Calgary" -msgstr "अमेरिका/केमान" - -#. i18n: comment to the previous timezone -#: TIMEZONES:148 TIMEZONES:204 TIMEZONES:824 -msgid "Mountain Time - Alberta, east British Columbia & west Saskatchewan" -msgstr "" - -#: TIMEZONES:149 -msgid "America/Cambridge_Bay" -msgstr "अमेरिका/कैमब्रिज_बे" - -#. i18n: comment to the previous timezone -#: TIMEZONES:151 -msgid "Mountain Time - west Nunavut" -msgstr "" - -#: TIMEZONES:152 -msgid "America/Campo_Grande" -msgstr "अमेरिका/केम्पो_ग्रान्दे" - -#. i18n: comment to the previous timezone -#: TIMEZONES:154 -msgid "Mato Grosso do Sul" -msgstr "" - -#: TIMEZONES:155 -msgid "America/Cancun" -msgstr "अमेरिका/कैनकुन" - -#. i18n: comment to the previous timezone -#: TIMEZONES:157 -msgid "Central Time - Quintana Roo" -msgstr "" - -#: TIMEZONES:158 -msgid "America/Caracas" -msgstr "अमेरिका/कराकस" - -#: TIMEZONES:159 -msgid "America/Catamarca" -msgstr "अमेरिका/कैटामारका" - -#: TIMEZONES:162 -msgid "America/Cayenne" -msgstr "अमेरिका/सायेने" - -#: TIMEZONES:163 -msgid "America/Cayman" -msgstr "अमेरिका/केमान" - -#: TIMEZONES:164 -msgid "America/Chicago" -msgstr "अमेरिका/शिकागो" - -#. i18n: comment to the previous timezone -#: TIMEZONES:166 TIMEZONES:1074 -msgid "Central Time" -msgstr "" - -#: TIMEZONES:167 -msgid "America/Chihuahua" -msgstr "अमेरिका/चिहुआहुआ" - -#. i18n: comment to the previous timezone -#: TIMEZONES:169 -msgid "Mountain Time - Chihuahua" -msgstr "" - -#. i18n: comment to the previous timezone -#: TIMEZONES:171 -msgid "Mexican Mountain Time - Chihuahua away from US border" -msgstr "" - -#: TIMEZONES:172 -#, fuzzy -#| msgid "America/Curacao" -msgid "America/Coral_Harbour" -msgstr "अमेरिका/कुराकाओ" - -#: TIMEZONES:175 -msgid "America/Cordoba" -msgstr "अमेरिका/कॉर्डोबा" - -#: TIMEZONES:178 -msgid "America/Costa_Rica" -msgstr "अमेरिका/कोस्टा_रिका" - -#: TIMEZONES:179 -#, fuzzy -#| msgid "Africa/Freetown" -msgid "America/Creston" -msgstr "अफ्रीका/फ्रीटाउन" - -#. i18n: comment to the previous timezone -#: TIMEZONES:181 -msgid "Mountain Standard Time - Creston, British Columbia" -msgstr "" - -#: TIMEZONES:182 -msgid "America/Cuiaba" -msgstr "अमेरिका/कुएबा" - -#. i18n: comment to the previous timezone -#: TIMEZONES:184 -msgid "Mato Grosso" -msgstr "" - -#: TIMEZONES:185 -msgid "America/Curacao" -msgstr "अमेरिका/कुराकाओ" - -#: TIMEZONES:186 -msgid "America/Danmarkshavn" -msgstr "अमेरिका/डेनमार्कशावन" - -#. i18n: comment to the previous timezone -#: TIMEZONES:188 -msgid "east coast, north of Scoresbysund" -msgstr "" - -#: TIMEZONES:189 -msgid "America/Dawson" -msgstr "अमेरिका/डॉसन" - -#. i18n: comment to the previous timezone -#: TIMEZONES:191 -msgid "Pacific Time - north Yukon" -msgstr "" - -#: TIMEZONES:192 -msgid "America/Dawson_Creek" -msgstr "अमेरिका/डॉसन_क्रिक" - -#. i18n: comment to the previous timezone -#: TIMEZONES:194 -msgid "" -"Mountain Standard Time - Dawson Creek & Fort Saint John, British Columbia" -msgstr "" - -#: TIMEZONES:195 -msgid "America/Denver" -msgstr "अमेरिका/डेनवर" - -#. i18n: comment to the previous timezone -#: TIMEZONES:197 TIMEZONES:965 TIMEZONES:1092 -msgid "Mountain Time" -msgstr "" - -#: TIMEZONES:198 -msgid "America/Detroit" -msgstr "अमेरिका/डैट्रिरॉइट" - -#. i18n: comment to the previous timezone -#: TIMEZONES:200 TIMEZONES:1089 -msgid "Eastern Time - Michigan - most locations" -msgstr "" - -#: TIMEZONES:201 -msgid "America/Dominica" -msgstr "अमेरिका/डोमिनिका" - -#: TIMEZONES:202 -msgid "America/Edmonton" -msgstr "अमेरिका/इडमॉनटॉन" - -#: TIMEZONES:205 -msgid "America/Eirunepe" -msgstr "अमेरिका/एयरुनपे" - -#. i18n: comment to the previous timezone -#: TIMEZONES:207 -msgid "W Amazonas" -msgstr "" - -#: TIMEZONES:208 -msgid "America/El_Salvador" -msgstr "अमेरिका/एल_सलवाडोर" - -#: TIMEZONES:209 -#, fuzzy -#| msgid "America/Grenada" -msgid "America/Ensenada" -msgstr "अमेरिका/ग्रेनडा" - -#. i18n: comment to the previous timezone -#: TIMEZONES:211 TIMEZONES:303 TIMEZONES:465 TIMEZONES:950 TIMEZONES:1095 -#, fuzzy -#| msgid "Pacific/Niue" -msgid "Pacific Time" -msgstr "प्रशांत/निउ" - -#: TIMEZONES:212 -#, fuzzy -#| msgid "America/Fortaleza" -msgid "America/Fort_Wayne" -msgstr "अमेरिका/फॉर्टलेज़ा" - -#. i18n: comment to the previous timezone -#: TIMEZONES:214 TIMEZONES:247 TIMEZONES:275 TIMEZONES:1077 -msgid "Eastern Time - Indiana - most locations" -msgstr "" - -#: TIMEZONES:215 -msgid "America/Fortaleza" -msgstr "अमेरिका/फॉर्टलेज़ा" - -#. i18n: comment to the previous timezone -#: TIMEZONES:217 -msgid "NE Brazil (MA, PI, CE, RN, PB)" -msgstr "" - -#: TIMEZONES:218 -#, fuzzy -#| msgid "Africa/Freetown" -msgid "America/Fredericton" -msgstr "अफ्रीका/फ्रीटाउन" - -#. i18n: comment to the previous timezone -#: TIMEZONES:220 TIMEZONES:240 TIMEZONES:812 -msgid "Atlantic Time - Nova Scotia (most places), PEI" -msgstr "" - -#: TIMEZONES:221 -msgid "America/Glace_Bay" -msgstr "अमेरिका/ग्लेस_बे" - -#. i18n: comment to the previous timezone -#: TIMEZONES:223 -msgid "Atlantic Time - Nova Scotia - places that did not observe DST 1966-1971" -msgstr "" - -#: TIMEZONES:224 -msgid "America/Godthab" -msgstr "अमेरिका/गॉडथब" - -#. i18n: comment to the previous timezone -#: TIMEZONES:226 TIMEZONES:428 TIMEZONES:527 TIMEZONES:691 TIMEZONES:694 -#: TIMEZONES:839 TIMEZONES:870 TIMEZONES:959 TIMEZONES:972 TIMEZONES:1014 -msgid "most locations" -msgstr "" - -#: TIMEZONES:227 -msgid "America/Goose_Bay" -msgstr "अमेरिका/गूज_बे" - -#. i18n: comment to the previous timezone -#: TIMEZONES:229 -msgid "Atlantic Time - Labrador - most locations" -msgstr "" - -#: TIMEZONES:230 -msgid "America/Grand_Turk" -msgstr "अमेरिका/ग्रैंड_तुर्क" - -#: TIMEZONES:231 -msgid "America/Grenada" -msgstr "अमेरिका/ग्रेनडा" - -#: TIMEZONES:232 -msgid "America/Guadeloupe" -msgstr "अमेरिका/गुआडेलोउप" - -#: TIMEZONES:233 -msgid "America/Guatemala" -msgstr "अमेरिका/गुआटेमाला" - -#: TIMEZONES:234 -msgid "America/Guayaquil" -msgstr "अमेरिका/गुआयाक़्युल" - -#. i18n: comment to the previous timezone -#: TIMEZONES:236 TIMEZONES:873 TIMEZONES:879 TIMEZONES:1058 -msgid "mainland" -msgstr "" - -#: TIMEZONES:237 -msgid "America/Guyana" -msgstr "अमेरिका/गुयाना" - -#: TIMEZONES:238 -msgid "America/Halifax" -msgstr "अमेरिका/हैलीफ़ैक्स" - -#: TIMEZONES:241 -msgid "America/Havana" -msgstr "अमेरिका/हवाना" - -#: TIMEZONES:242 -msgid "America/Hermosillo" -msgstr "अमेरिका/हरमॉसिलो" - -#. i18n: comment to the previous timezone -#: TIMEZONES:244 -msgid "Mountain Standard Time - Sonora" -msgstr "" - -#: TIMEZONES:245 -#, fuzzy -#| msgid "America/Indianapolis" -msgid "America/Indiana/Indianapolis" -msgstr "अमेरिका/इंडियापॉलिस" - -#: TIMEZONES:248 -msgid "America/Indiana/Knox" -msgstr "अमेरिका/इंडियाना/नॉक्स" - -#. i18n: comment to the previous timezone -#: TIMEZONES:250 TIMEZONES:297 TIMEZONES:1086 -msgid "Eastern Time - Indiana - Starke County" -msgstr "" - -#. i18n: comment to the previous timezone -#: TIMEZONES:252 -msgid "Central Time - Indiana - Starke County" -msgstr "" - -#: TIMEZONES:253 -msgid "America/Indiana/Marengo" -msgstr "अमेरिका/इंडियाना/मारेंगो" - -#. i18n: comment to the previous timezone -#: TIMEZONES:255 -msgid "Eastern Time - Indiana - Crawford County" -msgstr "" - -#: TIMEZONES:256 -#, fuzzy -#| msgid "America/Indiana/Marengo" -msgid "America/Indiana/Petersburg" -msgstr "अमेरिका/इंडियाना/मारेंगो" - -#. i18n: comment to the previous timezone -#: TIMEZONES:258 -msgid "Central Time - Indiana - Pike County" -msgstr "" - -#. i18n: comment to the previous timezone -#: TIMEZONES:260 -msgid "Eastern Time - Indiana - Pike County" -msgstr "" - -#: TIMEZONES:261 -#, fuzzy -#| msgid "America/Indiana/Vevay" -msgid "America/Indiana/Tell_City" -msgstr "अमेरिका/इंडियाना/वेवेय" - -#. i18n: comment to the previous timezone -#: TIMEZONES:263 -msgid "Central Time - Indiana - Perry County" -msgstr "" - -#: TIMEZONES:264 -msgid "America/Indiana/Vevay" -msgstr "अमेरिका/इंडियाना/वेवेय" - -#. i18n: comment to the previous timezone -#: TIMEZONES:266 -msgid "Eastern Time - Indiana - Switzerland County" -msgstr "" - -#: TIMEZONES:267 -#, fuzzy -#| msgid "America/Indiana/Vevay" -msgid "America/Indiana/Vincennes" -msgstr "अमेरिका/इंडियाना/वेवेय" - -#. i18n: comment to the previous timezone -#: TIMEZONES:269 -msgid "Eastern Time - Indiana - Daviess, Dubois, Knox & Martin Counties" -msgstr "" - -#: TIMEZONES:270 -#, fuzzy -#| msgid "America/Indiana/Knox" -msgid "America/Indiana/Winamac" -msgstr "अमेरिका/इंडियाना/नॉक्स" - -#. i18n: comment to the previous timezone -#: TIMEZONES:272 -msgid "Eastern Time - Indiana - Pulaski County" -msgstr "" - -#: TIMEZONES:273 -msgid "America/Indianapolis" -msgstr "अमेरिका/इंडियापॉलिस" - -#: TIMEZONES:276 -msgid "America/Inuvik" -msgstr "अमेरिका/इनुविक" - -#. i18n: comment to the previous timezone -#: TIMEZONES:278 -msgid "Mountain Time - west Northwest Territories" -msgstr "" - -#: TIMEZONES:279 -msgid "America/Iqaluit" -msgstr "अमेरिका/इक़्लुइट" - -#. i18n: comment to the previous timezone -#: TIMEZONES:281 -msgid "Eastern Time - east Nunavut - most locations" -msgstr "" - -#: TIMEZONES:282 -msgid "America/Jamaica" -msgstr "अमेरिका/जैमाएका" - -#: TIMEZONES:283 -msgid "America/Jujuy" -msgstr "अमेरिका/जुजुई" - -#: TIMEZONES:286 -msgid "America/Juneau" -msgstr "अमेरिका/जुनेआयू" - -#. i18n: comment to the previous timezone -#: TIMEZONES:288 -msgid "Alaska Time - Alaska panhandle" -msgstr "" - -#: TIMEZONES:289 -#, fuzzy -#| msgid "America/Louisville" -msgid "America/Kentucky/Louisville" -msgstr "अमेरिका/लुइसवेल" - -#. i18n: comment to the previous timezone -#: TIMEZONES:291 TIMEZONES:306 -#, fuzzy -#| msgid "America/Louisville" -msgid "Eastern Time - Kentucky - Louisville area" -msgstr "अमेरिका/लुइसवेल" - -#: TIMEZONES:292 -msgid "America/Kentucky/Monticello" -msgstr "अमेरिका/कैंटकी/मॉंटिसेलो" - -#. i18n: comment to the previous timezone -#: TIMEZONES:294 -msgid "Eastern Time - Kentucky - Wayne County" -msgstr "" - -#: TIMEZONES:295 -#, fuzzy -#| msgid "America/Indiana/Knox" -msgid "America/Knox_IN" -msgstr "अमेरिका/इंडियाना/नॉक्स" - -#: TIMEZONES:298 -#, fuzzy -#| msgid "America/Grenada" -msgid "America/Kralendijk" -msgstr "अमेरिका/ग्रेनडा" - -#: TIMEZONES:299 -msgid "America/La_Paz" -msgstr "अमेरिका/ला_पाज" - -#: TIMEZONES:300 -msgid "America/Lima" -msgstr "अमेरिका/लिमा" - -#: TIMEZONES:301 -msgid "America/Los_Angeles" -msgstr "अमेरिका/लॉस_एंजेलिस" - -#: TIMEZONES:304 -msgid "America/Louisville" -msgstr "अमेरिका/लुइसवेल" - -#: TIMEZONES:307 -#, fuzzy -#| msgid "America/Port-au-Prince" -msgid "America/Lower_Princes" -msgstr "अमेरिका/पॉर्ट_ऑ_प्रिंस" - -#: TIMEZONES:308 -msgid "America/Maceio" -msgstr "अमेरिका/मैसिओ" - -#. i18n: comment to the previous timezone -#: TIMEZONES:310 -msgid "Alagoas, Sergipe" -msgstr "" - -#: TIMEZONES:311 -msgid "America/Managua" -msgstr "अमेरिका/मानागुआ" - -#: TIMEZONES:312 -msgid "America/Manaus" -msgstr "अमेरिका/मनौअस" - -#. i18n: comment to the previous timezone -#: TIMEZONES:314 TIMEZONES:809 -msgid "E Amazonas" -msgstr "" - -#: TIMEZONES:315 -#, fuzzy -#| msgid "America/Maceio" -msgid "America/Marigot" -msgstr "अमेरिका/मैसिओ" - -#: TIMEZONES:316 -msgid "America/Martinique" -msgstr "अमेरिका/मार्टिनिक" - -#: TIMEZONES:317 -#, fuzzy -#| msgid "America/Manaus" -msgid "America/Matamoros" -msgstr "अमेरिका/मनौअस" - -#. i18n: comment to the previous timezone -#: TIMEZONES:319 -msgid "" -"US Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas near US border" -msgstr "" - -#: TIMEZONES:320 -msgid "America/Mazatlan" -msgstr "अमेरिका/मजाटलान" - -#. i18n: comment to the previous timezone -#: TIMEZONES:322 TIMEZONES:953 -msgid "Mountain Time - S Baja, Nayarit, Sinaloa" -msgstr "" - -#: TIMEZONES:323 -msgid "America/Mendoza" -msgstr "अमेरिका/मेंडोज़ा" - -#: TIMEZONES:326 -msgid "America/Menominee" -msgstr "अमेरिका/मेनोमिनी" - -#. i18n: comment to the previous timezone -#: TIMEZONES:328 -msgid "Central Time - Michigan - Dickinson, Gogebic, Iron & Menominee Counties" -msgstr "" - -#: TIMEZONES:329 -msgid "America/Merida" -msgstr "अमेरिका/मरिदा" - -#. i18n: comment to the previous timezone -#: TIMEZONES:331 -msgid "Central Time - Campeche, Yucatan" -msgstr "" - -#: TIMEZONES:332 -#, fuzzy -#| msgid "America/Mazatlan" -msgid "America/Metlakatla" -msgstr "अमेरिका/मजाटलान" - -#. i18n: comment to the previous timezone -#: TIMEZONES:334 -msgid "Metlakatla Time - Annette Island" -msgstr "" - -#: TIMEZONES:335 -msgid "America/Mexico_City" -msgstr "अमेरिका/मैक्सिको_शहर" - -#. i18n: comment to the previous timezone -#: TIMEZONES:337 TIMEZONES:956 -msgid "Central Time - most locations" -msgstr "" - -#: TIMEZONES:338 -msgid "America/Miquelon" -msgstr "अमेरिका/मिक्यूलॉन" - -#: TIMEZONES:339 -#, fuzzy -#| msgid "America/Edmonton" -msgid "America/Moncton" -msgstr "अमेरिका/इडमॉनटॉन" - -#. i18n: comment to the previous timezone -#: TIMEZONES:341 -msgid "Atlantic Time - New Brunswick" -msgstr "" - -#: TIMEZONES:342 -msgid "America/Monterrey" -msgstr "अमेरिका/मॉन्टेरेय" - -#. i18n: comment to the previous timezone -#: TIMEZONES:344 -msgid "Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas" -msgstr "" - -#. i18n: comment to the previous timezone -#: TIMEZONES:346 -msgid "" -"Mexican Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas away from " -"US border" -msgstr "" - -#: TIMEZONES:347 -msgid "America/Montevideo" -msgstr "अमेरिका/मोंटेविडिओ" - -#: TIMEZONES:348 -msgid "America/Montreal" -msgstr "अमेरिका/मॉंटरियल" - -#. i18n: comment to the previous timezone -#: TIMEZONES:350 TIMEZONES:379 -msgid "Eastern Time - Quebec - most locations" -msgstr "" - -#: TIMEZONES:351 -msgid "America/Montserrat" -msgstr "अमेरिका/मॉन्टसेरट" - -#: TIMEZONES:352 -msgid "America/Nassau" -msgstr "अमेरिका/नासाउ" - -#: TIMEZONES:353 -msgid "America/New_York" -msgstr "अमेरिका/न्यूयॉर्क" - -#. i18n: comment to the previous timezone -#: TIMEZONES:355 TIMEZONES:1080 -msgid "Eastern Time" -msgstr "" - -#: TIMEZONES:356 -msgid "America/Nipigon" -msgstr "अमेरिका/निपिगन" - -#. i18n: comment to the previous timezone -#: TIMEZONES:358 -msgid "" -"Eastern Time - Ontario & Quebec - places that did not observe DST 1967-1973" -msgstr "" - -#: TIMEZONES:359 -msgid "America/Nome" -msgstr "अमेरिका/नोम" - -#. i18n: comment to the previous timezone -#: TIMEZONES:361 -msgid "Alaska Time - west Alaska" -msgstr "" - -#: TIMEZONES:362 -msgid "America/Noronha" -msgstr "अमेरिका/नॉरॉनहा" - -#. i18n: comment to the previous timezone -#: TIMEZONES:364 TIMEZONES:803 -#, fuzzy -#| msgid "Atlantic/Canary" -msgid "Atlantic islands" -msgstr "अटलांटिक/कैनरी" - -#: TIMEZONES:365 -#, fuzzy -#| msgid "America/North_Dakota/Center" -msgid "America/North_Dakota/Beulah" -msgstr "अमेरिका/नॉर्थ_डकोटा/सेंटर" - -#. i18n: comment to the previous timezone -#: TIMEZONES:367 -msgid "Central Time - North Dakota - Mercer County" -msgstr "" - -#: TIMEZONES:368 -msgid "America/North_Dakota/Center" -msgstr "अमेरिका/नॉर्थ_डकोटा/सेंटर" - -#. i18n: comment to the previous timezone -#: TIMEZONES:370 -msgid "Central Time - North Dakota - Oliver County" -msgstr "" - -#: TIMEZONES:371 -#, fuzzy -#| msgid "America/North_Dakota/Center" -msgid "America/North_Dakota/New_Salem" -msgstr "अमेरिका/नॉर्थ_डकोटा/सेंटर" - -#. i18n: comment to the previous timezone -#: TIMEZONES:373 -msgid "Central Time - North Dakota - Morton County (except Mandan area)" -msgstr "" - -#: TIMEZONES:374 -#, fuzzy -#| msgid "America/Managua" -msgid "America/Ojinaga" -msgstr "अमेरिका/मानागुआ" - -#. i18n: comment to the previous timezone -#: TIMEZONES:376 -msgid "US Mountain Time - Chihuahua near US border" -msgstr "" - -#: TIMEZONES:377 -#, fuzzy -#| msgid "America/Maceio" -msgid "America/Ontario" -msgstr "अमेरिका/मैसिओ" - -#: TIMEZONES:380 -msgid "America/Panama" -msgstr "अमेरिका/पनामा" - -#: TIMEZONES:381 -msgid "America/Pangnirtung" -msgstr "अमेरिका/पांगनिर्टंग" - -#. i18n: comment to the previous timezone -#: TIMEZONES:383 -msgid "Eastern Time - Pangnirtung, Nunavut" -msgstr "" - -#: TIMEZONES:384 -msgid "America/Paramaribo" -msgstr "अमेरिका/पैरामारिबो" - -#: TIMEZONES:385 -msgid "America/Phoenix" -msgstr "अमेरिका/फीनिक्स" - -#. i18n: comment to the previous timezone -#: TIMEZONES:387 TIMEZONES:1071 -msgid "Mountain Standard Time - Arizona" -msgstr "" - -#: TIMEZONES:388 -msgid "America/Port-au-Prince" -msgstr "अमेरिका/पॉर्ट_ऑ_प्रिंस" - -#: TIMEZONES:389 -msgid "America/Port_of_Spain" -msgstr "अमेरिका/पॉर्ट_ऑफ_स्पेन" - -#: TIMEZONES:390 -#, fuzzy -#| msgid "America/Porto_Velho" -msgid "America/Porto_Acre" -msgstr "अमेरिका/पॉर्टो_वेलहो" - -#. i18n: comment to the previous timezone -#: TIMEZONES:392 TIMEZONES:416 TIMEZONES:800 -msgid "Acre" -msgstr "" - -#: TIMEZONES:393 -msgid "America/Porto_Velho" -msgstr "अमेरिका/पॉर्टो_वेलहो" - -#. i18n: comment to the previous timezone -#: TIMEZONES:395 -msgid "Rondonia" -msgstr "" - -#: TIMEZONES:396 -msgid "America/Puerto_Rico" -msgstr "अमेरिका/पुएर्टो_रिको" - -#: TIMEZONES:397 -msgid "America/Rainy_River" -msgstr "अमेरिका/रेनी_रिवर" - -#. i18n: comment to the previous timezone -#: TIMEZONES:399 -msgid "Central Time - Rainy River & Fort Frances, Ontario" -msgstr "" - -#: TIMEZONES:400 -msgid "America/Rankin_Inlet" -msgstr "अमेरिका/रेंकिन_इंलेट" - -#. i18n: comment to the previous timezone -#: TIMEZONES:402 -msgid "Central Time - central Nunavut" -msgstr "" - -#: TIMEZONES:403 -msgid "America/Recife" -msgstr "अमेरिका/रेसाइफ" - -#. i18n: comment to the previous timezone -#: TIMEZONES:405 -msgid "Pernambuco" -msgstr "" - -#: TIMEZONES:406 -msgid "America/Regina" -msgstr "अमेरिका/रेगिना" - -#. i18n: comment to the previous timezone -#: TIMEZONES:408 TIMEZONES:435 TIMEZONES:818 TIMEZONES:833 -msgid "Central Standard Time - Saskatchewan - most locations" -msgstr "" - -#: TIMEZONES:409 -#, fuzzy -#| msgid "America/Belem" -msgid "America/Resolute" -msgstr "अमेरिका/बेलेम" - -#. i18n: comment to the previous timezone -#: TIMEZONES:411 -msgid "Eastern Time - Resolute, Nunavut" -msgstr "" - -#. i18n: comment to the previous timezone -#: TIMEZONES:413 -msgid "Central Standard Time - Resolute, Nunavut" -msgstr "" - -#: TIMEZONES:414 -msgid "America/Rio_Branco" -msgstr "अमेरिका/रिओ_ब्रांको" - -#: TIMEZONES:417 -msgid "America/Rosario" -msgstr "अमेरिका/रॉसरियो" - -#: TIMEZONES:420 -#, fuzzy -#| msgid "America/Santiago" -msgid "America/Santa_Isabel" -msgstr "अमेरिका/सेनिटिआगो" - -#. i18n: comment to the previous timezone -#: TIMEZONES:422 -msgid "Mexican Pacific Time - Baja California away from US border" -msgstr "" - -#: TIMEZONES:423 -#, fuzzy -#| msgid "America/Santiago" -msgid "America/Santarem" -msgstr "अमेरिका/सेनिटिआगो" - -#. i18n: comment to the previous timezone -#: TIMEZONES:425 -msgid "W Para" -msgstr "" - -#: TIMEZONES:426 -msgid "America/Santiago" -msgstr "अमेरिका/सेनिटिआगो" - -#: TIMEZONES:429 -msgid "America/Santo_Domingo" -msgstr "अमेरिका/सेंटो_डोमिनिका" - -#: TIMEZONES:430 -msgid "America/Sao_Paulo" -msgstr "अमेरिका/साओ_पालॉ" - -#. i18n: comment to the previous timezone -#: TIMEZONES:432 TIMEZONES:806 -msgid "S & SE Brazil (GO, DF, MG, ES, RJ, SP, PR, SC, RS)" -msgstr "" - -#: TIMEZONES:433 -#, fuzzy -#| msgid "America/Dawson" -msgid "America/Saskatoon" -msgstr "अमेरिका/डॉसन" - -#: TIMEZONES:436 -msgid "America/Scoresbysund" -msgstr "अमेरिका/स्कोर्सबाइसुंड" - -#. i18n: comment to the previous timezone -#: TIMEZONES:438 -msgid "Scoresbysund / Ittoqqortoormiit" -msgstr "" - -#: TIMEZONES:439 -msgid "America/Shiprock" -msgstr "अमेरिका/शिपरॉक" - -#. i18n: comment to the previous timezone -#: TIMEZONES:441 -msgid "Mountain Time - Navajo" -msgstr "" - -#: TIMEZONES:442 -#, fuzzy -#| msgid "America/Antigua" -msgid "America/Sitka" -msgstr "अमेरिका/एंटिगुआ" - -#. i18n: comment to the previous timezone -#: TIMEZONES:444 -msgid "Alaska Time - southeast Alaska panhandle" -msgstr "" - -#: TIMEZONES:445 -#, fuzzy -#| msgid "America/Belem" -msgid "America/St_Barthelemy" -msgstr "अमेरिका/बेलेम" - -#: TIMEZONES:446 -msgid "America/St_Johns" -msgstr "अमेरिका/सेंट_जॉहंस" - -#. i18n: comment to the previous timezone -#: TIMEZONES:448 TIMEZONES:827 -msgid "Newfoundland Time, including SE Labrador" -msgstr "" - -#: TIMEZONES:449 -msgid "America/St_Kitts" -msgstr "अमेरिका/सेंट_किटस" - -#: TIMEZONES:450 -msgid "America/St_Lucia" -msgstr "अमेरिका/सेंट_लुसिया" - -#: TIMEZONES:451 -msgid "America/St_Thomas" -msgstr "अमेरिका/सेंट_थॉमस" - -#: TIMEZONES:452 -msgid "America/St_Vincent" -msgstr "अमेरिका/सेंट_विंसेंट" - -#: TIMEZONES:453 -msgid "America/Swift_Current" -msgstr "अमेरिका/स्फिट_करेंट" - -#. i18n: comment to the previous timezone -#: TIMEZONES:455 -msgid "Central Standard Time - Saskatchewan - midwest" -msgstr "" - -#: TIMEZONES:456 -msgid "America/Tegucigalpa" -msgstr "अमेरिका/टेगुसिगलपा" - -#: TIMEZONES:457 -msgid "America/Thule" -msgstr "अमेरिका/थूले" - -#. i18n: comment to the previous timezone -#: TIMEZONES:459 -msgid "Thule / Pituffik" -msgstr "" - -#: TIMEZONES:460 -msgid "America/Thunder_Bay" -msgstr "अमेरिका/थंडर_बे" - -#. i18n: comment to the previous timezone -#: TIMEZONES:462 -msgid "Eastern Time - Thunder Bay, Ontario" -msgstr "" - -#: TIMEZONES:463 -msgid "America/Tijuana" -msgstr "अमेरिका/टिजुआना" - -#. i18n: comment to the previous timezone -#: TIMEZONES:467 -msgid "US Pacific Time - Baja California near US border" -msgstr "" - -#: TIMEZONES:468 -msgid "America/Toronto" -msgstr "अमेरिका/टोरंटो" - -#. i18n: comment to the previous timezone -#: TIMEZONES:470 TIMEZONES:821 -msgid "Eastern Time - Ontario - most locations" -msgstr "" - -#: TIMEZONES:471 -msgid "America/Tortola" -msgstr "अमेरिका/टॉरटोला" - -#: TIMEZONES:472 -msgid "America/Vancouver" -msgstr "अमेरिका/वनकाउवर" - -#. i18n: comment to the previous timezone -#: TIMEZONES:474 TIMEZONES:830 -msgid "Pacific Time - west British Columbia" -msgstr "" - -#: TIMEZONES:475 -#, fuzzy -#| msgid "America/Regina" -msgid "America/Virgin" -msgstr "अमेरिका/रेगिना" - -#: TIMEZONES:476 -msgid "America/Whitehorse" -msgstr "अमेरिका/वाइट_हॉर्स" - -#. i18n: comment to the previous timezone -#: TIMEZONES:478 TIMEZONES:836 -msgid "Pacific Time - south Yukon" -msgstr "" - -#: TIMEZONES:479 -msgid "America/Winnipeg" -msgstr "अमेरिका/विनीपेग" - -#. i18n: comment to the previous timezone -#: TIMEZONES:481 TIMEZONES:815 -msgid "Central Time - Manitoba & west Ontario" -msgstr "" - -#: TIMEZONES:482 -msgid "America/Yakutat" -msgstr "अमेरिका/यकुटट" - -#. i18n: comment to the previous timezone -#: TIMEZONES:484 -msgid "Alaska Time - Alaska panhandle neck" -msgstr "" - -#: TIMEZONES:485 -msgid "America/Yellowknife" -msgstr "अमेरिका/येलोनाइफ" - -#. i18n: comment to the previous timezone -#: TIMEZONES:487 -msgid "Mountain Time - central Northwest Territories" -msgstr "" - -#: TIMEZONES:488 -msgid "Antarctica/Casey" -msgstr "एंटार्कटिका/कसेय" - -#. i18n: comment to the previous timezone -#: TIMEZONES:490 -msgid "Casey Station, Bailey Peninsula" -msgstr "" - -#: TIMEZONES:491 -msgid "Antarctica/Davis" -msgstr "एंटार्कटिका/डेविस" - -#. i18n: comment to the previous timezone -#: TIMEZONES:493 -msgid "Davis Station, Vestfold Hills" -msgstr "" - -#: TIMEZONES:494 -msgid "Antarctica/DumontDUrville" -msgstr "एंटार्कटिका/डुमॉंटडुवेल" - -#. i18n: comment to the previous timezone -#: TIMEZONES:496 -msgid "Dumont-d'Urville Station, Terre Adelie" -msgstr "" - -#: TIMEZONES:497 -#, fuzzy -#| msgid "Antarctica/McMurdo" -msgid "Antarctica/Macquarie" -msgstr "एंटार्कटिका/मैकमुर्दो" - -#. i18n: comment to the previous timezone -#: TIMEZONES:499 -msgid "Macquarie Island Station, Macquarie Island" -msgstr "" - -#: TIMEZONES:500 -msgid "Antarctica/Mawson" -msgstr "एंटार्कटिका/माकसन" - -#. i18n: comment to the previous timezone -#: TIMEZONES:502 -msgid "Mawson Station, Holme Bay" -msgstr "" - -#: TIMEZONES:503 -msgid "Antarctica/McMurdo" -msgstr "एंटार्कटिका/मैकमुर्दो" - -#. i18n: comment to the previous timezone -#: TIMEZONES:505 -msgid "McMurdo Station, Ross Island" -msgstr "" - -#: TIMEZONES:506 -msgid "Antarctica/Palmer" -msgstr "एंटार्कटिका/पलमेर" - -#. i18n: comment to the previous timezone -#: TIMEZONES:508 -msgid "Palmer Station, Anvers Island" -msgstr "" - -#: TIMEZONES:509 -msgid "Antarctica/Rothera" -msgstr "एंटार्कटिका/राथेरा" - -#. i18n: comment to the previous timezone -#: TIMEZONES:511 -msgid "Rothera Station, Adelaide Island" -msgstr "" - -#: TIMEZONES:512 -msgid "Antarctica/South_Pole" -msgstr "एंटार्कटिका/साउथपोल" - -#. i18n: comment to the previous timezone -#: TIMEZONES:514 -msgid "Amundsen-Scott Station, South Pole" -msgstr "" - -#: TIMEZONES:515 -msgid "Antarctica/Syowa" -msgstr "एंटार्कटिका/स्योवा" - -#. i18n: comment to the previous timezone -#: TIMEZONES:517 -msgid "Syowa Station, E Ongul I" -msgstr "" - -#: TIMEZONES:518 -msgid "Antarctica/Vostok" -msgstr "एंटार्कटिका/वॉस्टोक" - -#. i18n: comment to the previous timezone -#: TIMEZONES:520 -msgid "Vostok Station, S Magnetic Pole" -msgstr "" - -#. i18n: comment to the previous timezone -#: TIMEZONES:522 -msgid "Vostok Station, Lake Vostok" -msgstr "" - -#: TIMEZONES:523 -msgid "Arctic/Longyearbyen" -msgstr "आर्टिक/लॉगयेआर्वियन" - -#: TIMEZONES:524 -msgid "Asia/Aden" -msgstr "एशिया/एडेन" - -#: TIMEZONES:525 -msgid "Asia/Almaty" -msgstr "एशिया/अलमाती" - -#: TIMEZONES:528 -msgid "Asia/Amman" -msgstr "एशिया/अमान" - -#: TIMEZONES:529 -msgid "Asia/Anadyr" -msgstr "एशिया/अनादीर" - -#. i18n: comment to the previous timezone -#: TIMEZONES:531 -msgid "Moscow+10 - Bering Sea" -msgstr "" - -#. i18n: comment to the previous timezone -#: TIMEZONES:533 -msgid "Moscow+08 - Bering Sea" -msgstr "" - -#: TIMEZONES:534 -msgid "Asia/Aqtau" -msgstr "एशिया/अक़्ताउ" - -#. i18n: comment to the previous timezone -#: TIMEZONES:536 -msgid "Atyrau (Atirau, Gur'yev), Mangghystau (Mankistau)" -msgstr "" - -#: TIMEZONES:537 -msgid "Asia/Aqtobe" -msgstr "एशिया/अक़्टोब" - -#. i18n: comment to the previous timezone -#: TIMEZONES:539 -msgid "Aqtobe (Aktobe)" -msgstr "" - -#: TIMEZONES:540 -msgid "Asia/Ashgabat" -msgstr "एशिया/अशगाबाट" - -#: TIMEZONES:541 -#, fuzzy -#| msgid "Asia/Ashgabat" -msgid "Asia/Ashkhabad" -msgstr "एशिया/अशगाबाट" - -#: TIMEZONES:542 -msgid "Asia/Baghdad" -msgstr "एशिया/बगदाद" - -#: TIMEZONES:543 -msgid "Asia/Bahrain" -msgstr "एश्या/बहरिन" - -#: TIMEZONES:544 -msgid "Asia/Baku" -msgstr "एशिया/बाकू" - -#: TIMEZONES:545 -msgid "Asia/Bangkok" -msgstr "एशिया/बैंककॉक" - -#: TIMEZONES:546 -#, fuzzy -#| msgid "Asia/Beirut" -msgid "Asia/Beijing" -msgstr "एशिया/बेरुत" - -#. i18n: comment to the previous timezone -#: TIMEZONES:548 TIMEZONES:672 TIMEZONES:968 -msgid "east China - Beijing, Guangdong, Shanghai, etc." -msgstr "" - -#. i18n: comment to the previous timezone -#: TIMEZONES:550 -msgid "China Standard Time" -msgstr "" - -#: TIMEZONES:551 -msgid "Asia/Beirut" -msgstr "एशिया/बेरुत" - -#: TIMEZONES:552 -msgid "Asia/Bishkek" -msgstr "एशिया/बिशकेक" - -#: TIMEZONES:553 -msgid "Asia/Brunei" -msgstr "एशिया/ब्रुनइ" - -#: TIMEZONES:554 -msgid "Asia/Calcutta" -msgstr "एशिया/कोलकाता" - -#: TIMEZONES:555 -msgid "Asia/Choibalsan" -msgstr "एशिया/चोइबालसन" - -#. i18n: comment to the previous timezone -#: TIMEZONES:557 -msgid "Dornod, Sukhbaatar" -msgstr "" - -#: TIMEZONES:558 -msgid "Asia/Chongqing" -msgstr "एशिया/चोंगकिंग" - -#. i18n: comment to the previous timezone -#: TIMEZONES:560 TIMEZONES:565 -msgid "central China - Sichuan, Yunnan, Guangxi, Shaanxi, Guizhou, etc." -msgstr "" - -#. i18n: comment to the previous timezone -#: TIMEZONES:562 -msgid "China mountains" -msgstr "" - -#: TIMEZONES:563 -#, fuzzy -#| msgid "Asia/Chongqing" -msgid "Asia/Chungking" -msgstr "एशिया/चोंगकिंग" - -#: TIMEZONES:566 -msgid "Asia/Colombo" -msgstr "एशिया/कोलोंबो" - -#: TIMEZONES:567 -#, fuzzy -#| msgid "Asia/Dhaka" -msgid "Asia/Dacca" -msgstr "एशिया/ढाका" - -#: TIMEZONES:568 -msgid "Asia/Damascus" -msgstr "एशिया/डमास्कस" - -#: TIMEZONES:569 -msgid "Asia/Dhaka" -msgstr "एशिया/ढाका" - -#: TIMEZONES:570 -msgid "Asia/Dili" -msgstr "एशिया/दिली" - -#: TIMEZONES:571 -msgid "Asia/Dubai" -msgstr "एशिया/दुबई" - -#: TIMEZONES:572 -msgid "Asia/Dushanbe" -msgstr "एशिया/डशंबे" - -#: TIMEZONES:573 -msgid "Asia/Gaza" -msgstr "एशिया/गाज़ा" - -#. i18n: comment to the previous timezone -#: TIMEZONES:575 -msgid "Gaza Strip" -msgstr "" - -#: TIMEZONES:576 -msgid "Asia/Harbin" -msgstr "एशिया/हरबिन" - -#. i18n: comment to the previous timezone -#: TIMEZONES:578 -msgid "Heilongjiang (except Mohe), Jilin" -msgstr "" - -#. i18n: comment to the previous timezone -#: TIMEZONES:580 -msgid "China north" -msgstr "" - -#: TIMEZONES:581 -#, fuzzy -#| msgid "Asia/Harbin" -msgid "Asia/Hebron" -msgstr "एशिया/हरबिन" - -#. i18n: comment to the previous timezone -#: TIMEZONES:583 -msgid "West Bank" -msgstr "" - -#: TIMEZONES:584 -#, fuzzy -#| msgid "Asia/Chongqing" -msgid "Asia/Ho_Chi_Minh" -msgstr "एशिया/चोंगकिंग" - -#: TIMEZONES:585 -msgid "Asia/Hong_Kong" -msgstr "एशिया/हॉंग_कॉंग" - -#: TIMEZONES:586 -msgid "Asia/Hovd" -msgstr "एशिया/हावड" - -#. i18n: comment to the previous timezone -#: TIMEZONES:588 -msgid "Bayan-Olgiy, Govi-Altai, Hovd, Uvs, Zavkhan" -msgstr "" - -#: TIMEZONES:589 -msgid "Asia/Irkutsk" -msgstr "एशिया/इरकुटस्क" - -#. i18n: comment to the previous timezone -#: TIMEZONES:591 -msgid "Moscow+05 - Lake Baikal" -msgstr "" - -#: TIMEZONES:592 -msgid "Asia/Jakarta" -msgstr "एशिया/जकार्ता" - -#. i18n: comment to the previous timezone -#: TIMEZONES:594 -msgid "Java & Sumatra" -msgstr "" - -#: TIMEZONES:595 -msgid "Asia/Jayapura" -msgstr "एशिया/जयापुरा" - -#. i18n: comment to the previous timezone -#: TIMEZONES:597 -msgid "Irian Jaya & the Moluccas" -msgstr "" - -#. i18n: comment to the previous timezone -#: TIMEZONES:599 -msgid "west New Guinea (Irian Jaya) & Malukus (Moluccas)" -msgstr "" - -#: TIMEZONES:600 -msgid "Asia/Jerusalem" -msgstr "एशिया/जेरुशलम" - -#: TIMEZONES:601 -msgid "Asia/Kabul" -msgstr "एशिया/काबुल" - -#: TIMEZONES:602 -msgid "Asia/Kamchatka" -msgstr "एशिया/कैमचटका" - -#. i18n: comment to the previous timezone -#: TIMEZONES:604 -msgid "Moscow+09 - Kamchatka" -msgstr "" - -#. i18n: comment to the previous timezone -#: TIMEZONES:606 -msgid "Moscow+08 - Kamchatka" -msgstr "" - -#: TIMEZONES:607 -msgid "Asia/Karachi" -msgstr "एशिया/कराची" - -#: TIMEZONES:608 -msgid "Asia/Kashgar" -msgstr "एशिया/काशगर" - -#. i18n: comment to the previous timezone -#: TIMEZONES:610 -msgid "west Tibet & Xinjiang" -msgstr "" - -#. i18n: comment to the previous timezone -#: TIMEZONES:612 -msgid "China west Xinjiang" -msgstr "" - -#: TIMEZONES:613 -#, fuzzy -#| msgid "Asia/Katmandu" -msgid "Asia/Kathmandu" -msgstr "एशिया/काठमांडू" - -#: TIMEZONES:614 -msgid "Asia/Katmandu" -msgstr "एशिया/काठमांडू" - -#: TIMEZONES:615 -#, fuzzy -#| msgid "Asia/Jakarta" -msgid "Asia/Kolkata" -msgstr "एशिया/जकार्ता" - -#: TIMEZONES:616 -msgid "Asia/Krasnoyarsk" -msgstr "एशिया/क्रास्नोयार्सक" - -#. i18n: comment to the previous timezone -#: TIMEZONES:618 -msgid "Moscow+04 - Yenisei River" -msgstr "" - -#: TIMEZONES:619 -msgid "Asia/Kuala_Lumpur" -msgstr "एशिया/कौला_लामपुर" - -#. i18n: comment to the previous timezone -#: TIMEZONES:621 -msgid "peninsular Malaysia" -msgstr "" - -#: TIMEZONES:622 -msgid "Asia/Kuching" -msgstr "एशिया/कुचिंग" - -#. i18n: comment to the previous timezone -#: TIMEZONES:624 -msgid "Sabah & Sarawak" -msgstr "" - -#: TIMEZONES:625 -msgid "Asia/Kuwait" -msgstr "एशिया/कुबैत" - -#: TIMEZONES:626 -#, fuzzy -#| msgid "Asia/Macau" -msgid "Asia/Macao" -msgstr "एशिया/मक्का" - -#: TIMEZONES:627 -msgid "Asia/Macau" -msgstr "एशिया/मक्का" - -#: TIMEZONES:628 -msgid "Asia/Magadan" -msgstr "एशिया/मगदान" - -#. i18n: comment to the previous timezone -#: TIMEZONES:630 -msgid "Moscow+08 - Magadan" -msgstr "" - -#: TIMEZONES:631 -msgid "Asia/Makassar" -msgstr "एशिया/मकासार" - -#. i18n: comment to the previous timezone -#: TIMEZONES:633 TIMEZONES:688 -msgid "east & south Borneo, Celebes, Bali, Nusa Tengarra, west Timor" -msgstr "" - -#. i18n: comment to the previous timezone -#: TIMEZONES:635 -msgid "" -"east & south Borneo, Sulawesi (Celebes), Bali, Nusa Tengarra, west Timor" -msgstr "" - -#: TIMEZONES:636 -msgid "Asia/Manila" -msgstr "एशिया/मनीला" - -#: TIMEZONES:637 -msgid "Asia/Muscat" -msgstr "एशिया/मसकट" - -#: TIMEZONES:638 -msgid "Asia/Nicosia" -msgstr "एशिया/निकोसिया" - -#: TIMEZONES:639 -#, fuzzy -#| msgid "Asia/Irkutsk" -msgid "Asia/Novokuznetsk" -msgstr "एशिया/इरकुटस्क" - -#. i18n: comment to the previous timezone -#: TIMEZONES:641 -#, fuzzy -#| msgid "Asia/Novosibirsk" -msgid "Moscow+03 - Novokuznetsk" -msgstr "एशिया/नोवोसिबिर्क" - -#: TIMEZONES:642 -msgid "Asia/Novosibirsk" -msgstr "एशिया/नोवोसिबिर्क" - -#. i18n: comment to the previous timezone -#: TIMEZONES:644 -#, fuzzy -#| msgid "Asia/Novosibirsk" -msgid "Moscow+03 - Novosibirsk" -msgstr "एशिया/नोवोसिबिर्क" - -#: TIMEZONES:645 -msgid "Asia/Omsk" -msgstr "एशिया/ओमस्क" - -#. i18n: comment to the previous timezone -#: TIMEZONES:647 -msgid "Moscow+03 - west Siberia" -msgstr "" - -#: TIMEZONES:648 -msgid "Asia/Oral" -msgstr "एशिया/ऑराल" - -#. i18n: comment to the previous timezone -#: TIMEZONES:650 -msgid "West Kazakhstan" -msgstr "" - -#: TIMEZONES:651 -msgid "Asia/Phnom_Penh" -msgstr "एशिया/फेनॉम_पेनह" - -#: TIMEZONES:652 -msgid "Asia/Pontianak" -msgstr "एशिया/पांटिआनाक" - -#. i18n: comment to the previous timezone -#: TIMEZONES:654 -msgid "west & central Borneo" -msgstr "" - -#: TIMEZONES:655 -msgid "Asia/Pyongyang" -msgstr "एशिया/प्योंगयाग" - -#: TIMEZONES:656 -msgid "Asia/Qatar" -msgstr "एशिया/क़तर" - -#: TIMEZONES:657 -msgid "Asia/Qyzylorda" -msgstr "एशिया/क़्योज़ाइलोर्डा" - -#. i18n: comment to the previous timezone -#: TIMEZONES:659 -msgid "Qyzylorda (Kyzylorda, Kzyl-Orda)" -msgstr "" - -#: TIMEZONES:660 -msgid "Asia/Rangoon" -msgstr "एशिया/रंगून" - -#: TIMEZONES:661 -msgid "Asia/Riyadh" -msgstr "एशिया/रियाद" - -#: TIMEZONES:662 -msgid "Asia/Saigon" -msgstr "एशिया/साइगॉन" - -#: TIMEZONES:663 -msgid "Asia/Sakhalin" -msgstr "एशिया/सकहालिन" - -#. i18n: comment to the previous timezone -#: TIMEZONES:665 -msgid "Moscow+07 - Sakhalin Island" -msgstr "" - -#: TIMEZONES:666 -msgid "Asia/Samarkand" -msgstr "एशिया/समरकंद" - -#. i18n: comment to the previous timezone -#: TIMEZONES:668 -msgid "west Uzbekistan" -msgstr "" - -#: TIMEZONES:669 -msgid "Asia/Seoul" -msgstr "एशिया/सियोल" - -#: TIMEZONES:670 -msgid "Asia/Shanghai" -msgstr "एशिया/शैंघाई" - -#. i18n: comment to the previous timezone -#: TIMEZONES:674 -msgid "China east" -msgstr "" - -#: TIMEZONES:675 -msgid "Asia/Singapore" -msgstr "एशिया/सिंगापुर" - -#: TIMEZONES:676 -msgid "Asia/Taipei" -msgstr "एशिया/ताइवान" - -#: TIMEZONES:677 -msgid "Asia/Tashkent" -msgstr "एशिया/ताशकंद" - -#. i18n: comment to the previous timezone -#: TIMEZONES:679 -msgid "east Uzbekistan" -msgstr "" - -#: TIMEZONES:680 -msgid "Asia/Tbilisi" -msgstr "एशिया/बिलिसी" - -#: TIMEZONES:681 -msgid "Asia/Tehran" -msgstr "एशिया/तेहरान" - -#: TIMEZONES:682 -#, fuzzy -#| msgid "Asia/Taipei" -msgid "Asia/Tel_Aviv" -msgstr "एशिया/ताइवान" - -#: TIMEZONES:683 -#, fuzzy -#| msgid "Asia/Thimphu" -msgid "Asia/Thimbu" -msgstr "एशिया/थिमफू" - -#: TIMEZONES:684 -msgid "Asia/Thimphu" -msgstr "एशिया/थिमफू" - -#: TIMEZONES:685 -msgid "Asia/Tokyo" -msgstr "एशिया/टोक्यो" - -#: TIMEZONES:686 -msgid "Asia/Ujung_Pandang" -msgstr "एशिया/उजंग_पंगडांग" - -#: TIMEZONES:689 -msgid "Asia/Ulaanbaatar" -msgstr "एशिया/उलानबाटर" - -#: TIMEZONES:692 -#, fuzzy -#| msgid "Asia/Ulaanbaatar" -msgid "Asia/Ulan_Bator" -msgstr "एशिया/उलानबाटर" - -#: TIMEZONES:695 -msgid "Asia/Urumqi" -msgstr "एशिया/उरुंगी" - -#. i18n: comment to the previous timezone -#: TIMEZONES:697 -msgid "most of Tibet & Xinjiang" -msgstr "" - -#. i18n: comment to the previous timezone -#: TIMEZONES:699 -msgid "China Xinjiang-Tibet" -msgstr "" - -#: TIMEZONES:700 -msgid "Asia/Vientiane" -msgstr "एशिया/वियतनाम" - -#: TIMEZONES:701 -msgid "Asia/Vladivostok" -msgstr "एशिया/वलादिवोस्टोक" - -#. i18n: comment to the previous timezone -#: TIMEZONES:703 -msgid "Moscow+07 - Amur River" -msgstr "" - -#: TIMEZONES:704 -msgid "Asia/Yakutsk" -msgstr "एशिया/याकुटस्क" - -#. i18n: comment to the previous timezone -#: TIMEZONES:706 -msgid "Moscow+06 - Lena River" -msgstr "" - -#: TIMEZONES:707 -msgid "Asia/Yekaterinburg" -msgstr "एशिया/येकाटेरिंबर्ग" - -#. i18n: comment to the previous timezone -#: TIMEZONES:709 -msgid "Moscow+02 - Urals" -msgstr "" - -#: TIMEZONES:710 -msgid "Asia/Yerevan" -msgstr "एशिया/येरेवन" - -#: TIMEZONES:711 -msgid "Atlantic/Azores" -msgstr "अटलांटिक/अज़ोरेस" - -#. i18n: comment to the previous timezone -#: TIMEZONES:713 -msgid "Azores" -msgstr "" - -#: TIMEZONES:714 -msgid "Atlantic/Bermuda" -msgstr "अटलांटिक/बरमुडा" - -#: TIMEZONES:715 -msgid "Atlantic/Canary" -msgstr "अटलांटिक/कैनरी" - -#. i18n: comment to the previous timezone -#: TIMEZONES:717 -msgid "Canary Islands" -msgstr "" - -#: TIMEZONES:718 -msgid "Atlantic/Cape_Verde" -msgstr "अमेरिका/केप_वर्डे" - -#: TIMEZONES:719 -msgid "Atlantic/Faeroe" -msgstr "अटलांटिक/फाएरे" - -#: TIMEZONES:720 -#, fuzzy -#| msgid "Atlantic/Faeroe" -msgid "Atlantic/Faroe" -msgstr "अटलांटिक/फाएरे" - -#: TIMEZONES:721 -msgid "Atlantic/Jan_Mayen" -msgstr "अटलांटिक/जैन_मायेन" - -#: TIMEZONES:722 -msgid "Atlantic/Madeira" -msgstr "अटलांटिक/मैडेरा" - -#. i18n: comment to the previous timezone -#: TIMEZONES:724 -msgid "Madeira Islands" -msgstr "" - -#: TIMEZONES:725 -msgid "Atlantic/Reykjavik" -msgstr "अटलांटिक/रेकजाविक" - -#: TIMEZONES:726 -msgid "Atlantic/South_Georgia" -msgstr "अटलांटिक/साउथ_जोर्जिया" - -#: TIMEZONES:727 -msgid "Atlantic/St_Helena" -msgstr "अटलांटिक/सेंट_हेलेना" - -#: TIMEZONES:728 -msgid "Atlantic/Stanley" -msgstr "अटलांटिक/स्टांले" - -#: TIMEZONES:729 -#, fuzzy -#| msgid "Australia/Brisbane" -msgid "Australia/ACT" -msgstr "ऑस्ट्रेलिया/ब्रिसबन" - -#. i18n: comment to the previous timezone -#: TIMEZONES:731 TIMEZONES:743 TIMEZONES:770 TIMEZONES:785 -msgid "New South Wales - most locations" -msgstr "" - -#: TIMEZONES:732 -msgid "Australia/Adelaide" -msgstr "ऑस्ट्रेलिया/एडलेड" - -#. i18n: comment to the previous timezone -#: TIMEZONES:734 TIMEZONES:782 -#, fuzzy -#| msgid "Australia/Adelaide" -msgid "South Australia" -msgstr "ऑस्ट्रेलिया/एडलेड" - -#: TIMEZONES:735 -msgid "Australia/Brisbane" -msgstr "ऑस्ट्रेलिया/ब्रिसबन" - -#. i18n: comment to the previous timezone -#: TIMEZONES:737 TIMEZONES:779 -msgid "Queensland - most locations" -msgstr "" - -#: TIMEZONES:738 -msgid "Australia/Broken_Hill" -msgstr "ऑस्ट्रेलिया/ब्रोकन_हिल" - -#. i18n: comment to the previous timezone -#: TIMEZONES:740 TIMEZONES:797 -msgid "New South Wales - Yancowinna" -msgstr "" - -#: TIMEZONES:741 -#, fuzzy -#| msgid "Australia/Brisbane" -msgid "Australia/Canberra" -msgstr "ऑस्ट्रेलिया/ब्रिसबन" - -#: TIMEZONES:744 -#, fuzzy -#| msgid "Australia/Brisbane" -msgid "Australia/Currie" -msgstr "ऑस्ट्रेलिया/ब्रिसबन" - -#. i18n: comment to the previous timezone -#: TIMEZONES:746 -msgid "Tasmania - King Island" -msgstr "" - -#: TIMEZONES:747 -msgid "Australia/Darwin" -msgstr "ऑस्ट्रेलिया/डार्विन" - -#. i18n: comment to the previous timezone -#: TIMEZONES:749 TIMEZONES:773 -msgid "Northern Territory" -msgstr "" - -#: TIMEZONES:750 -#, fuzzy -#| msgid "Australia/Adelaide" -msgid "Australia/Eucla" -msgstr "ऑस्ट्रेलिया/एडलेड" - -#. i18n: comment to the previous timezone -#: TIMEZONES:752 -#, fuzzy -#| msgid "Australia/Adelaide" -msgid "Western Australia - Eucla area" -msgstr "ऑस्ट्रेलिया/एडलेड" - -#: TIMEZONES:753 -msgid "Australia/Hobart" -msgstr "ऑस्ट्रेलिया/हॉबर्ट" - -#. i18n: comment to the previous timezone -#: TIMEZONES:755 TIMEZONES:788 -msgid "Tasmania - most locations" -msgstr "" - -#: TIMEZONES:756 -#, fuzzy -#| msgid "Australia/Hobart" -msgid "Australia/LHI" -msgstr "ऑस्ट्रेलिया/हॉबर्ट" - -#. i18n: comment to the previous timezone -#: TIMEZONES:758 TIMEZONES:764 -msgid "Lord Howe Island" -msgstr "" - -#: TIMEZONES:759 -msgid "Australia/Lindeman" -msgstr "ऑस्ट्रेलिया/लिंडमन" - -#. i18n: comment to the previous timezone -#: TIMEZONES:761 -msgid "Queensland - Holiday Islands" -msgstr "" - -#: TIMEZONES:762 -msgid "Australia/Lord_Howe" -msgstr "ऑस्ट्रेलिया/लॉर्ड_हॉव" - -#: TIMEZONES:765 -msgid "Australia/Melbourne" -msgstr "ऑस्ट्रेलिया/मेलबर्न" - -#. i18n: comment to the previous timezone -#: TIMEZONES:767 TIMEZONES:791 -msgid "Victoria" -msgstr "" - -#: TIMEZONES:768 -#, fuzzy -#| msgid "Australia/Sydney" -msgid "Australia/NSW" -msgstr "ऑस्ट्रेलिया/सिडनी" - -#: TIMEZONES:771 -#, fuzzy -#| msgid "Australia/Perth" -msgid "Australia/North" -msgstr "ऑस्ट्रेलिया/पर्थ" - -#: TIMEZONES:774 -msgid "Australia/Perth" -msgstr "ऑस्ट्रेलिया/पर्थ" - -#. i18n: comment to the previous timezone -#: TIMEZONES:776 TIMEZONES:794 -msgid "Western Australia - most locations" -msgstr "" - -#: TIMEZONES:777 -#, fuzzy -#| msgid "Australia/Adelaide" -msgid "Australia/Queensland" -msgstr "ऑस्ट्रेलिया/एडलेड" - -#: TIMEZONES:780 -#, fuzzy -#| msgid "Australia/Perth" -msgid "Australia/South" -msgstr "ऑस्ट्रेलिया/पर्थ" - -#: TIMEZONES:783 -msgid "Australia/Sydney" -msgstr "ऑस्ट्रेलिया/सिडनी" - -#: TIMEZONES:786 -#, fuzzy -#| msgid "Australia/Brisbane" -msgid "Australia/Tasmania" -msgstr "ऑस्ट्रेलिया/ब्रिसबन" - -#: TIMEZONES:789 -#, fuzzy -#| msgid "Australia/Adelaide" -msgid "Australia/Victoria" -msgstr "ऑस्ट्रेलिया/एडलेड" - -#: TIMEZONES:792 -#, fuzzy -#| msgid "Australia/Perth" -msgid "Australia/West" -msgstr "ऑस्ट्रेलिया/पर्थ" - -#: TIMEZONES:795 -#, fuzzy -#| msgid "Australia/Darwin" -msgid "Australia/Yancowinna" -msgstr "ऑस्ट्रेलिया/डार्विन" - -#: TIMEZONES:798 -msgid "Brazil/Acre" -msgstr "" - -#: TIMEZONES:801 -#, fuzzy -#| msgid "America/Noronha" -msgid "Brazil/DeNoronha" -msgstr "अमेरिका/नॉरॉनहा" - -#: TIMEZONES:804 -msgid "Brazil/East" -msgstr "" - -#: TIMEZONES:807 -msgid "Brazil/West" -msgstr "" - -#: TIMEZONES:810 -msgid "Canada/Atlantic" -msgstr "" - -#: TIMEZONES:813 -msgid "Canada/Central" -msgstr "" - -#: TIMEZONES:816 -msgid "Canada/East-Saskatchewan" -msgstr "" - -#: TIMEZONES:819 -msgid "Canada/Eastern" -msgstr "" - -#: TIMEZONES:822 -msgid "Canada/Mountain" -msgstr "" - -#: TIMEZONES:825 -msgid "Canada/Newfoundland" -msgstr "" - -#: TIMEZONES:828 -msgid "Canada/Pacific" -msgstr "" - -#: TIMEZONES:831 -msgid "Canada/Saskatchewan" -msgstr "" - -#: TIMEZONES:834 -msgid "Canada/Yukon" -msgstr "" - -#: TIMEZONES:837 -msgid "Chile/Continental" -msgstr "" - -#: TIMEZONES:840 -msgid "Chile/EasterIsland" -msgstr "" - -#. i18n: comment to the previous timezone -#: TIMEZONES:842 TIMEZONES:981 -msgid "Easter Island & Sala y Gomez" -msgstr "" - -#: TIMEZONES:843 -msgid "Cuba" -msgstr "" - -#: TIMEZONES:844 -msgid "Egypt" -msgstr "" - -#: TIMEZONES:845 -msgid "Eire" -msgstr "" - -#: TIMEZONES:846 -msgid "Europe/Amsterdam" -msgstr "यूरोप/एमस्टरडम" - -#: TIMEZONES:847 -msgid "Europe/Andorra" -msgstr "यूरोप/एंडोरा" - -#: TIMEZONES:848 -msgid "Europe/Athens" -msgstr "यूरोप/एथेंस" - -#: TIMEZONES:849 -msgid "Europe/Belfast" -msgstr "यूरोप/बेलफास्ट" - -#: TIMEZONES:850 -msgid "Europe/Belgrade" -msgstr "यूरोप/बेलग्रेड" - -#: TIMEZONES:851 -msgid "Europe/Berlin" -msgstr "यूरोप/बर्लिन" - -#: TIMEZONES:852 -msgid "Europe/Bratislava" -msgstr "यूरोप/ब्राटिस्लवा" - -#: TIMEZONES:853 -msgid "Europe/Brussels" -msgstr "यूरोप/ब्रुसल्स" - -#: TIMEZONES:854 -msgid "Europe/Bucharest" -msgstr "यूरोप/बुचारेस्ट" - -#: TIMEZONES:855 -msgid "Europe/Budapest" -msgstr "यूरोप/बुडापेस्ट" - -#: TIMEZONES:856 -msgid "Europe/Chisinau" -msgstr "यूरोप/चिसिंनाउ" - -#: TIMEZONES:857 -msgid "Europe/Copenhagen" -msgstr "यूरोप/कोपेनहागन" - -#: TIMEZONES:858 -msgid "Europe/Dublin" -msgstr "यूरोप/डबलिन" - -#: TIMEZONES:859 -msgid "Europe/Gibraltar" -msgstr "यूरोप/गिब्रालटर" - -#: TIMEZONES:860 -#, fuzzy -#| msgid "Europe/Athens" -msgid "Europe/Guernsey" -msgstr "यूरोप/एथेंस" - -#: TIMEZONES:861 -msgid "Europe/Helsinki" -msgstr "यूरोप/हेलसिंकी" - -#: TIMEZONES:862 -#, fuzzy -#| msgid "Europe/Oslo" -msgid "Europe/Isle_of_Man" -msgstr "यूरोप/ओस्लो" - -#: TIMEZONES:863 -msgid "Europe/Istanbul" -msgstr "यूरोप/इसतानबुल" - -#: TIMEZONES:864 -#, fuzzy -#| msgid "Europe/Paris" -msgid "Europe/Jersey" -msgstr "यूरोप/पेरिस" - -#: TIMEZONES:865 -msgid "Europe/Kaliningrad" -msgstr "यूरोप/कैलिनिंग्राद" - -#. i18n: comment to the previous timezone -#: TIMEZONES:867 -msgid "Moscow-01 - Kaliningrad" -msgstr "" - -#: TIMEZONES:868 -msgid "Europe/Kiev" -msgstr "यूरोप/केव" - -#: TIMEZONES:871 -msgid "Europe/Lisbon" -msgstr "यूरोप/लिस्बन" - -#: TIMEZONES:874 -msgid "Europe/Ljubljana" -msgstr "यूरोप/ज़ुबज़ाना" - -#: TIMEZONES:875 -msgid "Europe/London" -msgstr "यूरोप/लंडन" - -#: TIMEZONES:876 -msgid "Europe/Luxembourg" -msgstr "यूरोप/लक्सेमबर्ग" - -#: TIMEZONES:877 -msgid "Europe/Madrid" -msgstr "यूरोप/मैड्रिड" - -#: TIMEZONES:880 -msgid "Europe/Malta" -msgstr "यूरोप/मालटा" - -#: TIMEZONES:881 -msgid "Europe/Mariehamn" -msgstr "यूरोप/मरेयहेम" - -#: TIMEZONES:882 -msgid "Europe/Minsk" -msgstr "यूरोप/मिंस्क" - -#: TIMEZONES:883 -msgid "Europe/Monaco" -msgstr "यूरोप/मोनाको" - -#: TIMEZONES:884 -msgid "Europe/Moscow" -msgstr "यूरोप/मास्को" - -#. i18n: comment to the previous timezone -#: TIMEZONES:886 TIMEZONES:1099 -msgid "Moscow+00 - west Russia" -msgstr "" - -#: TIMEZONES:887 -msgid "Europe/Oslo" -msgstr "यूरोप/ओस्लो" - -#: TIMEZONES:888 -msgid "Europe/Paris" -msgstr "यूरोप/पेरिस" - -#: TIMEZONES:889 -#, fuzzy -#| msgid "Europe/Andorra" -msgid "Europe/Podgorica" -msgstr "यूरोप/एंडोरा" - -#: TIMEZONES:890 -msgid "Europe/Prague" -msgstr "यूरोप/प्रग" - -#: TIMEZONES:891 -msgid "Europe/Riga" -msgstr "यूरोप/रिगा" - -#: TIMEZONES:892 -msgid "Europe/Rome" -msgstr "यूरोप/रोम" - -#: TIMEZONES:893 -msgid "Europe/Samara" -msgstr "यूरोप/समारा" - -#. i18n: comment to the previous timezone -#: TIMEZONES:895 -msgid "Moscow+01 - Samara, Udmurtia" -msgstr "" - -#. i18n: comment to the previous timezone -#: TIMEZONES:897 -msgid "Moscow+00 - Samara, Udmurtia" -msgstr "" - -#: TIMEZONES:898 -msgid "Europe/San_Marino" -msgstr "यूरोप/सेन_मेरिनो" - -#: TIMEZONES:899 -msgid "Europe/Sarajevo" -msgstr "यूरोप/साराजवो" - -#: TIMEZONES:900 -msgid "Europe/Simferopol" -msgstr "यूरोप/सिमफेरोपॉल" - -#. i18n: comment to the previous timezone -#: TIMEZONES:902 -msgid "central Crimea" -msgstr "" - -#: TIMEZONES:903 -msgid "Europe/Skopje" -msgstr "यूरोप/स्कोपज" - -#: TIMEZONES:904 -msgid "Europe/Sofia" -msgstr "यूरोप/सोफिया" - -#: TIMEZONES:905 -msgid "Europe/Stockholm" -msgstr "यूरोप/स्टॉकहॉम" - -#: TIMEZONES:906 -msgid "Europe/Tallinn" -msgstr "यूरोप/टलिन" - -#: TIMEZONES:907 -msgid "Europe/Tirane" -msgstr "यूरोप/तिराने" - -#: TIMEZONES:908 -#, fuzzy -#| msgid "Europe/Tirane" -msgid "Europe/Tiraspol" -msgstr "यूरोप/तिराने" - -#: TIMEZONES:909 -msgid "Europe/Uzhgorod" -msgstr "यूरोप/उज़गोरोड" - -#. i18n: comment to the previous timezone -#: TIMEZONES:911 -msgid "Ruthenia" -msgstr "" - -#: TIMEZONES:912 -msgid "Europe/Vaduz" -msgstr "यूरोप/वदुज़" - -#: TIMEZONES:913 -msgid "Europe/Vatican" -msgstr "यूरोप/वेटिकन" - -#: TIMEZONES:914 -msgid "Europe/Vienna" -msgstr "यूरोप/वियना" - -#: TIMEZONES:915 -msgid "Europe/Vilnius" -msgstr "यूरोप/विलनियस" - -#: TIMEZONES:916 -#, fuzzy -#| msgid "Europe/Belgrade" -msgid "Europe/Volgograd" -msgstr "यूरोप/बेलग्रेड" - -#. i18n: comment to the previous timezone -#: TIMEZONES:918 -msgid "Moscow+00 - Caspian Sea" -msgstr "" - -#: TIMEZONES:919 -msgid "Europe/Warsaw" -msgstr "यूरोप/वारसॉ" - -#: TIMEZONES:920 -msgid "Europe/Zagreb" -msgstr "यूरोप/जग्रेब" - -#: TIMEZONES:921 -msgid "Europe/Zaporozhye" -msgstr "यूरोप/ज़पोरोज़ाय" - -#. i18n: comment to the previous timezone -#: TIMEZONES:923 -msgid "Zaporozh'ye, E Lugansk / Zaporizhia, E Luhansk" -msgstr "" - -#: TIMEZONES:924 -msgid "Europe/Zurich" -msgstr "यूरोप/जुरिच" - -#: TIMEZONES:925 -msgid "GB" -msgstr "" - -#: TIMEZONES:926 -msgid "GB-Eire" -msgstr "" - -#: TIMEZONES:927 -#, fuzzy -#| msgid "Asia/Hong_Kong" -msgid "Hongkong" -msgstr "एशिया/हॉंग_कॉंग" - -#: TIMEZONES:928 -msgid "Iceland" -msgstr "" - -#: TIMEZONES:929 -msgid "Indian/Antananarivo" -msgstr "इंडियन/एंटानानारिवो" - -#: TIMEZONES:930 -msgid "Indian/Chagos" -msgstr "इंडियन/चगोस" - -#: TIMEZONES:931 -msgid "Indian/Christmas" -msgstr "इंडियन/क्रिसमस" - -#: TIMEZONES:932 -msgid "Indian/Cocos" -msgstr "इंडियन/कोकोस" - -#: TIMEZONES:933 -msgid "Indian/Comoro" -msgstr "इंडियन/कोमोरो" - -#: TIMEZONES:934 -msgid "Indian/Kerguelen" -msgstr "इंडियन/केर्गुएलिन" - -#: TIMEZONES:935 -msgid "Indian/Mahe" -msgstr "इंडियन/माहे" - -#: TIMEZONES:936 -msgid "Indian/Maldives" -msgstr "इंडियन/मालद्वीप" - -#: TIMEZONES:937 -msgid "Indian/Mauritius" -msgstr "इंडियन/मौरिसस" - -#: TIMEZONES:938 -msgid "Indian/Mayotte" -msgstr "इंडियन/मयोट्टे" - -#: TIMEZONES:939 -msgid "Indian/Reunion" -msgstr "इंडियन/रियुनियन" - -#: TIMEZONES:940 -msgid "Iran" -msgstr "" - -#: TIMEZONES:941 -#, fuzzy -#| msgid "Pacific/Kosrae" -msgid "Israel" -msgstr "प्रशांत/कोस्रे" - -#: TIMEZONES:942 -#, fuzzy -#| msgid "America/Jamaica" -msgid "Jamaica" -msgstr "अमेरिका/जैमाएका" - -#: TIMEZONES:943 -msgid "Japan" -msgstr "" - -#. i18n: comment to the previous timezone -#: TIMEZONES:944 TIMEZONES:946 TIMEZONES:1011 -#, fuzzy -#| msgid "Pacific/Kwajalein" -msgid "Kwajalein" -msgstr "प्रशांत/क्वाजलिन" - -#: TIMEZONES:947 -msgid "Libya" -msgstr "" - -#: TIMEZONES:948 -msgid "Mexico/BajaNorte" -msgstr "" - -#: TIMEZONES:951 -msgid "Mexico/BajaSur" -msgstr "" - -#: TIMEZONES:954 -msgid "Mexico/General" -msgstr "" - -#: TIMEZONES:957 -msgid "NZ" -msgstr "" - -#: TIMEZONES:960 -msgid "NZ-CHAT" -msgstr "" - -#. i18n: comment to the previous timezone -#: TIMEZONES:962 TIMEZONES:975 -msgid "Chatham Islands" -msgstr "" - -#: TIMEZONES:963 -msgid "Navajo" -msgstr "" - -#: TIMEZONES:966 -msgid "PRC" -msgstr "" - -#: TIMEZONES:969 -msgid "Pacific/Apia" -msgstr "प्रशांत/एपिया" - -#: TIMEZONES:970 -msgid "Pacific/Auckland" -msgstr "प्रशांत/ऑकलैंड" - -#: TIMEZONES:973 -msgid "Pacific/Chatham" -msgstr "प्रशांत/चटहाम" - -#: TIMEZONES:976 -#, fuzzy -#| msgid "Pacific/Truk" -msgid "Pacific/Chuuk" -msgstr "प्रशांत/ट्रुक" - -#. i18n: comment to the previous timezone -#: TIMEZONES:978 -msgid "Chuuk (Truk) and Yap" -msgstr "" - -#: TIMEZONES:979 -msgid "Pacific/Easter" -msgstr "प्रशांत/इस्टर" - -#: TIMEZONES:982 -msgid "Pacific/Efate" -msgstr "प्रशांत/इफेट" - -#: TIMEZONES:983 -msgid "Pacific/Enderbury" -msgstr "प्रशांत/एंडरबरी" - -#. i18n: comment to the previous timezone -#: TIMEZONES:985 -msgid "Phoenix Islands" -msgstr "" - -#: TIMEZONES:986 -msgid "Pacific/Fakaofo" -msgstr "प्रशांत/फकाओफो" - -#: TIMEZONES:987 -msgid "Pacific/Fiji" -msgstr "प्रशांत/फिजी" - -#: TIMEZONES:988 -msgid "Pacific/Funafuti" -msgstr "प्रशांत/फुनाफुटी" - -#: TIMEZONES:989 -msgid "Pacific/Galapagos" -msgstr "प्रशांत/गलापगोस" - -#. i18n: comment to the previous timezone -#: TIMEZONES:991 -msgid "Galapagos Islands" -msgstr "" - -#: TIMEZONES:992 -msgid "Pacific/Gambier" -msgstr "प्रशांत/गैंबियर" - -#. i18n: comment to the previous timezone -#: TIMEZONES:994 -msgid "Gambier Islands" -msgstr "" - -#: TIMEZONES:995 -msgid "Pacific/Guadalcanal" -msgstr "प्रशांत/गुआडालकनल" - -#: TIMEZONES:996 -msgid "Pacific/Guam" -msgstr "प्रशांत/गुआम" - -#: TIMEZONES:997 -msgid "Pacific/Honolulu" -msgstr "प्रशांत/होनोलूलू" - -#. i18n: comment to the previous timezone -#: TIMEZONES:999 TIMEZONES:1083 -msgid "Hawaii" -msgstr "" - -#: TIMEZONES:1000 -msgid "Pacific/Johnston" -msgstr "प्रशांत/जॉनस्टन" - -#. i18n: comment to the previous timezone -#: TIMEZONES:1002 -msgid "Johnston Atoll" -msgstr "" - -#: TIMEZONES:1003 -msgid "Pacific/Kiritimati" -msgstr "प्रशांत/किरितिमाती" - -#. i18n: comment to the previous timezone -#: TIMEZONES:1005 -msgid "Line Islands" -msgstr "" - -#: TIMEZONES:1006 -msgid "Pacific/Kosrae" -msgstr "प्रशांत/कोस्रे" - -#. i18n: comment to the previous timezone -#: TIMEZONES:1008 -#, fuzzy -#| msgid "Pacific/Kosrae" -msgid "Kosrae" -msgstr "प्रशांत/कोस्रे" - -#: TIMEZONES:1009 -msgid "Pacific/Kwajalein" -msgstr "प्रशांत/क्वाजलिन" - -#: TIMEZONES:1012 -msgid "Pacific/Majuro" -msgstr "प्रशांत/मजुरा" - -#: TIMEZONES:1015 -msgid "Pacific/Marquesas" -msgstr "प्रशांत/मारक्यूसास" - -#. i18n: comment to the previous timezone -#: TIMEZONES:1017 -msgid "Marquesas Islands" -msgstr "" - -#: TIMEZONES:1018 -msgid "Pacific/Midway" -msgstr "प्रशांत/मिडवे" - -#. i18n: comment to the previous timezone -#: TIMEZONES:1020 -msgid "Midway Islands" -msgstr "" - -#: TIMEZONES:1021 -msgid "Pacific/Nauru" -msgstr "प्रशांत/नाउरू" - -#: TIMEZONES:1022 -msgid "Pacific/Niue" -msgstr "प्रशांत/निउ" - -#: TIMEZONES:1023 -msgid "Pacific/Norfolk" -msgstr "प्रशांत/नॉरफॉक" - -#: TIMEZONES:1024 -msgid "Pacific/Noumea" -msgstr "प्रशांत/नाउमिया" - -#: TIMEZONES:1025 -msgid "Pacific/Pago_Pago" -msgstr "प्रशांत/पागो_पादो" - -#: TIMEZONES:1026 -msgid "Pacific/Palau" -msgstr "प्रशांत/पलाउ" - -#: TIMEZONES:1027 -msgid "Pacific/Pitcairn" -msgstr "प्रशांत/पिटकैम" - -#: TIMEZONES:1028 -#, fuzzy -#| msgid "Pacific/Ponape" -msgid "Pacific/Pohnpei" -msgstr "प्रशांत/पोनेप" - -#. i18n: comment to the previous timezone -#: TIMEZONES:1030 -msgid "Pohnpei (Ponape)" -msgstr "" - -#: TIMEZONES:1031 -msgid "Pacific/Ponape" -msgstr "प्रशांत/पोनेप" - -#. i18n: comment to the previous timezone -#: TIMEZONES:1033 -msgid "Ponape (Pohnpei)" -msgstr "" - -#: TIMEZONES:1034 -msgid "Pacific/Port_Moresby" -msgstr "प्रशांत/पॉर्ट_मोरेस्बी" - -#: TIMEZONES:1035 -msgid "Pacific/Rarotonga" -msgstr "प्रशांत/रारोटोंगा" - -#: TIMEZONES:1036 -msgid "Pacific/Saipan" -msgstr "प्रशांत/सैपान" - -#: TIMEZONES:1037 -#, fuzzy -#| msgid "Pacific/Saipan" -msgid "Pacific/Samoa" -msgstr "प्रशांत/सैपान" - -#: TIMEZONES:1038 -msgid "Pacific/Tahiti" -msgstr "प्रशांत/तहिती" - -#. i18n: comment to the previous timezone -#: TIMEZONES:1040 -msgid "Society Islands" -msgstr "" - -#: TIMEZONES:1041 -msgid "Pacific/Tarawa" -msgstr "प्रशांत/टरावा" - -#. i18n: comment to the previous timezone -#: TIMEZONES:1043 -msgid "Gilbert Islands" -msgstr "" - -#: TIMEZONES:1044 -msgid "Pacific/Tongatapu" -msgstr "प्रशांत/टॉन्गाटापु" - -#: TIMEZONES:1045 -msgid "Pacific/Truk" -msgstr "प्रशांत/ट्रुक" - -#. i18n: comment to the previous timezone -#: TIMEZONES:1047 TIMEZONES:1054 -msgid "Truk (Chuuk) and Yap" -msgstr "" - -#: TIMEZONES:1048 -msgid "Pacific/Wake" -msgstr "प्रशांत/वेक" - -#. i18n: comment to the previous timezone -#: TIMEZONES:1050 -msgid "Wake Island" -msgstr "" - -#: TIMEZONES:1051 -msgid "Pacific/Wallis" -msgstr "प्रशांत/वालिस" - -#: TIMEZONES:1052 -msgid "Pacific/Yap" -msgstr "प्रशांत/याप" - -#: TIMEZONES:1055 -msgid "Poland" -msgstr "" - -#: TIMEZONES:1056 -msgid "Portugal" -msgstr "" - -#: TIMEZONES:1059 -msgid "ROC" -msgstr "" - -#: TIMEZONES:1060 -msgid "ROK" -msgstr "" - -#: TIMEZONES:1061 -#, fuzzy -#| msgid "Asia/Singapore" -msgid "Singapore" -msgstr "एशिया/सिंगापुर" - -#: TIMEZONES:1062 -msgid "Turkey" -msgstr "" - -#: TIMEZONES:1063 -msgid "US/Alaska" -msgstr "" - -#: TIMEZONES:1066 -msgid "US/Aleutian" -msgstr "" - -#: TIMEZONES:1069 -msgid "US/Arizona" -msgstr "" - -#: TIMEZONES:1072 -msgid "US/Central" -msgstr "" - -#: TIMEZONES:1075 -msgid "US/East-Indiana" -msgstr "" - -#: TIMEZONES:1078 -msgid "US/Eastern" -msgstr "" - -#: TIMEZONES:1081 -msgid "US/Hawaii" -msgstr "" - -#: TIMEZONES:1084 -msgid "US/Indiana-Starke" -msgstr "" - -#: TIMEZONES:1087 -msgid "US/Michigan" -msgstr "" - -#: TIMEZONES:1090 -msgid "US/Mountain" -msgstr "" - -#: TIMEZONES:1093 -#, fuzzy -#| msgid "Pacific/Yap" -msgid "US/Pacific" -msgstr "प्रशांत/याप" - -#: TIMEZONES:1096 -msgid "US/Samoa" -msgstr "" - -#: TIMEZONES:1097 -msgid "W-SU" -msgstr "" - -#, fuzzy -#~| msgid "Country or Region:" -#~ msgid "Country or region:" -#~ msgstr "देश या क्षत्र:" - -#~ msgid "Languages:" -#~ msgstr "भाषाएँ:" - -#~ msgid "None selected (<a href=\"/change\">change...</a>)" -#~ msgstr "कोइ चयन नहीं (<a href=\"/change\">बदलें...</a>)" - -#~ msgid "Remove" -#~ msgstr "हटाएँ" - -#~ msgctxt "NAME OF TRANSLATORS" -#~ msgid "Your names" -#~ msgstr "रविशंकर श्रीवास्तव" - -#~ msgctxt "EMAIL OF TRANSLATORS" -#~ msgid "Your emails" -#~ msgstr "raviratlami@gmail.com" - -#~ msgid "Add..." -#~ msgstr "जोड़ें..." - -#~ msgid "Locale" -#~ msgstr "लोकेल" - -#~ msgid "Number" -#~ msgstr "क्रमांक" - -#~ msgid "Wednesday 23 February 1927" -#~ msgstr "बुधवार 23 फरवरी 1927" - -#~ msgid "1,234,567.89" -#~ msgstr "1,234,567.89" - -#~ msgid "Time:" -#~ msgstr "समय:" - -#~ msgid "Date:" -#~ msgstr "तारीख़ः" - -#~ msgid "Money:" -#~ msgstr "मुद्रा" - -#~ msgid "Short date:" -#~ msgstr "छोटी तिथिः" - -#~ msgid "$ 1,234,567.89" -#~ msgstr "$ 1,234,567.89" - -#~ msgid "Numbers:" -#~ msgstr "क्रमांकः" - -#~ msgid "1927-02-20" -#~ msgstr "1927-02-20" - -#~ msgid "19:38:47" -#~ msgstr "19:38:47" diff -Nru kde-l10n-hi-4.12.97/messages/kdegraphics/okular.po kde-l10n-hi-4.13.0/messages/kdegraphics/okular.po --- kde-l10n-hi-4.12.97/messages/kdegraphics/okular.po 2014-03-06 03:45:35.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kdegraphics/okular.po 2014-04-10 07:54:02.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: okular\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-06 01:39+0000\n" +"POT-Creation-Date: 2014-04-10 06:38+0000\n" "PO-Revision-Date: 2007-12-27 17:21+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -431,17 +431,17 @@ msgstr "" #. i18n: ectx: property (text), item, widget (QComboBox, kcfg_ZoomMode) -#: conf/dlggeneralbase.ui:355 part.cpp:2320 ui/pageview.cpp:3709 +#: conf/dlggeneralbase.ui:355 part.cpp:2333 ui/pageview.cpp:3688 msgid "Fit Width" msgstr "चौड़ाई फिट करें" #. i18n: ectx: property (text), item, widget (QComboBox, kcfg_ZoomMode) -#: conf/dlggeneralbase.ui:360 ui/pageview.cpp:3709 +#: conf/dlggeneralbase.ui:360 ui/pageview.cpp:3688 msgid "Fit Page" msgstr "पृष्ठ में फिट करें" #. i18n: ectx: property (text), item, widget (QComboBox, kcfg_ZoomMode) -#: conf/dlggeneralbase.ui:365 ui/pageview.cpp:3709 +#: conf/dlggeneralbase.ui:365 ui/pageview.cpp:3688 msgid "Auto Fit" msgstr "" @@ -1617,12 +1617,12 @@ msgid "Viewer Toolbar" msgstr "मुख्य औज़ार पट्टी" -#: part.cpp:156 shell/main.cpp:49 ui/annotationwidgets.cpp:333 -#: ui/sidebar.cpp:704 +#: part.cpp:156 shell/main.cpp:121 ui/annotationwidgets.cpp:333 +#: ui/sidebar.cpp:705 msgid "Okular" msgstr "ऑकुलर" -#: part.cpp:376 +#: part.cpp:377 msgid "Contents" msgstr "विषय सूची" @@ -1646,360 +1646,360 @@ "दस्तावेज़ में अंतर्निर्मित फ़ाइलें हैं. <a href=\"okular:/embeddedfiles\">उन्हें देखने के लिए " "यहाँ क्लिक करें</a> या फ़ाइल -> अंतर्निर्मित फ़ाइलें में जाएँ." -#: part.cpp:567 +#: part.cpp:566 msgctxt "Previous page" msgid "Previous" msgstr "पिछला" -#: part.cpp:568 +#: part.cpp:567 msgid "Go back to the Previous Page" msgstr "पिछले पृष्ठ पर जाएँ" -#: part.cpp:569 +#: part.cpp:568 msgid "Moves to the previous page of the document" msgstr "दस्तावेज़ के पिछले पृष्ठ पर जाता है" -#: part.cpp:579 +#: part.cpp:578 msgctxt "Next page" msgid "Next" msgstr "अगला" -#: part.cpp:580 +#: part.cpp:579 msgid "Advance to the Next Page" msgstr "अगले पृष्ठ में जाएँ" -#: part.cpp:581 +#: part.cpp:580 msgid "Moves to the next page of the document" msgstr "दस्तावेज़ के अगले पृष्ठ पर जाता है" -#: part.cpp:592 +#: part.cpp:591 #, fuzzy #| msgid "Reloading the document..." msgid "Beginning of the document" msgstr "दस्तावेज़ को रीलोड किया जा रहा है..." -#: part.cpp:593 +#: part.cpp:592 #, fuzzy #| msgid "Moves to the next page of the document" msgid "Moves to the beginning of the document" msgstr "दस्तावेज़ के अगले पृष्ठ पर जाता है" -#: part.cpp:597 +#: part.cpp:596 #, fuzzy #| msgid "Reloading the document..." msgid "End of the document" msgstr "दस्तावेज़ को रीलोड किया जा रहा है..." -#: part.cpp:598 +#: part.cpp:597 #, fuzzy #| msgid "Moves to the next page of the document" msgid "Moves to the end of the document" msgstr "दस्तावेज़ के अगले पृष्ठ पर जाता है" -#: part.cpp:609 part.cpp:1932 ui/bookmarklist.cpp:249 ui/bookmarklist.cpp:276 +#: part.cpp:608 part.cpp:1945 ui/bookmarklist.cpp:249 ui/bookmarklist.cpp:276 msgid "Rename Bookmark" msgstr "पसंदीदा को नया नाम दें" -#: part.cpp:611 +#: part.cpp:610 #, fuzzy #| msgid "Reload the current document from disk." msgid "Rename the current bookmark" msgstr "मौज़ूदा दस्तावेज़ डिस्क से फिर से लोड करें" -#: part.cpp:615 +#: part.cpp:614 msgid "Previous Bookmark" msgstr "पिछला पसंदीदा " -#: part.cpp:617 +#: part.cpp:616 #, fuzzy #| msgid "Go to the previous bookmarked page" msgid "Go to the previous bookmark" msgstr "पिछले पसंदीदा पृष्ठ पर जाएँ" -#: part.cpp:621 +#: part.cpp:620 msgid "Next Bookmark" msgstr "अगला पसंदीदा " -#: part.cpp:623 +#: part.cpp:622 #, fuzzy #| msgid "Go to the next bookmarked page" msgid "Go to the next bookmark" msgstr "अगले पसंदीदा पृष्ठ पर जाएँ" -#: part.cpp:649 +#: part.cpp:648 #, fuzzy #| msgid "Configure okular..." msgid "Configure Okular..." msgstr "ऑकुलर कॉन्फ़िगर करें..." -#: part.cpp:654 +#: part.cpp:653 msgid "Configure Viewer..." msgstr "प्रदर्शक कॉन्फ़िगर करें..." -#: part.cpp:661 +#: part.cpp:660 #, fuzzy #| msgid "Configure Backends..." msgid "Configure Viewer Backends..." msgstr "बैकएण्ड्स कॉन्फ़िगर करें..." -#: part.cpp:665 +#: part.cpp:664 msgid "Configure Backends..." msgstr "बैकएण्ड्स कॉन्फ़िगर करें..." -#: part.cpp:678 ui/annotationpopup.cpp:77 ui/annotationpopup.cpp:109 +#: part.cpp:677 ui/annotationpopup.cpp:77 ui/annotationpopup.cpp:109 #: ui/propertiesdialog.cpp:50 msgid "&Properties" msgstr "गुण (&P)" -#: part.cpp:692 +#: part.cpp:691 #, fuzzy #| msgid "About backend..." msgid "About Backend" msgstr "बैकएण्ड के बारे में..." -#: part.cpp:697 +#: part.cpp:696 msgid "Reloa&d" msgstr "फिर से लोड करें (&d)" -#: part.cpp:699 +#: part.cpp:698 msgid "Reload the current document from disk." msgstr "मौज़ूदा दस्तावेज़ डिस्क से फिर से लोड करें" -#: part.cpp:705 +#: part.cpp:704 msgid "Close &Find Bar" msgstr "खोज पट्टी बन्द करें (&F)" -#: part.cpp:709 +#: part.cpp:708 #, fuzzy #| msgid "Pages Size" msgid "Page Number" msgstr "पृष्ठ आकार" -#: part.cpp:742 +#: part.cpp:741 #, fuzzy #| msgid "Save As..." msgid "Save &Copy As..." msgstr "ऐसे सहेजें..." -#: part.cpp:751 +#: part.cpp:750 msgid "Show &Navigation Panel" msgstr "नेविगेशन फलक दिखाएँ (&N)" -#: part.cpp:759 +#: part.cpp:758 msgid "Show &Page Bar" msgstr "" -#: part.cpp:765 +#: part.cpp:764 msgid "&Embedded Files" msgstr "अंतर्निर्मित फ़ाइलें (&E)" -#: part.cpp:771 +#: part.cpp:770 msgid "E&xport As" msgstr "इस रूप में निर्यात करें (&x)" -#: part.cpp:781 +#: part.cpp:780 #, fuzzy #| msgid "Document to open" msgctxt "A document format, Okular-specific" msgid "Document Archive" msgstr "दस्तावेज़ जिसे खोलना है" -#: part.cpp:787 +#: part.cpp:786 msgid "P&resentation" msgstr "प्रेजेन्टेशन (&r)" -#: part.cpp:794 +#: part.cpp:793 #, fuzzy #| msgid "&Import Postscript as PDF..." msgid "&Import PostScript as PDF..." msgstr "पोस्ट-स्क्रिप्ट को पीडीएफ के रूप में आयात करें...(&I)" -#: part.cpp:799 +#: part.cpp:798 msgid "&Get Books From Internet..." msgstr "इंटरनेट से किताबें लाएँ... (&G)" -#: part.cpp:806 +#: part.cpp:805 msgid "Switch Blackscreen Mode" msgstr "" -#: part.cpp:812 +#: part.cpp:811 msgid "Toggle Drawing Mode" msgstr "ड्राइंग मोड टॉगल करें" -#: part.cpp:817 +#: part.cpp:816 msgid "Erase Drawings" msgstr "ड्राइंग मिटाएँ" -#: part.cpp:822 +#: part.cpp:821 #, fuzzy #| msgid "Configure Backends..." msgid "Configure Annotations..." msgstr "बैकएण्ड्स कॉन्फ़िगर करें..." -#: part.cpp:827 +#: part.cpp:826 #, fuzzy #| msgid "Presentation" msgid "Play/Pause Presentation" msgstr "प्रस्तुतीकरण" -#: part.cpp:972 +#: part.cpp:971 #, fuzzy, kde-format #| msgid "Could not open %1. Reason: %2" msgid "Could not open '%1'. File does not exist" msgstr "%1 को खोला नहीं जा सका. कारण: %2" -#: part.cpp:1007 +#: part.cpp:1020 #, kde-format msgid "The loading of %1 has been canceled." msgstr "" -#: part.cpp:1023 +#: part.cpp:1036 #, kde-format msgid "Could not open %1. Reason: %2" msgstr "%1 को खोला नहीं जा सका. कारण: %2" -#: part.cpp:1054 +#: part.cpp:1067 #, fuzzy #| msgid "Configure Backends" msgid "Configure Viewer Backends" msgstr "बैकएण्ड्स कॉन्फ़िगर करें" -#: part.cpp:1058 +#: part.cpp:1071 msgid "Configure Backends" msgstr "बैकएण्ड्स कॉन्फ़िगर करें" -#: part.cpp:1156 +#: part.cpp:1169 msgid "" "The program \"ps2pdf\" was not found, so Okular can not import PS files " "using it." msgstr "" -#: part.cpp:1156 +#: part.cpp:1169 msgid "ps2pdf not found" msgstr "ps2pdf नहीं मिला" -#: part.cpp:1175 +#: part.cpp:1188 msgid "Importing PS file as PDF (this may take a while)..." msgstr "पीएस फ़ाइल को पीडीएफ़ के लिए आयात किया जा रहा है (इसमें कुछ समय लग सकता है)..." -#: part.cpp:1255 +#: part.cpp:1268 msgid "This document has XFA forms, which are currently <b>unsupported</b>." msgstr "" -#: part.cpp:1261 +#: part.cpp:1274 msgid "" "This document has forms. Click on the button to interact with them, or use " "View -> Show Forms." msgstr "" -#: part.cpp:1328 +#: part.cpp:1341 msgid "" "The document requested to be launched in presentation mode.\n" "Do you want to allow it?" msgstr "" -#: part.cpp:1330 +#: part.cpp:1343 #, fuzzy #| msgid "Exit Presentation Mode" msgid "Presentation Mode" msgstr "प्रस्तुतीकरण मोड से बाहर हों" -#: part.cpp:1331 +#: part.cpp:1344 msgid "Allow" msgstr "" -#: part.cpp:1331 +#: part.cpp:1344 #, fuzzy #| msgid "Exit Presentation Mode" msgid "Allow the presentation mode" msgstr "प्रस्तुतीकरण मोड से बाहर हों" -#: part.cpp:1332 +#: part.cpp:1345 msgid "Do Not Allow" msgstr "" -#: part.cpp:1332 +#: part.cpp:1345 #, fuzzy #| msgid "Start the document in presentation mode" msgid "Do not allow the presentation mode" msgstr "दस्तावेज को प्रस्तुतीकरण मोड में प्रारंभ करें" -#: part.cpp:1392 +#: part.cpp:1405 #, kde-format msgid "Could not open %1" msgstr "%1 को खोल नहीं सका" -#: part.cpp:1404 +#: part.cpp:1417 msgid "Do you want to save your annotation changes or discard them?" msgstr "" -#: part.cpp:1405 +#: part.cpp:1418 #, fuzzy #| msgid "Open a document" msgid "Close Document" msgstr "दस्तावेज़ खोलें" -#: part.cpp:1511 +#: part.cpp:1524 msgid "" "This link points to a close document action that does not work when using " "the embedded viewer." msgstr "" -#: part.cpp:1517 +#: part.cpp:1530 msgid "" "This link points to a quit application action that does not work when using " "the embedded viewer." msgstr "" -#: part.cpp:1613 part.cpp:1632 +#: part.cpp:1626 part.cpp:1645 msgid "Reloading the document..." msgstr "दस्तावेज़ को रीलोड किया जा रहा है..." -#: part.cpp:1761 part.cpp:2316 ui/bookmarklist.cpp:250 +#: part.cpp:1774 part.cpp:2329 ui/bookmarklist.cpp:250 msgid "Remove Bookmark" msgstr " पसंदीदा मिटाएँ" -#: part.cpp:1820 +#: part.cpp:1833 msgid "Go to Page" msgstr "पृष्ठ पर जाएं" -#: part.cpp:1835 +#: part.cpp:1848 msgid "&Page:" msgstr "पृष्ठ: (&P)" -#: part.cpp:1932 +#: part.cpp:1945 msgid "Enter the new name of the bookmark:" msgstr "" -#: part.cpp:1970 +#: part.cpp:1983 #, fuzzy #| msgid "Rename Bookmark" msgid "Rename this Bookmark" msgstr "पसंदीदा को नया नाम दें" -#: part.cpp:2069 +#: part.cpp:2082 msgid "" "Your annotations will not be exported.\n" "You can export the annotated document using File -> Export As -> Document " "Archive" msgstr "" -#: part.cpp:2090 +#: part.cpp:2103 msgid "Could not open the temporary file for saving." msgstr "" -#: part.cpp:2108 part.cpp:2120 part.cpp:2168 part.cpp:2492 +#: part.cpp:2121 part.cpp:2133 part.cpp:2181 part.cpp:2505 #, kde-format msgid "File could not be saved in '%1'. Try to save it to another location." msgstr "" -#: part.cpp:2112 +#: part.cpp:2125 #, fuzzy, kde-format #| msgid "File not saved." msgid "File could not be saved in '%1'. %2" msgstr "फ़ाइल को सहेजा नहीं गया." -#: part.cpp:2153 +#: part.cpp:2166 #, kde-format msgid "" "Okular cannot copy %1 to the specified location.\n" @@ -2007,31 +2007,31 @@ "The document does not exist anymore." msgstr "" -#: part.cpp:2313 ui/annotationmodel.cpp:305 +#: part.cpp:2326 ui/annotationmodel.cpp:305 #, kde-format msgid "Page %1" msgstr "पृष्ठ %1" -#: part.cpp:2318 +#: part.cpp:2331 msgid "Add Bookmark" msgstr "पसंद जोड़ें" -#: part.cpp:2335 +#: part.cpp:2348 msgid "Tools" msgstr "औज़ार" -#: part.cpp:2592 +#: part.cpp:2605 msgid "Printing this document is not allowed." msgstr "इस दस्तावेज़ को छापना स्वीकार्य नहीं है." -#: part.cpp:2601 +#: part.cpp:2614 #, fuzzy #| msgid "Could not print the document. Please report to bugs.kde.org" msgid "" "Could not print the document. Unknown error. Please report to bugs.kde.org" msgstr "दस्तावेज़ छाप नहीं सकता. कृपया bugs.kde.org को बग रिपोर्ट करें." -#: part.cpp:2605 +#: part.cpp:2618 #, fuzzy, kde-format #| msgid "Could not print the document. Please report to bugs.kde.org" msgid "" @@ -2039,15 +2039,15 @@ "bugs.kde.org" msgstr "दस्तावेज़ छाप नहीं सकता. कृपया bugs.kde.org को बग रिपोर्ट करें." -#: part.cpp:2660 +#: part.cpp:2673 msgid "Go to the place you were before" msgstr "उस जगह पर जाएं जहाँ आप पहले जा चुके हैं" -#: part.cpp:2664 +#: part.cpp:2677 msgid "Go to the place you were after" msgstr "उस जगह पर जाएँ जहाँ आप जाना चाहते हैं" -#: part.cpp:2689 +#: part.cpp:2702 #, kde-format msgid "" "<qt><strong>File Error!</strong> Could not create temporary file " @@ -2056,7 +2056,7 @@ "<qt><strong>फ़ाइल त्रुटि!</strong> अस्थायी फ़ाइल तैयार नहीं कर सका<nobr><strong>%1</" "strong></nobr>.</qt>" -#: part.cpp:2707 +#: part.cpp:2720 #, kde-format msgid "" "<qt><strong>File Error!</strong> Could not open the file <nobr><strong>%1</" @@ -2065,7 +2065,7 @@ "<qt><strong>फ़ाइल त्रुटि!</strong> फ़ाइल <nobr><strong>%1</strong></nobr>को " "असंपीडित करने के लिए खोल नहीं सका. फ़ाइल को लोड नहीं किया जा सका.</qt>" -#: part.cpp:2710 +#: part.cpp:2723 msgid "" "<qt>This error typically occurs if you do not have enough permissions to " "read the file. You can check ownership and permissions if you right-click on " @@ -2073,7 +2073,7 @@ "qt>" msgstr "" -#: part.cpp:2734 +#: part.cpp:2747 #, kde-format msgid "" "<qt><strong>File Error!</strong> Could not uncompress the file <nobr><strong>" @@ -2082,13 +2082,13 @@ "<qt><strong>फ़ाइल त्रुटि!</strong> फ़ाइल <nobr><strong>%1</strong> </nobr>को " "असंपीडित नहीं किया जा सकता. फ़ाइल को लोड नहीं किया जा सका.</qt>" -#: part.cpp:2737 +#: part.cpp:2750 msgid "" "<qt>This error typically occurs if the file is corrupt. If you want to be " "sure, try to decompress the file manually using command-line tools.</qt>" msgstr "" -#: part.cpp:2766 +#: part.cpp:2779 msgid "No Bookmarks" msgstr "कोई पसंदीदा नहीं" @@ -2117,51 +2117,51 @@ msgid "Main Toolbar" msgstr "मुख्य औज़ार पट्टी" -#: shell/main.cpp:55 +#: shell/main.cpp:127 msgid "Page of the document to be shown" msgstr "दिखाए जाने वाले दस्तावेज़ का पृष्ठ" -#: shell/main.cpp:56 +#: shell/main.cpp:128 msgid "Start the document in presentation mode" msgstr "दस्तावेज को प्रस्तुतीकरण मोड में प्रारंभ करें" -#: shell/main.cpp:57 +#: shell/main.cpp:129 msgid "Start with print dialog" msgstr "" -#: shell/main.cpp:58 +#: shell/main.cpp:130 msgid "\"Unique instance\" control" msgstr "" -#: shell/main.cpp:59 +#: shell/main.cpp:131 msgid "Not raise window" msgstr "" -#: shell/main.cpp:60 +#: shell/main.cpp:132 msgid "Document to open. Specify '-' to read from stdin." msgstr "" -#: shell/main.cpp:87 +#: shell/main.cpp:154 msgid "Error: Can't open more than one document with the --unique switch" msgstr "" -#: shell/shell.cpp:91 shell/shell.cpp:146 +#: shell/shell.cpp:92 shell/shell.cpp:144 #, fuzzy #| msgid "Unable to find okular part." msgid "Unable to find the Okular component." msgstr "ऑकुलर पार्ट ढूंढ पाने में अक्षम." -#: shell/shell.cpp:132 +#: shell/shell.cpp:130 msgid "" "There is already a unique Okular instance running. This instance won't be " "the unique one." msgstr "" -#: shell/shell.cpp:184 +#: shell/shell.cpp:219 msgid "Can't open more than one document in the unique Okular instance." msgstr "" -#: shell/shell.cpp:272 +#: shell/shell.cpp:307 msgid "" "Click to open a file\n" "Click and hold to open a recent file" @@ -2169,32 +2169,32 @@ "किसी फ़ाइल को खोलने के लिए क्लिक करें\n" "किसी हालिया फ़ाइल को खोलने के लिए क्लिक कर दबाए रखें" -#: shell/shell.cpp:273 +#: shell/shell.cpp:308 msgid "" "<b>Click</b> to open a file or <b>Click and hold</b> to select a recent file" msgstr "" "किसी फ़ाइल को खोलने के लिए <b>क्लिक</b> करें या फिर किसी हालिया फ़ाइल को चुनने के लिए " "<b>क्लिक कर दबाए रखें</b>" -#: shell/shell.cpp:286 +#: shell/shell.cpp:321 #, fuzzy #| msgid "Next Page" msgid "Next Tab" msgstr "अगला पृष्ठ" -#: shell/shell.cpp:292 +#: shell/shell.cpp:327 #, fuzzy #| msgid "Previous Page" msgid "Previous Tab" msgstr "पिछला पृष्ठ" -#: shell/shell.cpp:365 ui/formwidgets.cpp:617 +#: shell/shell.cpp:400 ui/formwidgets.cpp:617 #, fuzzy #| msgid "*|All files" msgid "*|All Files" msgstr "*|सभी फ़ाइलें" -#: shell/shell.cpp:368 +#: shell/shell.cpp:403 #, fuzzy #| msgid "Open a document" msgid "Open Document" @@ -2884,119 +2884,119 @@ msgid "of" msgstr "का" -#: ui/pageview.cpp:432 +#: ui/pageview.cpp:431 msgid "Zoom" msgstr "ज़ूम" -#: ui/pageview.cpp:452 +#: ui/pageview.cpp:451 #, fuzzy #| msgid "Rotate Right" msgid "Rotate &Right" msgstr "दाएँ मुड़ें" -#: ui/pageview.cpp:453 +#: ui/pageview.cpp:452 #, fuzzy #| msgid "Wipe Right" msgctxt "Rotate right" msgid "Right" msgstr "दायीं तरफ से मिटाएँ" -#: ui/pageview.cpp:457 +#: ui/pageview.cpp:456 #, fuzzy #| msgid "Rotate Left" msgid "Rotate &Left" msgstr "बाएँ मुड़ें" -#: ui/pageview.cpp:458 +#: ui/pageview.cpp:457 #, fuzzy #| msgid "Wipe Left" msgctxt "Rotate left" msgid "Left" msgstr "बायीं तरफ से मिटाएँ" -#: ui/pageview.cpp:462 +#: ui/pageview.cpp:461 msgid "Original Orientation" msgstr "मूल दिशा" -#: ui/pageview.cpp:467 +#: ui/pageview.cpp:466 msgid "&Page Size" msgstr "पृष्ठ आकार (&P)" -#: ui/pageview.cpp:474 +#: ui/pageview.cpp:473 msgid "&Trim Margins" msgstr "" -#: ui/pageview.cpp:479 +#: ui/pageview.cpp:478 msgid "Fit &Width" msgstr "चौड़ाई में फिट करें (&W)" -#: ui/pageview.cpp:483 +#: ui/pageview.cpp:482 msgid "Fit &Page" msgstr "पृष्ठ में फिट करें (&P)" -#: ui/pageview.cpp:487 +#: ui/pageview.cpp:486 msgid "&Auto Fit" msgstr "" -#: ui/pageview.cpp:492 +#: ui/pageview.cpp:491 msgid "&View Mode" msgstr "दृश्य मोड (&V)" -#: ui/pageview.cpp:505 +#: ui/pageview.cpp:504 msgid "Single Page" msgstr "एकल पृष्ठ" -#: ui/pageview.cpp:506 +#: ui/pageview.cpp:505 #, fuzzy #| msgid "Facing Pages" msgid "Facing Pages" msgstr "आमने सामने के पृष्ठ" -#: ui/pageview.cpp:507 +#: ui/pageview.cpp:506 #, fuzzy #| msgid "Center &first page" msgid "Facing Pages (Center First Page)" msgstr "प्रथम पृष्ठ बीचोंबीच करें (&f)" -#: ui/pageview.cpp:508 +#: ui/pageview.cpp:507 msgid "Overview" msgstr "ओवरव्यू" -#: ui/pageview.cpp:520 +#: ui/pageview.cpp:519 msgid "&Continuous" msgstr "लगातार (&C)" -#: ui/pageview.cpp:528 +#: ui/pageview.cpp:527 msgid "&Browse Tool" msgstr "ब्राउज़ औज़ार (&B)" -#: ui/pageview.cpp:531 +#: ui/pageview.cpp:530 msgctxt "Browse Tool" msgid "Browse" msgstr "ब्राउज़" -#: ui/pageview.cpp:537 +#: ui/pageview.cpp:536 msgid "&Zoom Tool" msgstr "ज़ूम औज़ार (&Z)" -#: ui/pageview.cpp:540 +#: ui/pageview.cpp:539 msgctxt "Zoom Tool" msgid "Zoom" msgstr "ज़ूम" -#: ui/pageview.cpp:546 +#: ui/pageview.cpp:545 #, fuzzy #| msgid "Change &Colors" msgid "&Toggle Change Colors" msgstr "रंग बदलें (&C)" -#: ui/pageview.cpp:560 +#: ui/pageview.cpp:559 #, fuzzy #| msgid "Selection Tools" msgid "&Selection Tool" msgstr "चयन औज़ार" -#: ui/pageview.cpp:563 +#: ui/pageview.cpp:562 #, fuzzy #| msgctxt "Select Tool" #| msgid "Select" @@ -3004,22 +3004,22 @@ msgid "Selection" msgstr "चुनें" -#: ui/pageview.cpp:569 +#: ui/pageview.cpp:568 msgid "&Text Selection Tool" msgstr "पाठ चयन औजार (&T)" -#: ui/pageview.cpp:572 +#: ui/pageview.cpp:571 msgctxt "Text Selection Tool" msgid "Text Selection" msgstr "पाठ चयन" -#: ui/pageview.cpp:578 +#: ui/pageview.cpp:577 #, fuzzy #| msgid "Selection Tools" msgid "T&able Selection Tool" msgstr "चयन औज़ार" -#: ui/pageview.cpp:581 +#: ui/pageview.cpp:580 #, fuzzy #| msgctxt "Text Selection Tool" #| msgid "Text Selection" @@ -3027,169 +3027,169 @@ msgid "Table Selection" msgstr "पाठ चयन" -#: ui/pageview.cpp:587 +#: ui/pageview.cpp:586 msgid "&Magnifier" msgstr "" -#: ui/pageview.cpp:590 +#: ui/pageview.cpp:589 msgctxt "Magnifier Tool" msgid "Magnifier" msgstr "" -#: ui/pageview.cpp:596 +#: ui/pageview.cpp:595 msgid "&Review" msgstr "समीक्षा (&R)" -#: ui/pageview.cpp:609 +#: ui/pageview.cpp:608 #, fuzzy #| msgid "Open a document" msgid "Speak Whole Document" msgstr "दस्तावेज़ खोलें" -#: ui/pageview.cpp:614 +#: ui/pageview.cpp:613 msgid "Speak Current Page" msgstr "" -#: ui/pageview.cpp:619 +#: ui/pageview.cpp:618 msgid "Stop Speaking" msgstr "" -#: ui/pageview.cpp:625 +#: ui/pageview.cpp:624 msgid "Scroll Up" msgstr "ऊपर स्क्रॉल करें" -#: ui/pageview.cpp:631 +#: ui/pageview.cpp:630 msgid "Scroll Down" msgstr "नीचे स्क्रॉल करें" -#: ui/pageview.cpp:637 +#: ui/pageview.cpp:636 #, fuzzy #| msgid "Scroll Up" msgid "Scroll Page Up" msgstr "ऊपर स्क्रॉल करें" -#: ui/pageview.cpp:643 +#: ui/pageview.cpp:642 #, fuzzy #| msgid "Scroll Down" msgid "Scroll Page Down" msgstr "नीचे स्क्रॉल करें" -#: ui/pageview.cpp:980 +#: ui/pageview.cpp:979 #, kde-format msgid " Loaded a one-page document." msgid_plural " Loaded a %1-page document." msgstr[0] "%1 पृष्ठ का दस्तावेज़ लोड किया गया." msgstr[1] "%1 पृष्ठ का दस्तावेज़ लोड किया गया." -#: ui/pageview.cpp:2424 +#: ui/pageview.cpp:2423 msgid "Follow This Link" msgstr "इस लिंक पर जाएँ" -#: ui/pageview.cpp:2427 +#: ui/pageview.cpp:2426 #, fuzzy #| msgid "Sold" msgid "Stop Sound" msgstr "बिक गया" -#: ui/pageview.cpp:2430 +#: ui/pageview.cpp:2429 msgid "Copy Link Address" msgstr "" -#: ui/pageview.cpp:2579 +#: ui/pageview.cpp:2578 #, kde-format msgid "Text (1 character)" msgid_plural "Text (%1 characters)" msgstr[0] "पाठ (%1 अक्षर)" msgstr[1] "पाठ (%1 अक्षर)" -#: ui/pageview.cpp:2580 ui/pageview.cpp:2595 +#: ui/pageview.cpp:2579 ui/pageview.cpp:2594 msgid "Copy to Clipboard" msgstr "क्लिपबोर्ड पर नकल बनाएं" -#: ui/pageview.cpp:2585 ui/pageview.cpp:2736 ui/pageview.cpp:2843 +#: ui/pageview.cpp:2584 ui/pageview.cpp:2735 ui/pageview.cpp:2842 msgid "Copy forbidden by DRM" msgstr "डीआरएम द्वारा नक़ल किया जाना प्रतिबंधित है" -#: ui/pageview.cpp:2588 ui/pageview.cpp:2839 +#: ui/pageview.cpp:2587 ui/pageview.cpp:2838 msgid "Speak Text" msgstr "पाठ बोलें" -#: ui/pageview.cpp:2594 +#: ui/pageview.cpp:2593 #, kde-format msgid "Image (%1 by %2 pixels)" msgstr "छवि (%1 x %2 पिक्सेल्स)" -#: ui/pageview.cpp:2596 +#: ui/pageview.cpp:2595 msgid "Save to File..." msgstr "फ़ाइल में सहेजें..." -#: ui/pageview.cpp:2618 +#: ui/pageview.cpp:2617 #, kde-format msgid "Image [%1x%2] copied to clipboard." msgstr "छवि [%1x%2] क्लिपबोर्ड पर नक़ल किया गया." -#: ui/pageview.cpp:2626 +#: ui/pageview.cpp:2625 msgid "File not saved." msgstr "फ़ाइल को सहेजा नहीं गया." -#: ui/pageview.cpp:2636 +#: ui/pageview.cpp:2635 #, kde-format msgid "Image [%1x%2] saved to %3 file." msgstr "छवि [%1x%2] को %3 फ़ाइल में सहेजा." -#: ui/pageview.cpp:2835 +#: ui/pageview.cpp:2834 msgid "Copy Text" msgstr "पाठ की नक़ल बनाएं" -#: ui/pageview.cpp:2853 +#: ui/pageview.cpp:2852 #, fuzzy, kde-format #| msgid "Go to page %1" msgid "Go to '%1'" msgstr "पृष्ठ %1 पर जाएं" -#: ui/pageview.cpp:3945 +#: ui/pageview.cpp:3924 msgid "Hide Forms" msgstr "फ़ॉर्म छुपाएँ" -#: ui/pageview.cpp:3949 +#: ui/pageview.cpp:3928 msgid "Show Forms" msgstr "फ़ॉर्म दिखाएँ" -#: ui/pageview.cpp:3998 +#: ui/pageview.cpp:3977 #, fuzzy, kde-format #| msgid "Searching for %1" msgid "Search for '%1' with" msgstr "%1 के लिए ढूंढा जा रहा है" -#: ui/pageview.cpp:4013 +#: ui/pageview.cpp:3992 #, fuzzy #| msgid "Configure Viewer..." msgid "Configure Web Shortcuts..." msgstr "प्रदर्शक कॉन्फ़िगर करें..." -#: ui/pageview.cpp:4503 +#: ui/pageview.cpp:4482 msgid "Welcome" msgstr "सुस्वागतम" -#: ui/pageview.cpp:4607 +#: ui/pageview.cpp:4586 msgid "Select zooming area. Right-click to zoom out." msgstr "जूमिंग क्षेत्र चुनें. ज़ूम-आउट होने के लिए क्लिक करें." -#: ui/pageview.cpp:4622 +#: ui/pageview.cpp:4601 msgid "Click to see the magnified view." msgstr "" -#: ui/pageview.cpp:4633 +#: ui/pageview.cpp:4612 msgid "Draw a rectangle around the text/graphics to copy." msgstr "नक़ल करने के लिए पाठ/चित्र के चारों ओर एक आयताकार बनाएँ." -#: ui/pageview.cpp:4649 +#: ui/pageview.cpp:4628 #, fuzzy #| msgid "Select text." msgid "Select text" msgstr "पाठ चुनें." -#: ui/pageview.cpp:4666 +#: ui/pageview.cpp:4645 #, fuzzy #| msgid "Draw a rectangle around the text/graphics to copy." msgid "" @@ -3197,11 +3197,11 @@ "Esc to clear." msgstr "नक़ल करने के लिए पाठ/चित्र के चारों ओर एक आयताकार बनाएँ." -#: ui/pageview.cpp:4703 +#: ui/pageview.cpp:4682 msgid "Annotations author" msgstr "एन्नोटेशन लेखक" -#: ui/pageview.cpp:4704 +#: ui/pageview.cpp:4683 msgid "Please insert your name or initials:" msgstr "कृपया अपना नाम या आद्याक्षर भरें:" @@ -3569,25 +3569,25 @@ msgid "Show reviews for current page only" msgstr "सिर्फ वर्तमान पृष्ठ के लिए रीव्यू दिखाएं" -#: ui/sidebar.cpp:705 +#: ui/sidebar.cpp:706 msgid "Show Text" msgstr "पाठ दिखाएँ" -#: ui/sidebar.cpp:721 +#: ui/sidebar.cpp:722 msgid "Small Icons" msgstr "" -#: ui/sidebar.cpp:722 +#: ui/sidebar.cpp:723 msgid "Normal Icons" msgstr "" -#: ui/sidebar.cpp:723 +#: ui/sidebar.cpp:724 #, fuzzy #| msgid "Icon" msgid "Large Icons" msgstr "प्रतीक" -#: ui/thumbnaillist.cpp:1008 +#: ui/thumbnaillist.cpp:991 msgid "Show bookmarked pages only" msgstr "सिर्फ पसंदीदा पृष्ठों को ही दिखाएँ" diff -Nru kde-l10n-hi-4.12.97/messages/kdelibs/kio4.po kde-l10n-hi-4.13.0/messages/kdelibs/kio4.po --- kde-l10n-hi-4.12.97/messages/kdelibs/kio4.po 2014-03-24 03:37:15.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kdelibs/kio4.po 2014-03-28 04:11:32.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kio4\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-24 01:42+0000\n" +"POT-Creation-Date: 2014-03-28 02:03+0000\n" "PO-Revision-Date: 2007-11-17 17:50+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -3517,7 +3517,7 @@ msgstr "फ़ोल्डर पहले से ही अस्तित्व में है" #: kio/copyjob.cpp:1399 kio/copyjob.cpp:1982 kio/global.cpp:669 -#: kio/job.cpp:2234 kio/paste.cpp:101 +#: kio/job.cpp:2239 kio/paste.cpp:101 msgid "File Already Exists" msgstr "फ़ाइल पहले से ही अस्तित्व में है. " diff -Nru kde-l10n-hi-4.12.97/messages/kdepim/calendarsupport.po kde-l10n-hi-4.13.0/messages/kdepim/calendarsupport.po --- kde-l10n-hi-4.12.97/messages/kdepim/calendarsupport.po 2013-12-31 03:10:49.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kdepim/calendarsupport.po 2014-03-30 04:23:56.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: korganizer\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-12-31 01:32+0000\n" +"POT-Creation-Date: 2014-03-30 02:00+0000\n" "PO-Revision-Date: 2008-01-24 16:52+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -260,34 +260,34 @@ msgid "The archive file name is not valid." msgstr "अभिलेख फ़ाइल का नाम वैध नहीं है.\n" -#: attachmenthandler.cpp:101 +#: attachmenthandler.cpp:104 #, kde-format msgid "No attachment named \"%1\" found in the incidence." msgstr "" -#: attachmenthandler.cpp:109 +#: attachmenthandler.cpp:112 #, kde-format msgid "" "The attachment \"%1\" is a web link that is inaccessible from this computer. " msgstr "" -#: attachmenthandler.cpp:128 +#: attachmenthandler.cpp:131 msgid "" "The calendar invitation stored in this email message is broken in some way. " "Unable to continue." msgstr "" -#: attachmenthandler.cpp:182 attachmenthandler.cpp:244 +#: attachmenthandler.cpp:185 attachmenthandler.cpp:247 msgid "Unable to create a temporary file for the attachment." msgstr "" -#: attachmenthandler.cpp:218 utils.cpp:722 +#: attachmenthandler.cpp:221 utils.cpp:722 #, fuzzy #| msgid "Remove Attachments" msgid "Save Attachment" msgstr "संलग्नक निकालें" -#: attachmenthandler.cpp:223 +#: attachmenthandler.cpp:226 #, fuzzy, kde-format #| msgid "" #| "A template with that name already exists, do you want to overwrite it?." diff -Nru kde-l10n-hi-4.12.97/messages/kdepim/kleopatra.po kde-l10n-hi-4.13.0/messages/kdepim/kleopatra.po --- kde-l10n-hi-4.12.97/messages/kdepim/kleopatra.po 2013-12-19 03:27:50.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kdepim/kleopatra.po 2014-04-09 07:38:27.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kleopatra\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-12-19 01:33+0000\n" +"POT-Creation-Date: 2014-04-09 06:30+0000\n" "PO-Revision-Date: 2008-01-19 13:17+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -460,7 +460,7 @@ "%1</b></p></qt>" msgstr "<qt><p>प्रमाणपत्र:</p><p><b>%1</b> को मिटाने के दौरान एक त्रुटि हुई</p></qt>" -#: commands/dumpcertificatecommand.cpp:90 commands/dumpcrlcachecommand.cpp:87 +#: commands/dumpcertificatecommand.cpp:90 commands/dumpcrlcachecommand.cpp:108 #, fuzzy #| msgid "&Update" msgctxt "@action:button Update the log text widget" @@ -474,7 +474,7 @@ msgstr "प्रमाणपत्र उपयोग" #: commands/dumpcertificatecommand.cpp:285 -#: commands/dumpcrlcachecommand.cpp:247 +#: commands/dumpcrlcachecommand.cpp:268 #, fuzzy #| msgid "Unable to start %1 process. Please check your installation." msgid "Unable to start process gpgsm. Please check your installation." @@ -510,27 +510,27 @@ "कुंजियाँ ताज़ा करने की कोशिश में एक त्रुटि हुई:\n" "%1" -#: commands/dumpcrlcachecommand.cpp:227 +#: commands/dumpcrlcachecommand.cpp:248 #, fuzzy #| msgid "CRL cache dump:" msgid "CRL Cache Dump" msgstr "सीआरएल कैश डम्प:" -#: commands/dumpcrlcachecommand.cpp:249 commands/dumpcrlcachecommand.cpp:272 -#: commands/dumpcrlcachecommand.cpp:277 +#: commands/dumpcrlcachecommand.cpp:270 commands/dumpcrlcachecommand.cpp:293 +#: commands/dumpcrlcachecommand.cpp:298 #, fuzzy #| msgid "Dump CRL Cache..." msgid "Dump CRL Cache Error" msgstr "सीआरएल कैश डम्प करें..." -#: commands/dumpcrlcachecommand.cpp:269 +#: commands/dumpcrlcachecommand.cpp:290 msgid "" "The GpgSM process that tried to dump the CRL cache ended prematurely because " "of an unexpected error. Please check the output of gpgsm --call-dirmngr " "listcrls for details." msgstr "" -#: commands/dumpcrlcachecommand.cpp:275 +#: commands/dumpcrlcachecommand.cpp:296 #, fuzzy, kde-format #| msgid "" #| "An error occurred while trying to refresh keys:\n" @@ -1750,7 +1750,7 @@ "to be checksummed, not a mixture of both." msgstr "" -#: crypto/createchecksumscontroller.cpp:302 mainwindow_desktop.cpp:495 +#: crypto/createchecksumscontroller.cpp:302 mainwindow_desktop.cpp:500 #, fuzzy #| msgid "Canceled." msgid "Cancel" @@ -3117,7 +3117,7 @@ msgid "This is how the new User-ID will be stored in the certificate:" msgstr "" -#: dialogs/certificatedetailsdialog.cpp:249 +#: dialogs/certificatedetailsdialog.cpp:265 #, fuzzy, kde-format #| msgid "" #| "<qt><p>An error occurred while trying to delete the certificate:</p><p><b>" @@ -3128,31 +3128,31 @@ "message></para>" msgstr "<qt><p>प्रमाणपत्र:</p><p><b>%1</b> को मिटाने के दौरान एक त्रुटि हुई</p></qt>" -#: dialogs/certificatedetailsdialog.cpp:252 +#: dialogs/certificatedetailsdialog.cpp:268 #, fuzzy #| msgid "Certificate Listing Failed" msgctxt "@title" msgid "Certifications Loading Failed" msgstr "प्रमाणपत्र सूची बनाने में असफल" -#: dialogs/certificatedetailsdialog.cpp:275 +#: dialogs/certificatedetailsdialog.cpp:291 msgid "Please wait while generating the dump..." msgstr "" -#: dialogs/certificatedetailsdialog.cpp:353 +#: dialogs/certificatedetailsdialog.cpp:369 msgid "(please wait while certifications are being loaded)" msgstr "" -#: dialogs/certificatedetailsdialog.cpp:354 +#: dialogs/certificatedetailsdialog.cpp:370 msgid "Load Certifications (may take a while)" msgstr "" -#: dialogs/certificatedetailsdialog.cpp:380 +#: dialogs/certificatedetailsdialog.cpp:396 #, fuzzy, kde-format msgid "Issuer Certificate Not Found (%1)" msgstr "जारीकर्ता प्रमाणपत्र नहीं मिला ( %1)" -#: dialogs/certificatedetailsdialog.cpp:437 +#: dialogs/certificatedetailsdialog.cpp:453 #, fuzzy #| msgid "New subkeys:" msgctxt "@title" @@ -3477,17 +3477,17 @@ msgid "Certify Certificate: %1" msgstr "सीए प्रमाणपत्र मिटाया जा रहा है" -#: dialogs/deletecertificatesdialog.cpp:94 +#: dialogs/deletecertificatesdialog.cpp:112 msgid "These are the certificates you have selected for deletion:" msgstr "" -#: dialogs/deletecertificatesdialog.cpp:96 +#: dialogs/deletecertificatesdialog.cpp:114 msgid "" "These certificates will be deleted even though you did <emphasis>not</" "emphasis><nl/> explicitly select them (<a href=\"whatsthis://\">Why?</a>):" msgstr "" -#: dialogs/deletecertificatesdialog.cpp:117 +#: dialogs/deletecertificatesdialog.cpp:135 msgctxt "@info:whatsthis" msgid "" "<title>Why do you want to delete more certificates than I selected?</" @@ -3500,14 +3500,14 @@ "contents, too.</para>" msgstr "" -#: dialogs/deletecertificatesdialog.cpp:129 +#: dialogs/deletecertificatesdialog.cpp:147 #, fuzzy #| msgid "Delete" msgctxt "@action:button" msgid "Delete" msgstr "मिटाएँ" -#: dialogs/deletecertificatesdialog.cpp:189 +#: dialogs/deletecertificatesdialog.cpp:210 msgid "" "The certificate to be deleted is your own. It contains private key material, " "which is needed to decrypt past communication encrypted to the certificate, " @@ -3519,7 +3519,7 @@ msgstr[0] "" msgstr[1] "" -#: dialogs/deletecertificatesdialog.cpp:203 +#: dialogs/deletecertificatesdialog.cpp:224 msgid "" "One of the certificates to be deleted is your own. It contains private key " "material, which is needed to decrypt past communication encrypted to the " @@ -3531,7 +3531,7 @@ msgstr[0] "" msgstr[1] "" -#: dialogs/deletecertificatesdialog.cpp:218 +#: dialogs/deletecertificatesdialog.cpp:239 #, fuzzy #| msgid "Secret Key Export" msgid "Secret Key Deletion" @@ -3658,7 +3658,7 @@ msgid "ASCII armor" msgstr "" -#: dialogs/lookupcertificatesdialog.cpp:117 +#: dialogs/lookupcertificatesdialog.cpp:119 #, fuzzy #| msgid "Imported:" msgid "Import" @@ -4346,7 +4346,7 @@ #. i18n: ectx: Menu (certMenu) #. i18n: ectx: Menu (listview_popup) -#: kleopatra.rc:36 kleopatra.rc:102 +#: kleopatra.rc:36 kleopatra.rc:97 msgid "&Certificates" msgstr "प्रमाणपत्र (&C)" @@ -4377,11 +4377,6 @@ msgid "Main Toolbar" msgstr "ढूंढने के लिए औज़ार पट्टी" -#. i18n: ectx: ToolBar (searchToolBar) -#: kleopatra.rc:97 -msgid "Search Toolbar" -msgstr "ढूंढने के लिए औज़ार पट्टी" - #: kleopatraapplication.cpp:95 msgid "Run UI server only, hide main window" msgstr "" @@ -4685,28 +4680,28 @@ "present might not work correctly, or at all.</qt>" msgstr "" -#: mainwindow_desktop.cpp:116 mainwindow_mobile.cpp:140 +#: mainwindow_desktop.cpp:117 mainwindow_mobile.cpp:140 #, kde-format msgctxt "Quit [ApplicationName]" msgid "&Quit %1" msgstr "" -#: mainwindow_desktop.cpp:122 mainwindow_mobile.cpp:146 +#: mainwindow_desktop.cpp:123 mainwindow_mobile.cpp:146 msgid "Only &Close Window" msgstr "" -#: mainwindow_desktop.cpp:156 +#: mainwindow_desktop.cpp:157 #, kde-format msgid "" "%1 may be used by other applications as a service.\n" "You may instead want to close this window without exiting %1." msgstr "" -#: mainwindow_desktop.cpp:158 +#: mainwindow_desktop.cpp:159 msgid "Really Quit?" msgstr "" -#: mainwindow_desktop.cpp:186 mainwindow_mobile.cpp:192 +#: mainwindow_desktop.cpp:187 mainwindow_mobile.cpp:192 #, fuzzy #| msgid "" #| "Could not start GnuPG LogViewer (kwatchgnupg). Please check your " @@ -4717,13 +4712,13 @@ msgstr "" "ग्नू-पीजी लॉग-प्रदर्शक प्रारंभ नहीं कर पाया (kwatchgnupg). कृपया अपनी संस्थापना जाँचें." -#: mainwindow_desktop.cpp:188 mainwindow_mobile.cpp:194 +#: mainwindow_desktop.cpp:189 mainwindow_mobile.cpp:194 #, fuzzy #| msgid "Configure &GpgME Backend" msgid "Error Starting KWatchGnuPG" msgstr "जीपीजी-एमई बैकएण्ड कॉन्फ़िगर करें (&G)" -#: mainwindow_desktop.cpp:193 mainwindow_mobile.cpp:199 +#: mainwindow_desktop.cpp:194 mainwindow_mobile.cpp:199 #, fuzzy #| msgid "" #| "Could not start GnuPG LogViewer (kwatchgnupg). Please check your " @@ -4734,69 +4729,69 @@ msgstr "" "ग्नू-पीजी लॉग-प्रदर्शक प्रारंभ नहीं कर पाया (kwatchgnupg). कृपया अपनी संस्थापना जाँचें." -#: mainwindow_desktop.cpp:195 mainwindow_mobile.cpp:201 +#: mainwindow_desktop.cpp:196 mainwindow_mobile.cpp:201 msgid "Error Starting KGpgConf" msgstr "" -#: mainwindow_desktop.cpp:304 +#: mainwindow_desktop.cpp:309 #, fuzzy #| msgid "GnuPG Log Viewer..." msgid "GnuPG Log Viewer" msgstr "ग्नूपीजी लॉग प्रदर्शक..." -#: mainwindow_desktop.cpp:308 +#: mainwindow_desktop.cpp:313 msgid "GnuPG Administrative Console" msgstr "" -#: mainwindow_desktop.cpp:313 +#: mainwindow_desktop.cpp:318 #, fuzzy #| msgid "Configure &GpgME Backend" msgid "Configure GnuPG Backend..." msgstr "जीपीजी-एमई बैकएण्ड कॉन्फ़िगर करें (&G)" -#: mainwindow_desktop.cpp:317 mainwindow_mobile.cpp:267 +#: mainwindow_desktop.cpp:322 mainwindow_mobile.cpp:267 msgid "Perform Self-Test" msgstr "" -#: mainwindow_desktop.cpp:321 +#: mainwindow_desktop.cpp:326 msgid "About Gpg4win" msgstr "" -#: mainwindow_desktop.cpp:349 +#: mainwindow_desktop.cpp:354 msgid "Could not configure the cryptography backend (gpgconf tool not found)" msgstr "" -#: mainwindow_desktop.cpp:349 +#: mainwindow_desktop.cpp:354 msgid "Configuration Error" msgstr "" -#: mainwindow_desktop.cpp:381 mainwindow_mobile.cpp:334 +#: mainwindow_desktop.cpp:386 mainwindow_mobile.cpp:334 msgid "" "There are still some background operations ongoing. These will be terminated " "when closing the window. Proceed?" msgstr "" -#: mainwindow_desktop.cpp:384 mainwindow_mobile.cpp:337 +#: mainwindow_desktop.cpp:389 mainwindow_mobile.cpp:337 msgid "Ongoing Background Tasks" msgstr "" -#: mainwindow_desktop.cpp:482 +#: mainwindow_desktop.cpp:487 msgid "Sign/Encrypt..." msgstr "" -#: mainwindow_desktop.cpp:483 systrayicon.cpp:185 +#: mainwindow_desktop.cpp:488 systrayicon.cpp:185 #, fuzzy #| msgid "Deleting keys..." msgid "Decrypt/Verify..." msgstr "कुंजियाँ मिटाई जा रही हैं..." -#: mainwindow_desktop.cpp:487 +#: mainwindow_desktop.cpp:492 #, fuzzy #| msgid "Import Certificates..." msgid "Import Certificates" msgstr "प्रमाणपत्र आयात करें..." -#: mainwindow_desktop.cpp:488 +#: mainwindow_desktop.cpp:493 #, fuzzy #| msgid "Import CRLs..." msgid "Import CRLs" @@ -7095,10 +7090,6 @@ msgid "Open a new tab" msgstr "" -#: view/tabwidget.cpp:389 -msgid "CTRL+SHIFT+N" -msgstr "" - #: view/tabwidget.cpp:395 msgid "Rename Tab..." msgstr "" @@ -7107,10 +7098,6 @@ msgid "Rename this tab" msgstr "" -#: view/tabwidget.cpp:396 -msgid "CTRL+SHIFT+R" -msgstr "" - #: view/tabwidget.cpp:397 msgid "Duplicate Tab" msgstr "" @@ -7119,10 +7106,6 @@ msgid "Duplicate this tab" msgstr "" -#: view/tabwidget.cpp:398 -msgid "CTRL+SHIFT+D" -msgstr "" - #: view/tabwidget.cpp:399 msgid "Close Tab" msgstr "" @@ -7131,48 +7114,31 @@ msgid "Close this tab" msgstr "" -#: view/tabwidget.cpp:400 -msgid "CTRL+SHIFT+W" -msgstr "" - #: view/tabwidget.cpp:401 msgid "Move Tab Left" msgstr "" -#: view/tabwidget.cpp:402 -msgid "CTRL+SHIFT+LEFT" -msgstr "" - #: view/tabwidget.cpp:403 msgid "Move Tab Right" msgstr "" -#: view/tabwidget.cpp:404 -msgid "CTRL+SHIFT+RIGHT" -msgstr "" - #: view/tabwidget.cpp:405 #, fuzzy #| msgid "Hierarchical Key List" msgid "Hierarchical Certificate List" msgstr "हियरार्चिकल कुंजी सूची" -#: view/tabwidget.cpp:408 -msgid "CTRL+." -msgstr "" - -#: view/tabwidget.cpp:410 -msgid "CTRL+," -msgstr "" - -#: view/tabwidget.cpp:535 +#: view/tabwidget.cpp:534 msgid "Rename Tab" msgstr "" -#: view/tabwidget.cpp:535 +#: view/tabwidget.cpp:534 msgid "New tab title:" msgstr "" +#~ msgid "Search Toolbar" +#~ msgstr "ढूंढने के लिए औज़ार पट्टी" + #, fuzzy #~| msgid "&Tools" #~ msgid "Tools" diff -Nru kde-l10n-hi-4.12.97/messages/kdepim/kmail.po kde-l10n-hi-4.13.0/messages/kdepim/kmail.po --- kde-l10n-hi-4.12.97/messages/kdepim/kmail.po 2014-03-26 03:45:43.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kdepim/kmail.po 2014-04-09 07:38:27.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kmail\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-26 01:50+0000\n" +"POT-Creation-Date: 2014-04-09 06:30+0000\n" "PO-Revision-Date: 2008-01-20 16:51+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -406,7 +406,7 @@ msgid "Post to List" msgstr "सूची में पोस्ट करें" -#: collectionpage/collectionmailinglistpage.cpp:145 messageactions.cpp:387 +#: collectionpage/collectionmailinglistpage.cpp:145 messageactions.cpp:375 msgid "Subscribe to List" msgstr "सूची में सब्सक्राइब करें" @@ -560,7 +560,7 @@ msgstr "" #: collectionpage/collectiontemplatespage.cpp:39 -#: identity/identitydialog.cpp:544 +#: identity/identitydialog.cpp:547 msgid "Templates" msgstr "प्रारूप" @@ -571,7 +571,7 @@ msgstr "मनपसंद संदेश टैम्प्लेट इस्तेमाल करें (&U)" #: collectionpage/collectiontemplatespage.cpp:79 -#: identity/identitydialog.cpp:529 +#: identity/identitydialog.cpp:532 msgid "&Copy Global Templates" msgstr "वैश्विक टैम्प्लेट्स नक़ल करें (&C)" @@ -2564,24 +2564,24 @@ msgid "Insert" msgstr "कमांड भरें..." -#: editor/kmcomposewin.cpp:3579 +#: editor/kmcomposewin.cpp:3580 #, fuzzy #| msgid "A critical error occurred. Processing stops here." msgid "An error occurred while sending the file." msgstr "एक गंभीर त्रुटि हुई. प्रक्रिया यहाँ बन्द होती है." -#: editor/kmcomposewin.cpp:3579 +#: editor/kmcomposewin.cpp:3580 #, fuzzy #| msgid "Load Profile" msgid "Upload file" msgstr "प्रोफ़ाइल लोड करें" -#: editor/kmcomposewin.cpp:3598 +#: editor/kmcomposewin.cpp:3599 #, kde-format msgid "%1 return an error '%2'" msgstr "" -#: editor/kmcomposewin.cpp:3598 +#: editor/kmcomposewin.cpp:3599 msgid "Error" msgstr "त्रुटि" @@ -2872,11 +2872,11 @@ msgid "Advanced" msgstr "विस्तृत (&A)" -#: identity/identitydialog.cpp:378 +#: identity/identitydialog.cpp:379 msgid "&Reply-To address:" msgstr "जवाब भेजने का पताः (&R)" -#: identity/identitydialog.cpp:381 +#: identity/identitydialog.cpp:382 msgid "" "<qt><h3>Reply-To addresses</h3><p>This sets the <tt>Reply-to:</tt> header to " "contain a different email address to the normal <tt>From:</tt> address.</" @@ -2886,13 +2886,13 @@ "address.</p><p>If in doubt, leave this field blank.</p></qt>" msgstr "" -#: identity/identitydialog.cpp:401 +#: identity/identitydialog.cpp:403 #, fuzzy #| msgid "&BCC addresses:" msgid "&CC addresses:" msgstr "बेनामी नक़ल पताः (&B)" -#: identity/identitydialog.cpp:404 +#: identity/identitydialog.cpp:406 msgid "" "<qt><h3>CC (Carbon Copy) addresses</h3><p>The addresses that you enter here " "will be added to each outgoing mail that is sent with this identity.</" @@ -2902,11 +2902,11 @@ "blank.</p></qt>" msgstr "" -#: identity/identitydialog.cpp:421 +#: identity/identitydialog.cpp:424 msgid "&BCC addresses:" msgstr "बेनामी नक़ल पताः (&B)" -#: identity/identitydialog.cpp:424 +#: identity/identitydialog.cpp:427 msgid "" "<qt><h3>BCC (Blind Carbon Copy) addresses</h3><p>The addresses that you " "enter here will be added to each outgoing mail that is sent with this " @@ -2916,74 +2916,74 @@ "list of BCC recipients.</p><p>If in doubt, leave this field blank.</p></qt>" msgstr "" -#: identity/identitydialog.cpp:440 +#: identity/identitydialog.cpp:443 msgid "D&ictionary:" msgstr "शब्दकोष (&i)" -#: identity/identitydialog.cpp:449 +#: identity/identitydialog.cpp:452 msgid "Sent-mail &folder:" msgstr "भेजी-डाक फ़ोल्डरः (&f)" -#: identity/identitydialog.cpp:458 +#: identity/identitydialog.cpp:461 msgid "&Drafts folder:" msgstr "मसौदा फ़ोल्डरः (&D)" -#: identity/identitydialog.cpp:467 +#: identity/identitydialog.cpp:470 msgid "&Templates folder:" msgstr "टैम्पलेट्स फ़ोल्डर: (&T)" -#: identity/identitydialog.cpp:473 +#: identity/identitydialog.cpp:476 #, fuzzy #| msgid "Configure Account" msgid "Outgoing Account:" msgstr "खाता कॉन्फ़िगर करें" -#: identity/identitydialog.cpp:482 +#: identity/identitydialog.cpp:485 #, fuzzy #| msgid "Add 'header' to message" msgid "Attach my vCard to message" msgstr "संदेश में 'हेडर' जोड़ें." -#: identity/identitydialog.cpp:484 identity/identitydialog.cpp:972 +#: identity/identitydialog.cpp:487 identity/identitydialog.cpp:975 #, fuzzy #| msgid "Rename..." msgid "Create..." msgstr "नाम बदलें..." -#: identity/identitydialog.cpp:492 +#: identity/identitydialog.cpp:495 #, fuzzy #| msgid "Choose &language:" msgid "Autocorrection language:" msgstr "भाषा चुनें: (&l)" -#: identity/identitydialog.cpp:512 +#: identity/identitydialog.cpp:515 #, fuzzy #| msgid "&Use custom message templates" msgid "&Use custom message templates for this identity" msgstr "मनपसंद संदेश टैम्प्लेट इस्तेमाल करें (&U)" -#: identity/identitydialog.cpp:552 +#: identity/identitydialog.cpp:555 msgid "Signature" msgstr "हस्ताक्षर" -#: identity/identitydialog.cpp:561 +#: identity/identitydialog.cpp:564 #, fuzzy #| msgid "&Picture" msgid "Picture" msgstr "चित्र: (&P)" -#: identity/identitydialog.cpp:646 +#: identity/identitydialog.cpp:649 #, fuzzy, kde-format #| msgid "Invalid Email Address" msgid "Invalid Email Alias \"%1\"" msgstr "अवैध ई-मेल पता" -#: identity/identitydialog.cpp:655 job/addressvalidationjob.cpp:84 +#: identity/identitydialog.cpp:658 job/addressvalidationjob.cpp:84 #: job/addressvalidationjob.cpp:93 msgid "Invalid Email Address" msgstr "अवैध ई-मेल पता" -#: identity/identitydialog.cpp:690 +#: identity/identitydialog.cpp:693 #, kde-format msgid "" "One of the configured OpenPGP signing keys does not contain any user ID with " @@ -2992,14 +2992,14 @@ "verify signatures made with this configuration." msgstr "" -#: identity/identitydialog.cpp:698 +#: identity/identitydialog.cpp:701 #, kde-format msgid "" "One of the configured OpenPGP encryption keys does not contain any user ID " "with the configured email address for this identity (%1)." msgstr "" -#: identity/identitydialog.cpp:704 +#: identity/identitydialog.cpp:707 #, kde-format msgid "" "One of the configured S/MIME signing certificates does not contain the " @@ -3008,48 +3008,48 @@ "verify signatures made with this configuration." msgstr "" -#: identity/identitydialog.cpp:712 +#: identity/identitydialog.cpp:715 #, kde-format msgid "" "One of the configured S/MIME encryption certificates does not contain the " "configured email address for this identity (%1)." msgstr "" -#: identity/identitydialog.cpp:720 +#: identity/identitydialog.cpp:723 msgid "Email Address Not Found in Key/Certificates" msgstr "ई-मेल पता जो कुंजी/प्रमाणपत्र में नहीं मिला" -#: identity/identitydialog.cpp:735 +#: identity/identitydialog.cpp:738 msgid "The signature file is not valid" msgstr "हस्ताक्षर फ़ाइल वैध नहीं है" -#: identity/identitydialog.cpp:757 +#: identity/identitydialog.cpp:760 #, kde-format msgid "Edit Identity \"%1\"" msgstr "उपयोक्ता का संपादन करें \"%1\"" -#: identity/identitydialog.cpp:791 +#: identity/identitydialog.cpp:794 #, kde-format msgid "" "The custom sent-mail folder for identity \"%1\" does not exist (anymore); " "therefore, the default sent-mail folder will be used." msgstr "" -#: identity/identitydialog.cpp:803 +#: identity/identitydialog.cpp:806 #, kde-format msgid "" "The custom drafts folder for identity \"%1\" does not exist (anymore); " "therefore, the default drafts folder will be used." msgstr "" -#: identity/identitydialog.cpp:815 +#: identity/identitydialog.cpp:818 #, kde-format msgid "" "The custom templates folder for identity \"%1\" does not exist (anymore); " "therefore, the default templates folder will be used." msgstr "" -#: identity/identitydialog.cpp:974 +#: identity/identitydialog.cpp:977 msgid "Edit..." msgstr "संपादन..." @@ -3491,27 +3491,27 @@ msgid "Text Direction Toolbar" msgstr "" -#: kmkernel.cpp:608 +#: kmkernel.cpp:607 #, fuzzy, kde-format #| msgid "Are you sure you want to empty the trash folder?" msgid "Do you want to attach this folder \"%1\"?" msgstr "क्या आप वाक़ई रद्दी का फ़ोल्डर खाली करना चाहते हैं?" -#: kmkernel.cpp:608 +#: kmkernel.cpp:607 #, fuzzy #| msgid "New Folder" msgid "Attach Folder" msgstr "नया फ़ोल्डर" -#: kmkernel.cpp:920 +#: kmkernel.cpp:919 msgid "KMail is set to be offline; all network jobs are suspended" msgstr "केमेल को ऑफ़लाइन के रूप में सेट किया गया है, सभी नेटवर्क कार्य निलंबित हैं" -#: kmkernel.cpp:952 +#: kmkernel.cpp:951 msgid "KMail is set to be online; all network jobs resumed" msgstr "केमेल को ऑनलाइन के रूप में सेट किया गया है, सभी नेटवर्क कार्य फिर से चालू हैं" -#: kmkernel.cpp:955 +#: kmkernel.cpp:954 #, fuzzy #| msgid "KMail is set to be online; all network jobs resumed" msgid "" @@ -3519,48 +3519,48 @@ "connection is detected" msgstr "केमेल को ऑनलाइन के रूप में सेट किया गया है, सभी नेटवर्क कार्य फिर से चालू हैं" -#: kmkernel.cpp:1012 +#: kmkernel.cpp:1011 msgid "KMail is currently in offline mode. How do you want to proceed?" msgstr "केमेल अभी ऑफ़लाइन मोड में है. आप किस तरह आगे बढ़ना चाहते हैं?" -#: kmkernel.cpp:1014 +#: kmkernel.cpp:1013 msgid "Online/Offline" msgstr "ऑनलाइन/ऑफ़लाइन" -#: kmkernel.cpp:1015 kmmainwidget.cpp:2445 +#: kmkernel.cpp:1014 kmmainwidget.cpp:2445 msgid "Work Online" msgstr "आनलाइन कार्य करें" -#: kmkernel.cpp:1016 kmmainwidget.cpp:2442 +#: kmkernel.cpp:1015 kmmainwidget.cpp:2442 msgid "Work Offline" msgstr "ऑफ़लाइन कार्य करें" -#: kmkernel.cpp:1039 +#: kmkernel.cpp:1038 #, fuzzy #| msgid "KMail is set to be online; all network jobs resumed" msgid "Network connection detected, all network jobs resumed" msgstr "केमेल को ऑनलाइन के रूप में सेट किया गया है, सभी नेटवर्क कार्य फिर से चालू हैं" -#: kmkernel.cpp:1044 +#: kmkernel.cpp:1043 #, fuzzy #| msgid "KMail is set to be offline; all network jobs are suspended" msgid "No network connection detected, all network jobs are suspended" msgstr "केमेल को ऑफ़लाइन के रूप में सेट किया गया है, सभी नेटवर्क कार्य निलंबित हैं" -#: kmkernel.cpp:1138 +#: kmkernel.cpp:1137 #, kde-format msgid "" "Failed to open autosave file at %1.\n" "Reason: %2" msgstr "" -#: kmkernel.cpp:1140 +#: kmkernel.cpp:1139 #, fuzzy #| msgid "Autosaving Failed" msgid "Opening Autosave File Failed" msgstr "स्वचालित सहेजना असफल" -#: kmkernel.cpp:1645 +#: kmkernel.cpp:1644 #, kde-format msgid "This identity has been changed to use the default transport:" msgid_plural "" @@ -3568,7 +3568,7 @@ msgstr[0] "डिफ़ॉल्ट ट्रांसपोर्ट का प्रयोग करने के लिए इस पहचान को बदल दिया गया है:" msgstr[1] "डिफ़ॉल्ट ट्रांसपोर्ट का प्रयोग करने के लिए इन %1 पहचानों को बदल दिया गया है:" -#: kmkernel.cpp:1670 +#: kmkernel.cpp:1669 #, kde-format msgid "This identity has been changed to use the modified transport:" msgid_plural "" @@ -3577,35 +3577,35 @@ msgstr[1] "" "परिवर्धित ट्रांसपोर्ट का प्रयोग करने के लिए इन %1 पहचानों को बदल दिया गया है:" -#: kmkernel.cpp:1685 +#: kmkernel.cpp:1684 msgid "Sending messages" msgstr "संदेशों को भेजा जा रहा है" -#: kmkernel.cpp:1686 +#: kmkernel.cpp:1685 #, fuzzy #| msgid "Initiating sender process..." msgid "Initiating sending process..." msgstr "भेजने की प्रक्रिया प्रारंभ किया जा रहा है..." -#: kmkernel.cpp:1754 +#: kmkernel.cpp:1753 #, fuzzy #| msgctxt "View->attachments->" #| msgid "&Inline" msgid "online" msgstr "इनलाइन (&I)" -#: kmkernel.cpp:1754 +#: kmkernel.cpp:1753 #, fuzzy #| msgid "Work Offline" msgid "offline" msgstr "ऑफ़लाइन कार्य करें" -#: kmkernel.cpp:1754 +#: kmkernel.cpp:1753 #, kde-format msgid "Resource %1 is broken. This resource is now %2" msgstr "" -#: kmkernel.cpp:1932 kmkernel.cpp:1951 +#: kmkernel.cpp:1926 kmkernel.cpp:1945 #, kde-format msgctxt "<source>: <error message>" msgid "%1: %2" @@ -4461,62 +4461,62 @@ msgid "Filter %1" msgstr "फ़िल्टर %1" -#: kmmainwidget.cpp:4550 +#: kmmainwidget.cpp:4565 msgid "Network is unconnected. Folder information cannot be updated." msgstr "" -#: kmmainwidget.cpp:4558 kmmainwidget.cpp:4606 +#: kmmainwidget.cpp:4573 kmmainwidget.cpp:4621 #, fuzzy #| msgid "Retrieving folderlist" msgid "Retrieving folder properties" msgstr "फ़ोल्डर सूची फिर से प्राप्त किया जा रहा है" -#: kmmainwidget.cpp:4637 kmmainwidget.cpp:4705 +#: kmmainwidget.cpp:4652 kmmainwidget.cpp:4720 #, fuzzy #| msgid "Done" msgid "Done" msgstr "सम्पन्न" -#: kmmainwidget.cpp:4661 +#: kmmainwidget.cpp:4676 #, fuzzy, kde-format #| msgid "Properties of Folder %1" msgctxt "@title:window" msgid "Properties of Folder %1" msgstr "फ़ोल्डर %1 की विशेषताएं" -#: kmmainwidget.cpp:4673 +#: kmmainwidget.cpp:4688 #, fuzzy #| msgid "Remove Duplicate Messages" msgid "Removing duplicates" msgstr "दोबारा आए संदेशों को हटाएँ" -#: kmmainwidget.cpp:4699 +#: kmmainwidget.cpp:4714 #, fuzzy #| msgid "Error while removing a folder." msgid "Error while removing duplicates" msgstr "फ़ोल्डर मिटाते समय त्रुटि हुई." -#: kmmainwidget.cpp:4757 +#: kmmainwidget.cpp:4772 msgid "" "IMAP server not configured yet. Please configure the server in the IMAP " "account before setting up server-side subscription." msgstr "" -#: kmmainwidget.cpp:4759 +#: kmmainwidget.cpp:4774 msgid "" "Log in failed, please configure the IMAP account before setting up server-" "side subscription." msgstr "" -#: kmmainwidget.cpp:4777 +#: kmmainwidget.cpp:4792 msgid "Archive Mail Agent was not registered." msgstr "" -#: kmmainwidget.cpp:4787 +#: kmmainwidget.cpp:4802 msgid "Send Later Agent was not registered." msgstr "" -#: kmmainwidget.cpp:4803 +#: kmmainwidget.cpp:4818 #, fuzzy #| msgid "Could not start certificate manager. Please check your installation." msgid "" @@ -4524,13 +4524,13 @@ "installation." msgstr "प्रमाणपत्र प्रबंधक प्रारंभ नहीं कर सका. कृपया अपना संस्थापन जांचें." -#: kmmainwidget.cpp:4805 +#: kmmainwidget.cpp:4820 #, fuzzy #| msgid "Unable to start external editor." msgid "Unable to start \"PIM Setting Exporter\" program" msgstr "बाहरी संपादक प्रारंभ करने में अक्षम." -#: kmmainwidget.cpp:4845 +#: kmmainwidget.cpp:4860 #, fuzzy, kde-format #| msgid "Starting..." msgctxt "Show shortcut for focus quick search. Don't change it" @@ -4783,7 +4783,7 @@ msgid "&Reply" msgstr "जवाब... (&R)" -#: messageactions.cpp:76 searchdialog/searchwindow.cpp:233 +#: messageactions.cpp:76 searchdialog/searchwindow.cpp:231 msgid "&Reply..." msgstr "जवाब... (&R)" @@ -4791,11 +4791,11 @@ msgid "Reply to A&uthor..." msgstr "लेखक को जवाब भेजें... (&u)" -#: messageactions.cpp:90 searchdialog/searchwindow.cpp:237 +#: messageactions.cpp:90 searchdialog/searchwindow.cpp:235 msgid "Reply to &All..." msgstr "सब को जवाब भेजें... (&A)" -#: messageactions.cpp:97 searchdialog/searchwindow.cpp:241 +#: messageactions.cpp:97 searchdialog/searchwindow.cpp:239 msgid "Reply to Mailing-&List..." msgstr "डाक-सूची को जवाब भेजें... (&L)" @@ -4815,13 +4815,13 @@ msgid "&Edit Message" msgstr "संदेश संपादन (&E)" -#: messageactions.cpp:142 messageactions.cpp:299 +#: messageactions.cpp:142 messageactions.cpp:287 #, fuzzy #| msgid "Add..." msgid "Add Note..." msgstr "जोड़ें..." -#: messageactions.cpp:151 searchdialog/searchwindow.cpp:245 +#: messageactions.cpp:151 searchdialog/searchwindow.cpp:243 msgctxt "Message->" msgid "&Forward" msgstr "आगे (&F)" @@ -4853,69 +4853,69 @@ msgid "Mailing-&List" msgstr "डाक-सूची को जवाब भेजें... (&L)" -#: messageactions.cpp:301 +#: messageactions.cpp:289 #, fuzzy #| msgid "Edit With..." msgid "Edit Note..." msgstr "के साथ संपादन करें..." -#: messageactions.cpp:339 +#: messageactions.cpp:327 msgid "Filter on Mailing-List..." msgstr "डाक-सूची पर फ़िल्टर..." -#: messageactions.cpp:377 +#: messageactions.cpp:365 #, fuzzy #| msgid "OpenPGP Message - Bad Signature" msgid "Open Message in List Archive" msgstr "ओपन-पीजीपी संदेश - खराब हस्ताक्षर" -#: messageactions.cpp:379 +#: messageactions.cpp:367 #, fuzzy #| msgid "New Message" msgid "Post New Message" msgstr "नया संदेश" -#: messageactions.cpp:381 +#: messageactions.cpp:369 #, fuzzy #| msgid "List Archives" msgid "Go to Archive" msgstr "अभिलेखों की सूची" -#: messageactions.cpp:383 +#: messageactions.cpp:371 #, fuzzy #| msgid "List Help" msgid "Request Help" msgstr "मदद सूची" -#: messageactions.cpp:385 +#: messageactions.cpp:373 #, fuzzy #| msgid "Contacts" msgctxt "Contact the owner of the mailing list" msgid "Contact Owner" msgstr "सम्पर्क" -#: messageactions.cpp:389 +#: messageactions.cpp:377 #, fuzzy #| msgid "Unsubscribe from List" msgid "Unsubscribe from List" msgstr "सूची से अनसब्सक्राइब करें" -#: messageactions.cpp:397 +#: messageactions.cpp:385 #, kde-format msgid "Filter on Mailing-List %1..." msgstr "डाक-सूची %1 पर फ़िल्टर..." -#: messageactions.cpp:560 +#: messageactions.cpp:548 #, fuzzy #| msgid "Email" msgid "email" msgstr "ईमेल" -#: messageactions.cpp:563 +#: messageactions.cpp:551 msgid "web" msgstr "" -#: messageactions.cpp:566 +#: messageactions.cpp:554 #, fuzzy, kde-format msgctxt "" "%1 is a 'Contact Owner' or similar action. %2 is a protocol normally web or " @@ -4923,12 +4923,12 @@ msgid "%1 (%2)" msgstr "डाक: %1" -#: messageactions.cpp:629 +#: messageactions.cpp:617 #, kde-format msgid "Search for '%1' with" msgstr "" -#: messageactions.cpp:643 +#: messageactions.cpp:631 #, fuzzy #| msgid "Configure &Filters..." msgid "Configure Web Shortcuts..." @@ -4999,98 +4999,98 @@ msgid "&Search" msgstr "ढूंढें (&S)" -#: searchdialog/searchwindow.cpp:195 searchdialog/searchwindow.cpp:416 +#: searchdialog/searchwindow.cpp:193 searchdialog/searchwindow.cpp:414 msgid "Last Search" msgstr "पिछला खोज" -#: searchdialog/searchwindow.cpp:250 +#: searchdialog/searchwindow.cpp:248 #, fuzzy #| msgid "&Inline..." msgctxt "@action:inmenu Forward message inline." msgid "&Inline..." msgstr "यथावत्... (&I)" -#: searchdialog/searchwindow.cpp:255 +#: searchdialog/searchwindow.cpp:253 msgctxt "Message->Forward->" msgid "As &Attachment..." msgstr "संलग्नक के रूप में... (&A)" -#: searchdialog/searchwindow.cpp:269 +#: searchdialog/searchwindow.cpp:267 msgid "Save Attachments..." msgstr "संलग्नक सहेजें..." -#: searchdialog/searchwindow.cpp:275 +#: searchdialog/searchwindow.cpp:273 msgid "Clear Selection" msgstr "चयन साफ करें" -#: searchdialog/searchwindow.cpp:359 +#: searchdialog/searchwindow.cpp:357 #, kde-format msgid "%1 match" msgid_plural "%1 matches" msgstr[0] "%1 एक जैसा" msgstr[1] "%1 एक जैसे" -#: searchdialog/searchwindow.cpp:441 +#: searchdialog/searchwindow.cpp:439 #, fuzzy #| msgid "Could not sync maildir folder." msgid "You did not selected a valid folder." msgstr "मेलडिर फ़ोल्डर सिंक नहीं कर सका." -#: searchdialog/searchwindow.cpp:451 searchdialog/searchwindow.cpp:460 +#: searchdialog/searchwindow.cpp:449 searchdialog/searchwindow.cpp:458 msgid "You forgot to select collections." msgstr "" -#: searchdialog/searchwindow.cpp:478 +#: searchdialog/searchwindow.cpp:476 msgid "You forgot to define condition." msgstr "" -#: searchdialog/searchwindow.cpp:483 +#: searchdialog/searchwindow.cpp:481 msgid "All folders selected are empty or were not indexed." msgstr "" -#: searchdialog/searchwindow.cpp:489 +#: searchdialog/searchwindow.cpp:487 #, fuzzy #| msgid " message" #| msgid_plural " messages" msgid "No message found." msgstr "संदेश" -#: searchdialog/searchwindow.cpp:493 +#: searchdialog/searchwindow.cpp:491 msgid "" "Contains condition cannot be used with a number of characters inferior to 4." msgstr "" -#: searchdialog/searchwindow.cpp:525 +#: searchdialog/searchwindow.cpp:523 #, fuzzy #| msgid "Starting..." msgid "Searching..." msgstr "प्रारंभ किया जा रहा है..." -#: searchdialog/searchwindow.cpp:535 +#: searchdialog/searchwindow.cpp:533 #, fuzzy, kde-format #| msgid "Move Messages to Folder" msgid "Cannot get search result. %1" msgstr "संदेशों को फ़ोल्डर में खिसकाएँ" -#: searchdialog/searchwindow.cpp:541 +#: searchdialog/searchwindow.cpp:539 #, fuzzy #| msgid "Search canceled" msgid "Search failed." msgstr "ढूंढना रद्द" -#: searchdialog/searchwindow.cpp:581 +#: searchdialog/searchwindow.cpp:579 #, fuzzy #| msgid " Spell check complete." msgid "Search complete." msgstr "मात्रा की जांच पूरी हो गई." -#: searchdialog/searchwindow.cpp:601 +#: searchdialog/searchwindow.cpp:599 #, fuzzy #| msgid " Spell check stopped." msgid "Search stopped." msgstr "वर्तनी जांच रोका." -#: searchdialog/searchwindow.cpp:659 +#: searchdialog/searchwindow.cpp:657 #, kde-format msgid "" "There was a problem renaming your search folder. A common reason for this is " @@ -5098,7 +5098,7 @@ "\"%1\"." msgstr "" -#: searchdialog/searchwindow.cpp:765 +#: searchdialog/searchwindow.cpp:753 #, fuzzy, kde-format #| msgid "Copy Messages" msgid "Copy Message" @@ -5106,7 +5106,7 @@ msgstr[0] "संदेशों की नक़ल बनाएँ" msgstr[1] "संदेशों की नक़ल बनाएँ" -#: searchdialog/searchwindow.cpp:768 +#: searchdialog/searchwindow.cpp:756 #, fuzzy, kde-format #| msgid "Cut Messages" msgid "Cut Message" diff -Nru kde-l10n-hi-4.12.97/messages/kdepim/kontact.po kde-l10n-hi-4.13.0/messages/kdepim/kontact.po --- kde-l10n-hi-4.12.97/messages/kdepim/kontact.po 2014-03-18 04:10:55.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kdepim/kontact.po 2014-04-10 07:54:02.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kontact\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-18 01:42+0000\n" +"POT-Creation-Date: 2014-04-10 06:40+0000\n" "PO-Revision-Date: 2008-01-23 13:17+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -725,19 +725,23 @@ msgid "Popup Notes" msgstr "नोट्स छापें" -#: plugins/knotes/summarywidget.cpp:147 +#: plugins/knotes/summarywidget.cpp:125 +msgid "No note found" +msgstr "" + +#: plugins/knotes/summarywidget.cpp:159 #, fuzzy #| msgid "New Note..." msgid "Modify Note..." msgstr "नया नोट" -#: plugins/knotes/summarywidget.cpp:151 +#: plugins/knotes/summarywidget.cpp:163 #, fuzzy #| msgid "Delete Feed" msgid "Delete Note..." msgstr "फीड मिटाएँ" -#: plugins/knotes/summarywidget.cpp:221 +#: plugins/knotes/summarywidget.cpp:233 #, fuzzy, kde-format #| msgid "Read Note: \"%1\"" msgid "Read Popup Note: \"%1\"" @@ -2749,13 +2753,13 @@ msgid "Cannot load part for %1." msgstr " %1 के लिए पार्ट लोड नहीं कर सका." -#: src/mainwindow.cpp:886 +#: src/mainwindow.cpp:888 #, fuzzy, kde-format msgctxt "@title:window Plugin dependent window title" msgid "%1 - Kontact" msgstr "%1 - कॉन्टेक्ट" -#: src/mainwindow.cpp:1237 +#: src/mainwindow.cpp:1239 #, fuzzy, kde-format #| msgid "" #| "<h2 style='text-align:center; margin-top: 0px;'>Welcome to Kontact %1</" @@ -2792,7 +2796,7 @@ "tr></table><p style=\"margin-bottom: 0px\"> <a href=\"%24\">इस परिचय को छोड़ें</" "a></p>" -#: src/mainwindow.cpp:1250 +#: src/mainwindow.cpp:1252 #, fuzzy #| msgid "" #| "Kontact handles your e-mail, addressbook, calendar, to-do list and more." @@ -2802,40 +2806,40 @@ msgstr "" "कॉन्टेक्ट आपके ईमेल, पतापुस्तिका, कैलेण्डर, कार्य सूची तथा और भी अन्य चीजों को सम्हालता है." -#: src/mainwindow.cpp:1256 +#: src/mainwindow.cpp:1258 #, fuzzy #| msgid "Read Manual" msgctxt "@item:intext" msgid "Read Manual" msgstr "मैनुअल पढ़ें" -#: src/mainwindow.cpp:1257 +#: src/mainwindow.cpp:1259 #, fuzzy #| msgid "Learn more about Kontact and its components" msgctxt "@item:intext" msgid "Learn more about Kontact and its components" msgstr "कॉन्टेक्ट तथा इसके अवयवों के बारे में और अधिक जानें" -#: src/mainwindow.cpp:1263 +#: src/mainwindow.cpp:1265 #, fuzzy #| msgid "Visit Kontact Website" msgctxt "@item:intext" msgid "Visit Kontact Website" msgstr "कॉन्टेक्ट वेबसाइट में जाएँ" -#: src/mainwindow.cpp:1264 +#: src/mainwindow.cpp:1266 #, fuzzy #| msgid "Access online resources and tutorials" msgctxt "@item:intext" msgid "Access online resources and tutorials" msgstr "ऑनलाइन संसाधनों तथा शिक्षणपाठ पर पहुँचें" -#: src/mainwindow.cpp:1270 +#: src/mainwindow.cpp:1272 msgctxt "@item:intext" msgid "Setup your Accounts" msgstr "" -#: src/mainwindow.cpp:1271 +#: src/mainwindow.cpp:1273 #, fuzzy #| msgid "Prepare Kontact for use in corporate networks" msgctxt "@item:intext" diff -Nru kde-l10n-hi-4.12.97/messages/kdepim/libkdepim.po kde-l10n-hi-4.13.0/messages/kdepim/libkdepim.po --- kde-l10n-hi-4.12.97/messages/kdepim/libkdepim.po 2014-03-18 04:10:55.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kdepim/libkdepim.po 2014-04-08 10:13:54.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: libkdepim\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-18 01:42+0000\n" +"POT-Creation-Date: 2014-04-08 08:21+0000\n" "PO-Revision-Date: 2008-01-26 16:00+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -26,27 +26,27 @@ msgid "Your emails" msgstr "raviratlami@aol.in," -#: addressline/addresseelineedit.cpp:116 +#: addressline/addresseelineedit.cpp:117 #, fuzzy, kde-format #| msgid "LDAP server %1" msgid "LDAP server: %1" msgstr "एलडीएपी सर्वर %1" -#: addressline/addresseelineedit.cpp:288 +#: addressline/addresseelineedit.cpp:292 msgctxt "@title:group" msgid "Contacts found in your data" msgstr "" -#: addressline/addresseelineedit.cpp:1273 +#: addressline/addresseelineedit.cpp:1300 msgid "Configure Completion Order..." msgstr "पूर्णता अनुक्रम कॉन्फ़िगर करें..." -#: addressline/completionordereditor.cpp:77 +#: addressline/completionordereditor.cpp:78 #, kde-format msgid "LDAP server %1" msgstr "एलडीएपी सर्वर %1" -#: addressline/completionordereditor.cpp:198 +#: addressline/completionordereditor.cpp:199 msgid "Edit Completion Order" msgstr "संपादन पूर्णता अनुक्रम" @@ -442,23 +442,23 @@ msgid "Configure LDAP Servers..." msgstr "पूर्णता अनुक्रम कॉन्फ़िगर करें..." -#: ldap/ldapsearchdialog.cpp:662 +#: ldap/ldapsearchdialog.cpp:663 #, fuzzy #| msgid "Copy rule" msgid "Copy" msgstr "नक़ल नियम" -#: ldap/ldapsearchdialog.cpp:785 +#: ldap/ldapsearchdialog.cpp:786 msgid "You must select an LDAP server before searching." msgstr "" -#: ldap/ldapsearchdialog.cpp:884 +#: ldap/ldapsearchdialog.cpp:885 #, kde-format msgctxt "arguments are host name, datetime" msgid "Imported from LDAP directory %1 on %2" msgstr "" -#: ldap/ldapsearchdialog.cpp:901 +#: ldap/ldapsearchdialog.cpp:903 msgid "Configure the Address Book LDAP Settings" msgstr "" diff -Nru kde-l10n-hi-4.12.97/messages/kdepim/libkleopatra.po kde-l10n-hi-4.13.0/messages/kdepim/libkleopatra.po --- kde-l10n-hi-4.12.97/messages/kdepim/libkleopatra.po 2013-06-18 03:14:05.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kdepim/libkleopatra.po 2014-04-08 10:13:54.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: libkleopatra\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-06-18 01:37+0000\n" +"POT-Creation-Date: 2014-04-08 08:21+0000\n" "PO-Revision-Date: 2008-01-26 16:23+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -140,7 +140,7 @@ #: backends/qgpgme/qgpgmekeylistjob.cpp:152 #: backends/qgpgme/qgpgmelistallkeysjob.cpp:154 ui/keyrequester.cpp:231 -#: ui/keyselectiondialog.cpp:599 +#: ui/keyselectiondialog.cpp:603 #, kde-format msgid "" "<qt><p>An error occurred while fetching the keys from the backend:</p><p><b>" @@ -392,51 +392,6 @@ msgid "Other Certificates" msgstr "प्रमाणपत्र प्रबंधक प्रारंभ करें (&S)" -#. i18n: ectx: property (windowTitle), widget (QDialog, AddDirectoryServiceDialog) -#: ui/adddirectoryservicedialog.ui:13 -msgid "Add or Change Directory Service" -msgstr "डिरेक्ट्री सेवा जोड़ें या परिवर्तित करें" - -#. i18n: ectx: property (text), widget (QLabel, serverNameLA) -#: ui/adddirectoryservicedialog.ui:25 -msgid "&Server name:" -msgstr "सर्वर नामः (&S)" - -#. i18n: ectx: property (text), widget (QLineEdit, portED) -#: ui/adddirectoryservicedialog.ui:38 -msgid "389" -msgstr "389" - -#. i18n: ectx: property (text), widget (QLabel, usernameLA) -#: ui/adddirectoryservicedialog.ui:48 -msgid "&User name (optional):" -msgstr "उपयोक्ता नाम (वैकल्पिक): (&U)" - -#. i18n: ectx: property (text), widget (QLabel, passwordLA) -#: ui/adddirectoryservicedialog.ui:74 -msgid "Pass&word (optional):" -msgstr "पासवर्ड (वैकल्पिक): (&w)" - -#. i18n: ectx: property (text), widget (QPushButton, PushButton3) -#: ui/adddirectoryservicedialog.ui:84 -msgid "&OK" -msgstr "ठीक (&O)" - -#. i18n: ectx: property (text), widget (QPushButton, PushButton4) -#: ui/adddirectoryservicedialog.ui:94 -msgid "&Cancel" -msgstr "रद्द करें (&C)" - -#. i18n: ectx: property (text), widget (QLabel, descriptionLA) -#: ui/adddirectoryservicedialog.ui:140 -msgid "&Base DN:" -msgstr "बेस डीएनः (&B)" - -#. i18n: ectx: property (text), widget (QLabel, portLA) -#: ui/adddirectoryservicedialog.ui:150 -msgid "&Port:" -msgstr "पोर्टः (&P)" - #: ui/cryptoconfigdialog.cpp:40 msgid "Configure GnuPG Backend" msgstr "" @@ -747,27 +702,27 @@ msgid "All others" msgstr "अन्य सभी" -#: ui/dnattributeorderconfigwidget.cpp:133 +#: ui/dnattributeorderconfigwidget.cpp:134 msgid "Move to top" msgstr "शीर्ष में जाएँ" -#: ui/dnattributeorderconfigwidget.cpp:134 +#: ui/dnattributeorderconfigwidget.cpp:135 msgid "Move one up" msgstr "एक ऊपर लाएँ" -#: ui/dnattributeorderconfigwidget.cpp:135 +#: ui/dnattributeorderconfigwidget.cpp:136 msgid "Remove from current attribute order" msgstr "वर्तमान विशेषता अनुक्रम से मिटाएँ" -#: ui/dnattributeorderconfigwidget.cpp:136 +#: ui/dnattributeorderconfigwidget.cpp:137 msgid "Add to current attribute order" msgstr "वर्तमान विशेषता अनुक्रम में जोड़ें" -#: ui/dnattributeorderconfigwidget.cpp:137 +#: ui/dnattributeorderconfigwidget.cpp:138 msgid "Move one down" msgstr "एक नीचे लाएँ" -#: ui/dnattributeorderconfigwidget.cpp:138 +#: ui/dnattributeorderconfigwidget.cpp:139 msgid "Move to bottom" msgstr "तल में जाएँ" @@ -832,7 +787,7 @@ msgstr "<placeholder>अज्ञात</placeholder>" #: ui/keyrequester.cpp:236 ui/keyrequester.cpp:265 ui/keyrequester.cpp:289 -#: ui/keyselectiondialog.cpp:571 ui/keyselectiondialog.cpp:604 +#: ui/keyselectiondialog.cpp:575 ui/keyselectiondialog.cpp:608 msgid "Key Listing Failed" msgstr "कुंजी निर्यात असफल" @@ -937,27 +892,27 @@ msgid "&Start Certificate Manager" msgstr "प्रमाणपत्र प्रबंधक प्रारंभ करें (&S)" -#: ui/keyselectiondialog.cpp:569 +#: ui/keyselectiondialog.cpp:573 msgid "No backends found for listing keys. Check your installation." msgstr "कुंजियाँ सूचीबद्ध करने के लिए कोई बैकएण्ड नहीं मिला. अपनी संस्थापना जाँचें." -#: ui/keyselectiondialog.cpp:588 +#: ui/keyselectiondialog.cpp:592 msgid "Could not start certificate manager; please check your installation." msgstr "प्रमाणपत्र प्रबंधक प्रारंभ नहीं कर सका. कृपया अपनी संस्थापना जाँचें." -#: ui/keyselectiondialog.cpp:590 +#: ui/keyselectiondialog.cpp:594 msgid "Certificate Manager Error" msgstr "प्रमाणपत्र प्रबंधक त्रुटि" -#: ui/keyselectiondialog.cpp:640 +#: ui/keyselectiondialog.cpp:644 msgid "Checking selected keys..." msgstr "चयनित कुंजियाँ जाँची जा रही हैं..." -#: ui/keyselectiondialog.cpp:640 +#: ui/keyselectiondialog.cpp:644 msgid "Fetching keys..." msgstr "कुंजियाँ प्राप्त की जा रही हैं..." -#: ui/keyselectiondialog.cpp:665 +#: ui/keyselectiondialog.cpp:669 #, kde-format msgid "" "<qt>One backend returned truncated output.<p>Not all available keys are " @@ -968,11 +923,11 @@ msgstr[0] "" msgstr[1] "" -#: ui/keyselectiondialog.cpp:670 +#: ui/keyselectiondialog.cpp:674 msgid "Key List Result" msgstr "कुंजी सूची परिणाम" -#: ui/keyselectiondialog.cpp:777 +#: ui/keyselectiondialog.cpp:781 msgid "Recheck Key" msgstr "कुंजी को फिर से जाँचें" @@ -1081,6 +1036,33 @@ msgid "%1: %2" msgstr "%1: %2" +#~ msgid "Add or Change Directory Service" +#~ msgstr "डिरेक्ट्री सेवा जोड़ें या परिवर्तित करें" + +#~ msgid "&Server name:" +#~ msgstr "सर्वर नामः (&S)" + +#~ msgid "389" +#~ msgstr "389" + +#~ msgid "&User name (optional):" +#~ msgstr "उपयोक्ता नाम (वैकल्पिक): (&U)" + +#~ msgid "Pass&word (optional):" +#~ msgstr "पासवर्ड (वैकल्पिक): (&w)" + +#~ msgid "&OK" +#~ msgstr "ठीक (&O)" + +#~ msgid "&Cancel" +#~ msgstr "रद्द करें (&C)" + +#~ msgid "&Base DN:" +#~ msgstr "बेस डीएनः (&B)" + +#~ msgid "&Port:" +#~ msgstr "पोर्टः (&P)" + #~ msgctxt "NAME OF TRANSLATORS" #~ msgid "Your names" #~ msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर" diff -Nru kde-l10n-hi-4.12.97/messages/kdepim/libksieve.po kde-l10n-hi-4.13.0/messages/kdepim/libksieve.po --- kde-l10n-hi-4.12.97/messages/kdepim/libksieve.po 2014-03-24 03:37:15.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kdepim/libksieve.po 2014-04-03 07:52:44.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: libksieve\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-24 01:44+0000\n" +"POT-Creation-Date: 2014-04-03 06:41+0000\n" "PO-Revision-Date: 2008-01-26 16:35+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -175,7 +175,7 @@ msgstr "" #: ksieveui/autocreatescripts/commonwidgets/sievehelpbutton.cpp:31 -#: ksieveui/editor/sieveeditortabwidget.cpp:61 +#: ksieveui/editor/sieveeditortabwidget.cpp:62 msgid "Help" msgstr "" @@ -1526,12 +1526,12 @@ msgid "Keep in Graphical mode" msgstr "" -#: ksieveui/editor/sieveeditortabwidget.cpp:71 +#: ksieveui/editor/sieveeditortabwidget.cpp:72 #, kde-format msgid "Error during load page about %1" msgstr "" -#: ksieveui/editor/sieveeditortabwidget.cpp:87 +#: ksieveui/editor/sieveeditortabwidget.cpp:88 #, kde-format msgid "Help about: %1" msgstr "" diff -Nru kde-l10n-hi-4.12.97/messages/kdepim/libmessagelist.po kde-l10n-hi-4.13.0/messages/kdepim/libmessagelist.po --- kde-l10n-hi-4.12.97/messages/kdepim/libmessagelist.po 2014-03-26 03:45:43.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kdepim/libmessagelist.po 2014-03-29 04:06:52.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kmail\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-26 01:50+0000\n" +"POT-Creation-Date: 2014-03-29 01:54+0000\n" "PO-Revision-Date: 2008-01-20 16:51+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -562,88 +562,88 @@ msgid "Ready" msgstr "तैयार." -#: core/quicksearchline.cpp:60 +#: core/quicksearchline.cpp:62 #, fuzzy #| msgid "Last Search" msgctxt "@action:button" msgid "Lock search" msgstr "पिछला खोज" -#: core/quicksearchline.cpp:63 +#: core/quicksearchline.cpp:66 msgctxt "@info:whatsthis" msgid "" "Toggle this button if you want to keep your quick search locked when moving " "to other folders or when narrowing the search by message status." msgstr "" -#: core/quicksearchline.cpp:78 +#: core/quicksearchline.cpp:81 #, fuzzy #| msgid "Available Filters" msgid "Quick Filter:" msgstr "उपलब्ध फ़िल्टर्स" -#: core/quicksearchline.cpp:84 +#: core/quicksearchline.cpp:87 #, fuzzy #| msgid "Search" msgctxt "Search for messages." msgid "Search" msgstr "ढूंढें" -#: core/quicksearchline.cpp:95 +#: core/quicksearchline.cpp:98 #, fuzzy #| msgid "Configure KMail..." msgid "More..." msgstr "के-मेल कॉन्फ़िगर करें..." -#: core/quicksearchline.cpp:121 +#: core/quicksearchline.cpp:125 #, fuzzy #| msgid "Filtering messages" msgid "Filter message by:" msgstr "संदेश फ़िल्टर किया जा रहा है" -#: core/quicksearchline.cpp:124 +#: core/quicksearchline.cpp:128 #, fuzzy #| msgid "Full message" msgid "Full Message" msgstr "पूरा संदेश" -#: core/quicksearchline.cpp:130 +#: core/quicksearchline.cpp:136 msgid "Body" msgstr "" -#: core/quicksearchline.cpp:136 +#: core/quicksearchline.cpp:143 #, fuzzy #| msgid "Subject" msgid "Subject" msgstr "विषय" -#: core/quicksearchline.cpp:149 +#: core/quicksearchline.cpp:158 msgid "Bcc" msgstr "" -#: core/quicksearchline.cpp:270 +#: core/quicksearchline.cpp:293 msgctxt "@info:tooltip" msgid "Clear the quick search field when changing folders" msgstr "" -#: core/quicksearchline.cpp:274 +#: core/quicksearchline.cpp:297 msgctxt "@info:tooltip" msgid "Prevent the quick search field from being cleared when changing folders" msgstr "" -#: core/quicksearchline.cpp:323 +#: core/quicksearchline.cpp:347 #, fuzzy #| msgid "To" msgid "To" msgstr "को" -#: core/quicksearchline.cpp:325 core/view.cpp:2401 core/view.cpp:2405 +#: core/quicksearchline.cpp:349 core/view.cpp:2401 core/view.cpp:2405 #, fuzzy #| msgid "&From" msgid "From" msgstr "द्वारा (&F)" -#: core/quicksearchline.cpp:335 +#: core/quicksearchline.cpp:359 #, fuzzy #| msgctxt "msg status" #| msgid "Unread" @@ -651,7 +651,7 @@ msgid "Unread" msgstr "बिनपढ़ा" -#: core/quicksearchline.cpp:338 +#: core/quicksearchline.cpp:362 #, fuzzy #| msgctxt "msg status" #| msgid "Replied" @@ -659,7 +659,7 @@ msgid "Replied" msgstr "जवाब प्रेषित" -#: core/quicksearchline.cpp:342 +#: core/quicksearchline.cpp:366 #, fuzzy #| msgctxt "msg status" #| msgid "Forwarded" @@ -667,7 +667,7 @@ msgid "Forwarded" msgstr "आगे भेजा गया" -#: core/quicksearchline.cpp:346 +#: core/quicksearchline.cpp:370 #, fuzzy #| msgctxt "msg status" #| msgid "Important" @@ -675,13 +675,13 @@ msgid "Important" msgstr "महत्वपूर्ण" -#: core/quicksearchline.cpp:350 +#: core/quicksearchline.cpp:374 #, fuzzy msgctxt "@action:inmenu Status of a message" msgid "Action Item" msgstr "मह्त्वपूर्ण संदेश" -#: core/quicksearchline.cpp:354 +#: core/quicksearchline.cpp:378 #, fuzzy #| msgctxt "msg status" #| msgid "Watched" @@ -689,7 +689,7 @@ msgid "Watched" msgstr "निगाह रखी" -#: core/quicksearchline.cpp:358 +#: core/quicksearchline.cpp:382 #, fuzzy #| msgctxt "msg status" #| msgid "Ignored" @@ -697,28 +697,28 @@ msgid "Ignored" msgstr "नज़रअंदाज़ किया" -#: core/quicksearchline.cpp:362 +#: core/quicksearchline.cpp:386 #, fuzzy #| msgid "Has Attachment" msgctxt "@action:inmenu Status of a message" msgid "Has Attachment" msgstr "संलग्नक है" -#: core/quicksearchline.cpp:366 +#: core/quicksearchline.cpp:390 #, fuzzy #| msgid "Advanced Options" msgctxt "@action:inmenu Status of a message" msgid "Has Invitation" msgstr "विस्तृत विकल्प" -#: core/quicksearchline.cpp:370 +#: core/quicksearchline.cpp:394 #, fuzzy #| msgid "Spam" msgctxt "@action:inmenu Status of a message" msgid "Spam" msgstr "बेकार डाक" -#: core/quicksearchline.cpp:374 +#: core/quicksearchline.cpp:398 #, fuzzy #| msgid "Ham" msgctxt "@action:inmenu Status of a message" diff -Nru kde-l10n-hi-4.12.97/messages/kdepim/libmessageviewer.po kde-l10n-hi-4.13.0/messages/kdepim/libmessageviewer.po --- kde-l10n-hi-4.12.97/messages/kdepim/libmessageviewer.po 2014-03-26 03:45:43.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kdepim/libmessageviewer.po 2014-04-09 07:38:27.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kmail\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-26 01:51+0000\n" +"POT-Creation-Date: 2014-04-09 06:31+0000\n" "PO-Revision-Date: 2008-01-20 16:51+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -40,7 +40,7 @@ msgid "No blockable element found." msgstr "कोई दोहरे संदेश नहीं मिले." -#: adblock/adblockblockableitemswidget.cpp:59 viewer/mimetreemodel.cpp:249 +#: adblock/adblockblockableitemswidget.cpp:59 viewer/mimetreemodel.cpp:250 msgid "Type" msgstr "क़िस्म" @@ -587,65 +587,65 @@ msgid "Bugzilla: " msgstr "" -#: header/fancyheaderstyle.cpp:221 header/grantleeheaderformatter.cpp:140 +#: header/fancyheaderstyle.cpp:221 header/grantleeheaderformatter.cpp:142 msgid "Spam Status:" msgstr "स्पैम स्थितिः" -#: header/grantleeheaderformatter.cpp:84 +#: header/grantleeheaderformatter.cpp:85 #, fuzzy, kde-format #| msgid "The signature file is not valid" msgid "Grantlee theme \"%1\" is not valid." msgstr "हस्ताक्षर फ़ाइल वैध नहीं है" -#: header/grantleeheaderformatter.cpp:109 +#: header/grantleeheaderformatter.cpp:111 #, fuzzy #| msgid "S&ubject:" msgid "Subject:" msgstr "विषयः (&u)" -#: header/grantleeheaderformatter.cpp:112 +#: header/grantleeheaderformatter.cpp:114 #, fuzzy #| msgid "To: " msgid "To:" msgstr "मिलेः" -#: header/grantleeheaderformatter.cpp:117 +#: header/grantleeheaderformatter.cpp:119 #, fuzzy #| msgid "Reply to: " msgid "Reply to:" msgstr "को जवाब भेजें:" -#: header/grantleeheaderformatter.cpp:123 +#: header/grantleeheaderformatter.cpp:125 #, fuzzy #| msgid "CC: " msgid "CC:" msgstr "नक़ल: " -#: header/grantleeheaderformatter.cpp:129 +#: header/grantleeheaderformatter.cpp:131 #, fuzzy #| msgid "BCC: " msgid "BCC:" msgstr "गुमनाम पता.: " -#: header/grantleeheaderformatter.cpp:133 +#: header/grantleeheaderformatter.cpp:135 #, fuzzy #| msgid "From: " msgid "From:" msgstr "द्वारा:" -#: header/grantleeheaderformatter.cpp:143 +#: header/grantleeheaderformatter.cpp:145 #, fuzzy #| msgid "Date: " msgid "Date:" msgstr "तारीख़:" -#: header/grantleeheaderformatter.cpp:160 +#: header/grantleeheaderformatter.cpp:162 #, fuzzy #| msgid "(resent from %1)" msgid "resent from" msgstr "(%1 से फिर से भेजा गया)" -#: header/grantleeheaderformatter.cpp:167 +#: header/grantleeheaderformatter.cpp:169 #, fuzzy #| msgid "Receiver" msgid "receiver was" @@ -653,13 +653,13 @@ msgstr[0] "पाने वाला" msgstr[1] "पाने वाला" -#: header/grantleeheaderformatter.cpp:181 +#: header/grantleeheaderformatter.cpp:183 #, fuzzy #| msgid "Printing Output" msgid "Printing mode" msgstr "आउटपुट मुद्रित किया जा रहा है" -#: header/grantleeheaderformatter.cpp:218 +#: header/grantleeheaderformatter.cpp:220 #, fuzzy #| msgid "[vCard]" msgid "[vcard]" @@ -1579,11 +1579,11 @@ msgid "body part" msgstr "मुख्य भाग" -#: viewer/mimetreemodel.cpp:247 +#: viewer/mimetreemodel.cpp:248 msgid "Description" msgstr "वर्णन" -#: viewer/mimetreemodel.cpp:251 +#: viewer/mimetreemodel.cpp:252 msgid "Size" msgstr "आकार" @@ -1770,52 +1770,52 @@ msgid "Show Raw Message" msgstr "संदेश आगे भेजें" -#: viewer/objecttreeparser.cpp:2067 viewer/viewer_p.cpp:2937 +#: viewer/objecttreeparser.cpp:2067 viewer/viewer_p.cpp:2931 msgid "" "Chiasmus backend does not offer the \"x-obtain-keys\" function. Please " "report this bug." msgstr "" -#: viewer/objecttreeparser.cpp:2073 viewer/viewer_p.cpp:2939 -#: viewer/viewer_p.cpp:2944 viewer/viewer_p.cpp:2953 viewer/viewer_p.cpp:2962 -#: viewer/viewer_p.cpp:2980 viewer/viewer_p.cpp:2992 viewer/viewer_p.cpp:3032 +#: viewer/objecttreeparser.cpp:2073 viewer/viewer_p.cpp:2933 +#: viewer/viewer_p.cpp:2938 viewer/viewer_p.cpp:2947 viewer/viewer_p.cpp:2956 +#: viewer/viewer_p.cpp:2974 viewer/viewer_p.cpp:2986 viewer/viewer_p.cpp:3026 msgid "Chiasmus Backend Error" msgstr "चियास्मस बैकएण्ड त्रुटि" -#: viewer/objecttreeparser.cpp:2079 viewer/viewer_p.cpp:2950 +#: viewer/objecttreeparser.cpp:2079 viewer/viewer_p.cpp:2944 msgid "" "Unexpected return value from Chiasmus backend: The \"x-obtain-keys\" " "function did not return a string list. Please report this bug." msgstr "" -#: viewer/objecttreeparser.cpp:2087 viewer/viewer_p.cpp:2959 +#: viewer/objecttreeparser.cpp:2087 viewer/viewer_p.cpp:2953 msgid "" "No keys have been found. Please check that a valid key path has been set in " "the Chiasmus configuration." msgstr "" -#: viewer/objecttreeparser.cpp:2093 viewer/viewer_p.cpp:2966 +#: viewer/objecttreeparser.cpp:2093 viewer/viewer_p.cpp:2960 msgid "Chiasmus Decryption Key Selection" msgstr "चियास्मस डीक्रिप्शन कुंजी चयन" -#: viewer/objecttreeparser.cpp:2106 viewer/viewer_p.cpp:2978 +#: viewer/objecttreeparser.cpp:2106 viewer/viewer_p.cpp:2972 msgid "" "Chiasmus backend does not offer the \"x-decrypt\" function. Please report " "this bug." msgstr "" -#: viewer/objecttreeparser.cpp:2114 viewer/viewer_p.cpp:2990 +#: viewer/objecttreeparser.cpp:2114 viewer/viewer_p.cpp:2984 msgid "" "The \"x-decrypt\" function does not accept the expected parameters. Please " "report this bug." msgstr "" -#: viewer/objecttreeparser.cpp:2120 viewer/viewer_p.cpp:2997 -#: viewer/viewer_p.cpp:3024 +#: viewer/objecttreeparser.cpp:2120 viewer/viewer_p.cpp:2991 +#: viewer/viewer_p.cpp:3018 msgid "Chiasmus Decryption Error" msgstr "चियास्मस डीक्रिप्शन त्रुटि" -#: viewer/objecttreeparser.cpp:2126 viewer/viewer_p.cpp:3029 +#: viewer/objecttreeparser.cpp:2126 viewer/viewer_p.cpp:3023 msgid "" "Unexpected return value from Chiasmus backend: The \"x-decrypt\" function " "did not return a byte array. Please report this bug." @@ -2220,7 +2220,7 @@ msgid "&Copy Email Address" msgstr "ई-मेल पता" -#: viewer/urlhandlermanager.cpp:737 viewer/viewer_p.cpp:2794 +#: viewer/urlhandlermanager.cpp:737 viewer/viewer_p.cpp:2788 msgid "Address copied to clipboard." msgstr "क्लिपबोर्ड पर पता की प्रति बनाई." @@ -2688,36 +2688,36 @@ msgid "Attachments:" msgstr "संलग्नक (&t)" -#: viewer/viewer_p.cpp:2799 +#: viewer/viewer_p.cpp:2793 msgid "URL copied to clipboard." msgstr "क्लिपबोर्ड पर यूआरएल की प्रति बनाई." -#: viewer/viewer_p.cpp:3091 +#: viewer/viewer_p.cpp:3085 msgid "Hide full address list" msgstr "" -#: viewer/viewer_p.cpp:3095 +#: viewer/viewer_p.cpp:3089 #, fuzzy msgid "Show full address list" msgstr "हमेशा दिखाएँ (&s)" -#: viewer/viewer_p.cpp:3118 +#: viewer/viewer_p.cpp:3112 #, fuzzy, kde-format #| msgid "Message was signed by %1." msgid "Message loading failed: %1." msgstr "संदेश %1 के द्वारा हस्ताक्षरित है." -#: viewer/viewer_p.cpp:3123 +#: viewer/viewer_p.cpp:3117 #, fuzzy #| msgid "Message was signed by %1." msgid "Message not found." msgstr "संदेश %1 के द्वारा हस्ताक्षरित है." -#: viewer/viewer_p.cpp:3247 +#: viewer/viewer_p.cpp:3241 msgid "Caret Browsing will be activated. Switch off with F7 shortcut." msgstr "" -#: viewer/viewer_p.cpp:3248 +#: viewer/viewer_p.cpp:3242 msgid "Activate Caret Browsing" msgstr "" @@ -2814,10 +2814,12 @@ msgstr "कार्य-सूची" #: widgets/todoedit.cpp:77 -msgid "Select collection where Todo will stored." -msgstr "" +#, fuzzy +#| msgid "The most recently selected folder in the folder selection dialog." +msgid "The most recently selected folder used for Todos." +msgstr "फ़ोल्डर चयन संवाद में सबसे हालिया चयनित फ़ोल्डर." -#: widgets/todoedit.cpp:156 +#: widgets/todoedit.cpp:143 #, fuzzy, kde-format #| msgid "Reply to: " msgid "Reply to \"%1\"" diff -Nru kde-l10n-hi-4.12.97/messages/kdesdk/umbrello.po kde-l10n-hi-4.13.0/messages/kdesdk/umbrello.po --- kde-l10n-hi-4.12.97/messages/kdesdk/umbrello.po 2014-03-26 03:45:43.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kdesdk/umbrello.po 2014-03-30 04:23:56.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: umbrello\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-26 01:53+0000\n" +"POT-Creation-Date: 2014-03-30 02:03+0000\n" "PO-Revision-Date: 2008-02-24 17:02+0530\n" "Last-Translator: Ravishankar Shrivastava <aviratlami@aol.in>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -177,7 +177,7 @@ msgid "That is an invalid name." msgstr "वह एक अवैध नाम है." -#: classifier.cpp:407 classifier.cpp:784 dialogs/diagrampropertiespage.cpp:75 +#: classifier.cpp:407 classifier.cpp:784 dialogs/diagrampropertiespage.cpp:76 #: entity.cpp:125 entity.cpp:178 entity.cpp:228 entity.cpp:277 enum.cpp:107 #: object_factory.cpp:212 package.cpp:175 umldoc.cpp:1287 umldoc.cpp:1358 #: umldoc.cpp:1388 umldoc.cpp:1422 @@ -1505,7 +1505,7 @@ #: dialogs/assocgenpage.cpp:77 dialogs/classpropdlg.cpp:128 #: dialogs/objectnodedialog.cpp:45 dialogs/parmpropdlg.cpp:71 #: dialogs/statedialog.cpp:45 dialogs/statedialog.cpp:125 -#: dialogs/umlviewdialog.cpp:41 listpopupmenu.cpp:632 +#: dialogs/umlviewdialog.cpp:41 listpopupmenu.cpp:633 #: refactoring/refactoringassistant.cpp:456 msgid "Properties" msgstr "गुण" @@ -1524,7 +1524,7 @@ msgid "Final activity" msgstr "अंतिम क्रियाएँ" -#: dialogs/activitydialog.cpp:141 listpopupmenu.cpp:1380 worktoolbar.cpp:326 +#: dialogs/activitydialog.cpp:141 listpopupmenu.cpp:1381 worktoolbar.cpp:326 msgid "Branch/Merge" msgstr "शाखा/मिलाएँ" @@ -1606,12 +1606,12 @@ msgid "New Activity..." msgstr "नई क्रिया..." -#: dialogs/activitypage.cpp:103 listpopupmenu.cpp:638 +#: dialogs/activitypage.cpp:103 listpopupmenu.cpp:639 #: refactoring/refactoringassistant.cpp:457 msgid "Delete" msgstr "मिटाएँ" -#: dialogs/activitypage.cpp:105 widgets/floatingtextwidget.cpp:391 +#: dialogs/activitypage.cpp:105 widgets/floatingtextwidget.cpp:396 msgid "Rename" msgstr "नाम बदलें" @@ -1619,12 +1619,12 @@ msgid "New Activity" msgstr "नई क्रिया" -#: dialogs/activitypage.cpp:175 toolbarstateother.cpp:251 umlscene.cpp:3069 +#: dialogs/activitypage.cpp:175 toolbarstateother.cpp:251 umlscene.cpp:3083 #: widgets/activitywidget.cpp:364 widgets/statewidget.cpp:497 msgid "Enter the name of the new activity:" msgstr "नई क्रिया का नाम भरें:" -#: dialogs/activitypage.cpp:175 toolbarstateother.cpp:251 umlscene.cpp:3070 +#: dialogs/activitypage.cpp:175 toolbarstateother.cpp:251 umlscene.cpp:3084 #: widgets/statewidget.cpp:498 msgid "new activity" msgstr "नई क्रिया" @@ -1963,8 +1963,8 @@ msgstr "टेबल (&T)" #: dialogs/classgenpage.cpp:214 dialogs/umlattributedialog.cpp:98 -#: dialogs/umloperationdialog.cpp:123 listpopupmenu.cpp:1079 -#: listpopupmenu.cpp:1124 +#: dialogs/umloperationdialog.cpp:123 listpopupmenu.cpp:1080 +#: listpopupmenu.cpp:1125 msgid "Visibility" msgstr "दृश्यता" @@ -2038,7 +2038,7 @@ msgstr "नाम बेजोड़ नहीं है" #: dialogs/classifierlistpage.cpp:115 dialogs/classpropdlg.cpp:280 -#: listpopupmenu.cpp:1072 listpopupmenu.cpp:1108 +#: listpopupmenu.cpp:1073 listpopupmenu.cpp:1109 #: refactoring/refactoringassistant.cpp:662 msgid "Attributes" msgstr "गुणधर्म" @@ -2048,7 +2048,7 @@ msgstr "नया गुणधर्म... (&e)" #: dialogs/classifierlistpage.cpp:119 dialogs/classpropdlg.cpp:292 -#: listpopupmenu.cpp:1075 listpopupmenu.cpp:1117 +#: listpopupmenu.cpp:1076 listpopupmenu.cpp:1118 #: refactoring/refactoringassistant.cpp:678 msgid "Operations" msgstr "संचालन" @@ -2092,7 +2092,7 @@ #: dialogs/classifierlistpage.cpp:206 #: dialogs/umlforeignkeyconstraintdialog.cpp:321 #: dialogs/umloperationdialog.cpp:166 -#: dialogs/umluniqueconstraintdialog.cpp:122 umldoc.cpp:1484 umlscene.cpp:3284 +#: dialogs/umluniqueconstraintdialog.cpp:122 umldoc.cpp:1484 umlscene.cpp:3298 msgid "&Delete" msgstr "मिटाएँ (&D)" @@ -2111,9 +2111,9 @@ #: dialogs/classoptionspage.cpp:124 dialogs/classoptionspage.cpp:191 #: dialogs/classoptionspage.cpp:213 dialogs/codeeditor.cpp:791 -#: listpopupmenu.cpp:1068 listpopupmenu.cpp:1105 listpopupmenu.cpp:1110 -#: listpopupmenu.cpp:1118 listpopupmenu.cpp:1125 listpopupmenu.cpp:1132 -#: listpopupmenu.cpp:1138 +#: listpopupmenu.cpp:1069 listpopupmenu.cpp:1106 listpopupmenu.cpp:1111 +#: listpopupmenu.cpp:1119 listpopupmenu.cpp:1126 listpopupmenu.cpp:1133 +#: listpopupmenu.cpp:1139 msgid "Show" msgstr "दिखाएँ" @@ -2293,8 +2293,8 @@ msgid "Add operations to the new class." msgstr "" -#: dialogs/codeeditor.cpp:785 listpopupmenu.cpp:1111 listpopupmenu.cpp:1119 -#: listpopupmenu.cpp:1126 listpopupmenu.cpp:1133 listpopupmenu.cpp:1139 +#: dialogs/codeeditor.cpp:785 listpopupmenu.cpp:1112 listpopupmenu.cpp:1120 +#: listpopupmenu.cpp:1127 listpopupmenu.cpp:1134 listpopupmenu.cpp:1140 msgid "Hide" msgstr "छुपाएँ" @@ -2314,15 +2314,15 @@ msgid "Insert Code Block After" msgstr "कोड ब्लॉक बाद में प्रविष्ट करें" -#: dialogs/codeeditor.cpp:826 listpopupmenu.cpp:644 +#: dialogs/codeeditor.cpp:826 listpopupmenu.cpp:645 msgid "Copy" msgstr "नक़ल" -#: dialogs/codeeditor.cpp:831 listpopupmenu.cpp:647 +#: dialogs/codeeditor.cpp:831 listpopupmenu.cpp:648 msgid "Paste" msgstr "चिपकाएँ" -#: dialogs/codeeditor.cpp:836 listpopupmenu.cpp:641 +#: dialogs/codeeditor.cpp:836 listpopupmenu.cpp:642 msgid "Cut" msgstr "काटें" @@ -2406,19 +2406,19 @@ msgid "<p align=\"right\">Editable text:</p>" msgstr "<p align=\"right\">संपादन योग्य पाठ:</p>" -#: dialogs/constraintlistpage.cpp:72 listpopupmenu.cpp:1412 +#: dialogs/constraintlistpage.cpp:72 listpopupmenu.cpp:1413 msgid "Unique Constraint..." msgstr "विशिष्ट प्रतिबन्ध..." -#: dialogs/constraintlistpage.cpp:76 listpopupmenu.cpp:1411 +#: dialogs/constraintlistpage.cpp:76 listpopupmenu.cpp:1412 msgid "Primary Key Constraint..." msgstr "प्राथमिक कुंजी प्रतिबंध..." -#: dialogs/constraintlistpage.cpp:80 listpopupmenu.cpp:1413 +#: dialogs/constraintlistpage.cpp:80 listpopupmenu.cpp:1414 msgid "Foreign Key Constraint..." msgstr "विदेशी कुंजी प्रतिबंध..." -#: dialogs/constraintlistpage.cpp:84 listpopupmenu.cpp:1414 +#: dialogs/constraintlistpage.cpp:84 listpopupmenu.cpp:1415 msgid "Check Constraint..." msgstr "प्रतिबन्ध जांचें..." @@ -2460,15 +2460,15 @@ msgid "No diagrams selected." msgstr "कोई आरेख चुना नहीं गया." -#: dialogs/diagrampropertiespage.cpp:74 +#: dialogs/diagrampropertiespage.cpp:75 msgid "The name you have entered is invalid." msgstr "जो नाम आपने भरा है वह अवैध है." -#: dialogs/diagrampropertiespage.cpp:84 +#: dialogs/diagrampropertiespage.cpp:85 msgid "The name you have entered is not unique." msgstr "जो नाम आपने भरा है वह बेजोड़ नहीं है." -#: dialogs/diagrampropertiespage.cpp:85 umldoc.cpp:1428 +#: dialogs/diagrampropertiespage.cpp:86 umldoc.cpp:1428 msgid "Name Not Unique" msgstr "नाम बेजोड़ नहीं है" @@ -2788,29 +2788,29 @@ msgid "Contained Items" msgstr "रखी हुई वस्तुएँ" -#: dialogs/selectopdlg.cpp:51 dialogs/selectopdlg.cpp:62 +#: dialogs/selectopdlg.cpp:53 dialogs/selectopdlg.cpp:64 msgid "Select Operation" msgstr "संचालन चुनें" -#: dialogs/selectopdlg.cpp:70 +#: dialogs/selectopdlg.cpp:72 msgid "Sequence number:" msgstr "अनुक्रम क्रमांक:" -#: dialogs/selectopdlg.cpp:73 +#: dialogs/selectopdlg.cpp:75 #, fuzzy #| msgid "&Auto increment" msgid "Auto increment:" msgstr "स्वचालित वृद्धि (&A)" -#: dialogs/selectopdlg.cpp:77 +#: dialogs/selectopdlg.cpp:80 msgid "Class operation:" msgstr "क्लास संचालन:" -#: dialogs/selectopdlg.cpp:86 listpopupmenu.cpp:570 listpopupmenu.cpp:683 +#: dialogs/selectopdlg.cpp:89 listpopupmenu.cpp:571 listpopupmenu.cpp:684 msgid "New Operation..." msgstr "नया संचालन..." -#: dialogs/selectopdlg.cpp:90 +#: dialogs/selectopdlg.cpp:93 msgid "Custom operation:" msgstr "मनपसंद संचालन:" @@ -3595,603 +3595,603 @@ msgid "The folderfile %1 cannot be opened." msgstr "फ़ोल्डरफ़ाइल %1 खोला नहीं जा सका." -#: listpopupmenu.cpp:337 listpopupmenu.cpp:1711 +#: listpopupmenu.cpp:338 listpopupmenu.cpp:1712 msgid "Category Type" msgstr "वर्ग क़िस्म" -#: listpopupmenu.cpp:388 +#: listpopupmenu.cpp:389 msgid "Move Up" msgstr "ऊपर जाएँ" -#: listpopupmenu.cpp:389 +#: listpopupmenu.cpp:390 msgid "Move Down" msgstr "नीचे जाएँ" -#: listpopupmenu.cpp:395 +#: listpopupmenu.cpp:396 msgid "Rename Class..." msgstr "वर्ग को नया नाम दें..." -#: listpopupmenu.cpp:396 +#: listpopupmenu.cpp:397 msgid "Rename Object..." msgstr "ऑब्जेक्ट को नया नाम दें..." -#: listpopupmenu.cpp:415 +#: listpopupmenu.cpp:416 #, fuzzy msgctxt "clear note" msgid "Clear" msgstr "साफ करें" -#: listpopupmenu.cpp:417 listpopupmenu.cpp:517 listpopupmenu.cpp:536 -#: listpopupmenu.cpp:577 +#: listpopupmenu.cpp:418 listpopupmenu.cpp:518 listpopupmenu.cpp:537 +#: listpopupmenu.cpp:578 msgid "Change Text..." msgstr "पाठ बदलें..." -#: listpopupmenu.cpp:437 +#: listpopupmenu.cpp:438 msgid "Change State Name..." msgstr "अवस्था नाम बदलें..." -#: listpopupmenu.cpp:444 listpopupmenu.cpp:458 +#: listpopupmenu.cpp:445 listpopupmenu.cpp:459 msgid "Flip Horizontal" msgstr "आड़ा पलटें" -#: listpopupmenu.cpp:446 listpopupmenu.cpp:461 +#: listpopupmenu.cpp:447 listpopupmenu.cpp:462 msgid "Flip Vertical" msgstr "खड़ा पलटें" -#: listpopupmenu.cpp:464 listpopupmenu.cpp:597 listpopupmenu.cpp:1224 +#: listpopupmenu.cpp:465 listpopupmenu.cpp:598 listpopupmenu.cpp:1225 msgid "Fill Color..." msgstr "भराव रंग..." -#: listpopupmenu.cpp:480 +#: listpopupmenu.cpp:481 msgid "Change Activity Name..." msgstr "गतिविधि नाम बदलें..." -#: listpopupmenu.cpp:499 +#: listpopupmenu.cpp:500 msgid "Change Object Node Name..." msgstr "ऑब्जैक्ट नोड नाम बदलें..." -#: listpopupmenu.cpp:515 +#: listpopupmenu.cpp:516 #, fuzzy msgctxt "clear precondition" msgid "Clear" msgstr "साफ करें" -#: listpopupmenu.cpp:526 +#: listpopupmenu.cpp:527 msgid "Add Interaction Operand" msgstr "इंटरेक्शन ऑपरेण्ड जोड़ें" -#: listpopupmenu.cpp:534 +#: listpopupmenu.cpp:535 #, fuzzy msgctxt "clear combined fragment" msgid "Clear" msgstr "साफ करें" -#: listpopupmenu.cpp:544 listpopupmenu.cpp:547 listpopupmenu.cpp:1857 -#: listpopupmenu.cpp:1861 +#: listpopupmenu.cpp:545 listpopupmenu.cpp:548 listpopupmenu.cpp:1858 +#: listpopupmenu.cpp:1862 msgid "Change Multiplicity..." msgstr "गुणनता बदलें..." -#: listpopupmenu.cpp:550 listpopupmenu.cpp:1865 +#: listpopupmenu.cpp:551 listpopupmenu.cpp:1866 msgid "Change Name" msgstr " नाम बदलें" -#: listpopupmenu.cpp:553 listpopupmenu.cpp:933 listpopupmenu.cpp:1849 +#: listpopupmenu.cpp:554 listpopupmenu.cpp:934 listpopupmenu.cpp:1850 msgid "Change Role A Name..." msgstr "भूमिका ए नाम बदलें..." -#: listpopupmenu.cpp:556 listpopupmenu.cpp:934 listpopupmenu.cpp:1853 +#: listpopupmenu.cpp:557 listpopupmenu.cpp:935 listpopupmenu.cpp:1854 msgid "Change Role B Name..." msgstr "भूमिका बी नाम बदलें..." -#: listpopupmenu.cpp:571 listpopupmenu.cpp:942 +#: listpopupmenu.cpp:572 listpopupmenu.cpp:943 msgid "Select Operation..." msgstr "संचालन चुनें..." -#: listpopupmenu.cpp:595 listpopupmenu.cpp:1222 +#: listpopupmenu.cpp:596 listpopupmenu.cpp:1223 #, fuzzy msgctxt "color menu" msgid "Color" msgstr "रंग" -#: listpopupmenu.cpp:596 listpopupmenu.cpp:653 listpopupmenu.cpp:1223 +#: listpopupmenu.cpp:597 listpopupmenu.cpp:654 listpopupmenu.cpp:1224 msgid "Line Color..." msgstr "रेखा का रंग..." #. i18n: ectx: label, entry (useFillColor), group (UI Options) -#: listpopupmenu.cpp:598 listpopupmenu.cpp:1225 umbrello.kcfg:130 +#: listpopupmenu.cpp:599 listpopupmenu.cpp:1226 umbrello.kcfg:130 msgid "Use Fill Color" msgstr "भराव रंग इस्तेमाल करें" -#: listpopupmenu.cpp:599 +#: listpopupmenu.cpp:600 #, fuzzy #| msgid "Fill Color" msgid "No Fill Color" msgstr "भराव रंग" -#: listpopupmenu.cpp:616 listpopupmenu.cpp:867 +#: listpopupmenu.cpp:617 listpopupmenu.cpp:868 msgid "Resize" msgstr "" -#: listpopupmenu.cpp:619 listpopupmenu.cpp:650 +#: listpopupmenu.cpp:620 listpopupmenu.cpp:651 msgid "Change Font..." msgstr "फ़ॉन्ट बदलें..." -#: listpopupmenu.cpp:635 listpopupmenu.cpp:1869 +#: listpopupmenu.cpp:636 listpopupmenu.cpp:1870 msgid "Rename..." msgstr "नाम बदलें..." -#: listpopupmenu.cpp:656 +#: listpopupmenu.cpp:657 msgid "Expand All" msgstr "सभी फैलाएँ" -#: listpopupmenu.cpp:659 +#: listpopupmenu.cpp:660 msgid "Collapse All" msgstr "सभी समेंटें" -#: listpopupmenu.cpp:662 +#: listpopupmenu.cpp:663 #, fuzzy msgctxt "duplicate action" msgid "Duplicate" msgstr "अनुकृति" -#: listpopupmenu.cpp:665 +#: listpopupmenu.cpp:666 msgid "Externalize Folder..." msgstr "फ़ोल्डर एक्सटर्नलाइज़ करें..." -#: listpopupmenu.cpp:668 +#: listpopupmenu.cpp:669 msgid "Internalize Folder" msgstr "फ़ोल्डर इंटरनलाइज करें" -#: listpopupmenu.cpp:671 +#: listpopupmenu.cpp:672 #, fuzzy #| msgid "Import Classes..." msgid "Import File(s)..." msgstr "क्लास आयात करें..." -#: listpopupmenu.cpp:674 +#: listpopupmenu.cpp:675 msgid "Import Project..." msgstr "परियोजना आयात करें..." -#: listpopupmenu.cpp:677 +#: listpopupmenu.cpp:678 msgid "Reset Label Positions" msgstr "लेबल स्थिति रीसेट करें" -#: listpopupmenu.cpp:680 +#: listpopupmenu.cpp:681 msgid "New Parameter..." msgstr "नया-पैरामीटर..." -#: listpopupmenu.cpp:686 +#: listpopupmenu.cpp:687 msgid "New Attribute..." msgstr "नया गुणधर्म..." -#: listpopupmenu.cpp:689 listpopupmenu.cpp:1796 +#: listpopupmenu.cpp:690 listpopupmenu.cpp:1797 msgid "New Template..." msgstr "नया टैम्प्लेट..." -#: listpopupmenu.cpp:692 +#: listpopupmenu.cpp:693 msgid "New Literal..." msgstr "नया लिटरल..." -#: listpopupmenu.cpp:695 +#: listpopupmenu.cpp:696 msgid "New Entity Attribute..." msgstr "नया एंटिटी गुणधर्म..." -#: listpopupmenu.cpp:698 +#: listpopupmenu.cpp:699 msgid "Export as Picture..." msgstr "छवि के रूप में निर्यात करें..." -#: listpopupmenu.cpp:717 +#: listpopupmenu.cpp:718 msgid "Subsystem" msgstr "सबसिस्टम" -#: listpopupmenu.cpp:720 worktoolbar.cpp:332 +#: listpopupmenu.cpp:721 worktoolbar.cpp:332 msgid "Component" msgstr "अवयव" -#: listpopupmenu.cpp:723 worktoolbar.cpp:334 +#: listpopupmenu.cpp:724 worktoolbar.cpp:334 msgid "Artifact" msgstr "आर्टिफेक्ट" -#: listpopupmenu.cpp:734 worktoolbar.cpp:333 +#: listpopupmenu.cpp:735 worktoolbar.cpp:333 msgid "Node" msgstr "नोड" -#: listpopupmenu.cpp:747 listpopupmenu.cpp:882 +#: listpopupmenu.cpp:748 listpopupmenu.cpp:883 msgid "Folder" msgstr "फ़ोल्डर" -#: listpopupmenu.cpp:750 worktoolbar.cpp:338 +#: listpopupmenu.cpp:751 worktoolbar.cpp:338 msgid "Entity" msgstr "एंटिटी" -#: listpopupmenu.cpp:760 worktoolbar.cpp:360 +#: listpopupmenu.cpp:761 worktoolbar.cpp:360 msgid "Category" msgstr "श्रेणी" -#: listpopupmenu.cpp:763 worktoolbar.cpp:314 +#: listpopupmenu.cpp:764 worktoolbar.cpp:314 msgid "Actor" msgstr "कर्ता" -#: listpopupmenu.cpp:766 worktoolbar.cpp:321 +#: listpopupmenu.cpp:767 worktoolbar.cpp:321 msgid "Use Case" msgstr "केस इस्तेमाल करें" -#: listpopupmenu.cpp:776 +#: listpopupmenu.cpp:777 msgid "Text Line..." msgstr "पाठ की पंक्ति..." -#: listpopupmenu.cpp:879 +#: listpopupmenu.cpp:880 #, fuzzy msgctxt "new container menu" msgid "New" msgstr "नया" -#: listpopupmenu.cpp:883 +#: listpopupmenu.cpp:884 #, fuzzy msgctxt "new class menu item" msgid "Class" msgstr "वर्ग" -#: listpopupmenu.cpp:884 worktoolbar.cpp:335 +#: listpopupmenu.cpp:885 worktoolbar.cpp:335 msgid "Interface" msgstr "इंटरफेस" -#: listpopupmenu.cpp:885 worktoolbar.cpp:336 +#: listpopupmenu.cpp:886 worktoolbar.cpp:336 msgid "Datatype" msgstr "डाटाटाइप" -#: listpopupmenu.cpp:886 worktoolbar.cpp:337 +#: listpopupmenu.cpp:887 worktoolbar.cpp:337 msgid "Enum" msgstr "एन्यूम" -#: listpopupmenu.cpp:887 listpopupmenu.cpp:1091 worktoolbar.cpp:331 +#: listpopupmenu.cpp:888 listpopupmenu.cpp:1092 worktoolbar.cpp:331 msgid "Package" msgstr "पैकेज" -#: listpopupmenu.cpp:921 +#: listpopupmenu.cpp:922 #, fuzzy #| msgid "Add only" msgid "Add Point" msgstr "सिर्फ जोड़ें" -#: listpopupmenu.cpp:923 +#: listpopupmenu.cpp:924 #, fuzzy #| msgid "Delete" msgid "Delete Point" msgstr "मिटाएँ" -#: listpopupmenu.cpp:932 +#: listpopupmenu.cpp:933 msgid "Change Association Name..." msgstr "सम्बद्धता नाम बदलें..." -#: listpopupmenu.cpp:972 +#: listpopupmenu.cpp:973 #, fuzzy #| msgid "Auto Save" msgctxt "Layout menu" msgid "Layout" msgstr "स्वचलित सहेजें" -#: listpopupmenu.cpp:973 +#: listpopupmenu.cpp:974 msgid "Polyline" msgstr "" -#: listpopupmenu.cpp:974 +#: listpopupmenu.cpp:975 msgid "Direct" msgstr "" -#: listpopupmenu.cpp:975 +#: listpopupmenu.cpp:976 msgid "Spline" msgstr "" -#: listpopupmenu.cpp:976 +#: listpopupmenu.cpp:977 msgid "Orthogonal" msgstr "" -#: listpopupmenu.cpp:1045 +#: listpopupmenu.cpp:1046 #, kde-format msgid "apply '%1'" msgstr "" -#: listpopupmenu.cpp:1077 +#: listpopupmenu.cpp:1078 msgid "Public Only" msgstr "सिर्फ सार्वजनिक" -#: listpopupmenu.cpp:1081 +#: listpopupmenu.cpp:1082 msgid "Operation Signature" msgstr "संचालन हस्ताक्षर" -#: listpopupmenu.cpp:1086 +#: listpopupmenu.cpp:1087 msgid "Attribute Signature" msgstr "गुणधर्म हस्ताक्षर" -#: listpopupmenu.cpp:1094 stereotype.cpp:112 +#: listpopupmenu.cpp:1095 stereotype.cpp:112 msgid "Stereotype" msgstr "स्टीरियो-टाइप" -#: listpopupmenu.cpp:1112 listpopupmenu.cpp:1120 +#: listpopupmenu.cpp:1113 listpopupmenu.cpp:1121 #, fuzzy #| msgid "Show Attribute Signature" msgid "Show Signatures" msgstr "गुणधर्म हस्ताक्षर दिखाएँ" -#: listpopupmenu.cpp:1113 listpopupmenu.cpp:1121 +#: listpopupmenu.cpp:1114 listpopupmenu.cpp:1122 #, fuzzy #| msgid "Attribute Signature" msgid "Hide Signatures" msgstr "गुणधर्म हस्ताक्षर" -#: listpopupmenu.cpp:1127 +#: listpopupmenu.cpp:1128 msgid "Hide Non-public members" msgstr "" -#: listpopupmenu.cpp:1128 +#: listpopupmenu.cpp:1129 msgid "Show Non-public members" msgstr "" -#: listpopupmenu.cpp:1131 +#: listpopupmenu.cpp:1132 #, fuzzy #| msgid "Package" msgid "Packages" msgstr "पैकेज" -#: listpopupmenu.cpp:1137 +#: listpopupmenu.cpp:1138 #, fuzzy #| msgid "Stereotype" msgid "Stereotypes" msgstr "स्टीरियो-टाइप" -#: listpopupmenu.cpp:1151 +#: listpopupmenu.cpp:1152 #, fuzzy msgctxt "new classifier menu" msgid "New" msgstr "नया" -#: listpopupmenu.cpp:1154 +#: listpopupmenu.cpp:1155 msgid "Attribute..." msgstr "विशेषता" -#: listpopupmenu.cpp:1155 +#: listpopupmenu.cpp:1156 msgid "Operation..." msgstr "संचालन..." -#: listpopupmenu.cpp:1156 +#: listpopupmenu.cpp:1157 msgid "Template..." msgstr "टैम्प्लेट..." -#: listpopupmenu.cpp:1166 +#: listpopupmenu.cpp:1167 msgid "Draw as Circle" msgstr "वृत्त की तरह आरेखित करें" -#: listpopupmenu.cpp:1168 +#: listpopupmenu.cpp:1169 msgid "Change into Class" msgstr "क्लास में बदलें" -#: listpopupmenu.cpp:1170 +#: listpopupmenu.cpp:1171 msgid "Refactor" msgstr "रीफैक्टर" -#: listpopupmenu.cpp:1171 +#: listpopupmenu.cpp:1172 msgid "View Code" msgstr "कोड दिखाएँ" -#: listpopupmenu.cpp:1174 +#: listpopupmenu.cpp:1175 msgid "Change into Interface" msgstr "इंटरफ़ेस में बदलें" -#: listpopupmenu.cpp:1201 +#: listpopupmenu.cpp:1202 #, fuzzy #| msgid "&Align" msgctxt "align menu" msgid "Align" msgstr "पंक्तिबद्ध (&A)" -#: listpopupmenu.cpp:1202 uml.cpp:493 +#: listpopupmenu.cpp:1203 uml.cpp:493 msgid "Align Right" msgstr "दायाँ पंक्तिबद्ध करें" -#: listpopupmenu.cpp:1203 uml.cpp:498 +#: listpopupmenu.cpp:1204 uml.cpp:498 msgid "Align Left" msgstr "बायाँ पंक्तिबद्ध करें " -#: listpopupmenu.cpp:1204 uml.cpp:503 +#: listpopupmenu.cpp:1205 uml.cpp:503 msgid "Align Top" msgstr "शीर्ष में पंक्तिबद्ध करें" -#: listpopupmenu.cpp:1205 uml.cpp:508 +#: listpopupmenu.cpp:1206 uml.cpp:508 msgid "Align Bottom" msgstr "तल में पंक्तिबद्ध करें" -#: listpopupmenu.cpp:1207 uml.cpp:513 +#: listpopupmenu.cpp:1208 uml.cpp:513 msgid "Align Vertical Middle" msgstr "खड़ा मध्य में पंक्तिबद्ध करें" -#: listpopupmenu.cpp:1208 uml.cpp:518 +#: listpopupmenu.cpp:1209 uml.cpp:518 msgid "Align Horizontal Middle" msgstr "आड़ा मध्य में पंक्तिबद्ध करें" -#: listpopupmenu.cpp:1209 uml.cpp:523 +#: listpopupmenu.cpp:1210 uml.cpp:523 msgid "Align Vertical Distribute" msgstr "डिस्ट्रीब्यूट को खड़े में पंक्तिबद्ध करें" -#: listpopupmenu.cpp:1210 uml.cpp:528 +#: listpopupmenu.cpp:1211 uml.cpp:528 msgid "Align Horizontal Distribute" msgstr "डिस्ट्रीब्यूट को आड़े में पंक्तिबद्ध करें" -#: listpopupmenu.cpp:1303 +#: listpopupmenu.cpp:1304 #, fuzzy msgctxt "new sub menu" msgid "New" msgstr "नया" -#: listpopupmenu.cpp:1352 +#: listpopupmenu.cpp:1353 msgid "Actor..." msgstr "कर्ता..." -#: listpopupmenu.cpp:1353 +#: listpopupmenu.cpp:1354 msgid "Use Case..." msgstr "केस इस्तेमाल करें" -#: listpopupmenu.cpp:1357 +#: listpopupmenu.cpp:1358 #, fuzzy msgctxt "new class menu item" msgid "Class..." msgstr "वर्ग..." -#: listpopupmenu.cpp:1358 +#: listpopupmenu.cpp:1359 msgid "Interface..." msgstr "इंटरफेस..." -#: listpopupmenu.cpp:1359 +#: listpopupmenu.cpp:1360 msgid "Datatype..." msgstr "डाटाटाइप..." -#: listpopupmenu.cpp:1360 +#: listpopupmenu.cpp:1361 msgid "Enum..." msgstr "ईन्यूम" -#: listpopupmenu.cpp:1361 +#: listpopupmenu.cpp:1362 msgid "Package..." msgstr "पैकेज..." -#: listpopupmenu.cpp:1365 worktoolbar.cpp:323 +#: listpopupmenu.cpp:1366 worktoolbar.cpp:323 msgid "Initial State" msgstr "आरंभिक अवस्था" -#: listpopupmenu.cpp:1366 worktoolbar.cpp:325 +#: listpopupmenu.cpp:1367 worktoolbar.cpp:325 msgid "End State" msgstr "अंत अवस्था" -#: listpopupmenu.cpp:1367 +#: listpopupmenu.cpp:1368 #, fuzzy msgctxt "add new state" msgid "State..." msgstr "अवस्था..." -#: listpopupmenu.cpp:1368 worktoolbar.cpp:343 +#: listpopupmenu.cpp:1369 worktoolbar.cpp:343 msgid "Junction" msgstr "जंक्शन" -#: listpopupmenu.cpp:1369 worktoolbar.cpp:339 +#: listpopupmenu.cpp:1370 worktoolbar.cpp:339 msgid "Deep History" msgstr "डीप इतिहास" -#: listpopupmenu.cpp:1370 worktoolbar.cpp:340 +#: listpopupmenu.cpp:1371 worktoolbar.cpp:340 msgid "Shallow History" msgstr "शैलो इतिहास" -#: listpopupmenu.cpp:1371 +#: listpopupmenu.cpp:1372 #, fuzzy msgid "Choice" msgstr "चुनाव" -#: listpopupmenu.cpp:1372 worktoolbar.cpp:342 +#: listpopupmenu.cpp:1373 worktoolbar.cpp:342 msgid "Fork" msgstr "फ़ॉर्क" -#: listpopupmenu.cpp:1373 +#: listpopupmenu.cpp:1374 #, fuzzy msgid "Join" msgstr "शामिल हों" -#: listpopupmenu.cpp:1377 worktoolbar.cpp:355 +#: listpopupmenu.cpp:1378 worktoolbar.cpp:355 msgid "Initial Activity" msgstr "आरंभिक गतिविधि" -#: listpopupmenu.cpp:1378 worktoolbar.cpp:352 +#: listpopupmenu.cpp:1379 worktoolbar.cpp:352 msgid "End Activity" msgstr "अंतिम गतिविधि" -#: listpopupmenu.cpp:1379 listpopupmenu.cpp:1421 +#: listpopupmenu.cpp:1380 listpopupmenu.cpp:1422 msgid "Activity..." msgstr "क्रिया..." -#: listpopupmenu.cpp:1384 +#: listpopupmenu.cpp:1385 msgid "Subsystem..." msgstr "सबसिस्टम..." -#: listpopupmenu.cpp:1385 +#: listpopupmenu.cpp:1386 msgid "Component..." msgstr "अवयव..." -#: listpopupmenu.cpp:1386 +#: listpopupmenu.cpp:1387 msgid "Artifact..." msgstr "शिल्पतथ्य..." -#: listpopupmenu.cpp:1389 +#: listpopupmenu.cpp:1390 msgid "Node..." msgstr "नोड..." -#: listpopupmenu.cpp:1392 +#: listpopupmenu.cpp:1393 msgid "Entity..." msgstr "एंटिटी..." -#: listpopupmenu.cpp:1393 +#: listpopupmenu.cpp:1394 msgid "Category..." msgstr "वर्ग..." -#: listpopupmenu.cpp:1397 +#: listpopupmenu.cpp:1398 msgid "Object..." msgstr "वस्तु..." -#: listpopupmenu.cpp:1401 +#: listpopupmenu.cpp:1402 msgid "Attribute" msgstr "विशेषता" -#: listpopupmenu.cpp:1402 listpopupmenu.cpp:1406 +#: listpopupmenu.cpp:1403 listpopupmenu.cpp:1407 msgid "Operation" msgstr "ऑपरेशन" -#: listpopupmenu.cpp:1403 listpopupmenu.cpp:1407 +#: listpopupmenu.cpp:1404 listpopupmenu.cpp:1408 msgid "Template" msgstr "टेम्पलेट" -#: listpopupmenu.cpp:1410 +#: listpopupmenu.cpp:1411 msgid "Entity Attribute..." msgstr "एंटिटी गुणधर्म..." -#: listpopupmenu.cpp:1417 +#: listpopupmenu.cpp:1418 msgid "Enum Literal..." msgstr "ईन्यूम लिटरल..." -#: listpopupmenu.cpp:1845 +#: listpopupmenu.cpp:1846 msgid "Delete Anchor" msgstr "एंकर मिटाएँ" -#: listpopupmenu.cpp:1894 +#: listpopupmenu.cpp:1895 msgid "Undo" msgstr "पहले जैसा" -#: listpopupmenu.cpp:1895 +#: listpopupmenu.cpp:1896 msgid "Redo" msgstr "दोहराएँ" -#: listpopupmenu.cpp:1901 +#: listpopupmenu.cpp:1902 msgid "Clear Diagram" msgstr "आरेख साफ करें" -#: listpopupmenu.cpp:1905 +#: listpopupmenu.cpp:1906 msgid "Snap to Grid" msgstr "ग्रिड में स्नेप करें" -#: listpopupmenu.cpp:1907 +#: listpopupmenu.cpp:1908 msgid "Show Grid" msgstr "ग्रिड दिखाएँ" -#: listpopupmenu.cpp:1909 +#: listpopupmenu.cpp:1910 #, fuzzy #| msgid "Show operation signature" msgid "Show Documentation Indicator" msgstr "संचालन हस्ताक्षर दिखाएँ" -#: listpopupmenu.cpp:1921 +#: listpopupmenu.cpp:1922 msgid "Disjoint(Specialisation)" msgstr "डिस्जॉइन्ट(विशेषज्ञता)" -#: listpopupmenu.cpp:1922 +#: listpopupmenu.cpp:1923 msgid "Overlapping(Specialisation)" msgstr "ओवरलेपिंग (स्पेशियलाइज़ेशन)" -#: listpopupmenu.cpp:1923 +#: listpopupmenu.cpp:1924 msgid "Union" msgstr "संघ" @@ -4414,15 +4414,15 @@ msgid "Choose a different name." msgstr "भिन्न नाम इस्तेमाल करें (&U)" -#: toolbarstateassociation.cpp:178 toolbarstateassociation.cpp:244 +#: toolbarstateassociation.cpp:178 toolbarstateassociation.cpp:247 msgid "Incorrect use of associations." msgstr "सम्बद्धता का गलत उपयोग." -#: toolbarstateassociation.cpp:178 toolbarstateassociation.cpp:244 +#: toolbarstateassociation.cpp:178 toolbarstateassociation.cpp:247 msgid "Association Error" msgstr "सम्बद्धता त्रुटि" -#: toolbarstateother.cpp:250 umlscene.cpp:3068 widgets/activitywidget.cpp:363 +#: toolbarstateother.cpp:250 umlscene.cpp:3082 widgets/activitywidget.cpp:363 msgid "Enter Activity Name" msgstr "गतिविधि नाम भरें" @@ -4462,15 +4462,15 @@ msgid "new Combined Fragment" msgstr "नया एकीकृत फ्रेगमेंट" -#: toolbarstateother.cpp:279 umlscene.cpp:3033 widgets/statewidget.cpp:483 +#: toolbarstateother.cpp:279 umlscene.cpp:3047 widgets/statewidget.cpp:483 msgid "Enter State Name" msgstr "अवस्था नाम भरें" -#: toolbarstateother.cpp:280 umlscene.cpp:3034 widgets/statewidget.cpp:484 +#: toolbarstateother.cpp:280 umlscene.cpp:3048 widgets/statewidget.cpp:484 msgid "Enter the name of the new state:" msgstr "नई अवस्था का नाम भरें:" -#: toolbarstateother.cpp:280 umlscene.cpp:3035 +#: toolbarstateother.cpp:280 umlscene.cpp:3049 msgid "new state" msgstr "नई अवस्था" @@ -6125,74 +6125,74 @@ msgid "Name Not Valid" msgstr "नाम वैध नहीं है" -#: umlscene.cpp:497 +#: umlscene.cpp:511 #, kde-format msgid "Diagram: %2 Page %1" msgstr "आरेखः %2 पृष्ठ %1" -#: umlscene.cpp:1292 +#: umlscene.cpp:1306 #, fuzzy #| msgid "&Use fill color" msgid "Use fill color" msgstr "भराव रंग इस्तेमाल करें... (&U)" -#: umlscene.cpp:1294 +#: umlscene.cpp:1308 #, fuzzy #| msgid "Fill Color" msgid "No fill color" msgstr "भराव रंग" -#: umlscene.cpp:1309 +#: umlscene.cpp:1323 #, fuzzy #| msgid "Change Font" msgid "Change font" msgstr "फ़ॉन्ट बदलें" -#: umlscene.cpp:1323 +#: umlscene.cpp:1337 #, fuzzy #| msgid "Change Line Color" msgid "Change line color" msgstr "पंक्ति रंग बदलें" -#: umlscene.cpp:1341 +#: umlscene.cpp:1355 #, fuzzy #| msgid "Line width:" msgid "Change line width" msgstr "लकीर की चौड़ाई." -#: umlscene.cpp:1361 +#: umlscene.cpp:1375 #, fuzzy #| msgid "Change Fill Color" msgid "Change fill color" msgstr "भराव रंग बदलें" -#: umlscene.cpp:1376 +#: umlscene.cpp:1390 #, fuzzy #| msgid "Role Properties" msgid "Change visual property" msgstr "भूमिका गुण" -#: umlscene.cpp:1396 +#: umlscene.cpp:1410 #, fuzzy #| msgid "Delete" msgid "Delete widgets" msgstr "मिटाएँ" -#: umlscene.cpp:1447 +#: umlscene.cpp:1461 #, fuzzy #| msgid "Create widget :" msgid "Resize widgets" msgstr "विजेट बनाएँ :" -#: umlscene.cpp:3106 +#: umlscene.cpp:3120 msgid "Enter Diagram Name" msgstr "आरेख नाम भरें" -#: umlscene.cpp:3107 +#: umlscene.cpp:3121 msgid "Enter the new name of the diagram:" msgstr "आरेख का नया नाम भरें:" -#: umlscene.cpp:3282 +#: umlscene.cpp:3296 msgid "" "You are about to delete the entire diagram.\n" "Are you sure?" @@ -6200,7 +6200,7 @@ "आप सम्पूर्ण आरेख को मिटाने वाले हैं.\n" "क्या आप सुनिश्चित हैं?" -#: umlscene.cpp:3283 +#: umlscene.cpp:3297 msgid "Delete Diagram?" msgstr "आरेख मिटाएँ?" @@ -6247,31 +6247,31 @@ msgid "A problem occurred while saving diagram in %1" msgstr "डायग्राम को %1 पर सहेजने में एक समस्या आई" -#: widgets/associationwidget.cpp:3003 +#: widgets/associationwidget.cpp:3004 msgid "Multiplicity" msgstr "गुणनता" -#: widgets/associationwidget.cpp:3004 widgets/floatingtextwidget.cpp:377 +#: widgets/associationwidget.cpp:3005 widgets/floatingtextwidget.cpp:382 msgid "Enter multiplicity:" msgstr "गुणनता भरें:" -#: widgets/associationwidget.cpp:3021 +#: widgets/associationwidget.cpp:3022 msgid "Association Name" msgstr "सम्बद्धता नाम" -#: widgets/associationwidget.cpp:3022 widgets/floatingtextwidget.cpp:384 +#: widgets/associationwidget.cpp:3023 widgets/floatingtextwidget.cpp:389 msgid "Enter association name:" msgstr "सम्बद्धता नाम भरें:" -#: widgets/associationwidget.cpp:3041 +#: widgets/associationwidget.cpp:3042 msgid "Role Name" msgstr "भूमिका नाम" -#: widgets/associationwidget.cpp:3042 widgets/floatingtextwidget.cpp:375 +#: widgets/associationwidget.cpp:3043 widgets/floatingtextwidget.cpp:380 msgid "Enter role name:" msgstr "भूमिका नाम भरें:" -#: widgets/associationwidget.cpp:3710 +#: widgets/associationwidget.cpp:3711 msgid "Press Ctrl with left mouse click to delete a point" msgstr "" @@ -6327,25 +6327,25 @@ msgid "Enter the alternative:" msgstr "वैकल्पिक भरें :" -#: widgets/floatingtextwidget.cpp:190 +#: widgets/floatingtextwidget.cpp:194 msgid "Change Text" msgstr "पाठ बदलें" -#: widgets/floatingtextwidget.cpp:190 widgets/floatingtextwidget.cpp:386 +#: widgets/floatingtextwidget.cpp:194 widgets/floatingtextwidget.cpp:391 msgid "Enter new text:" msgstr "नया पाठ भरें:" -#: widgets/floatingtextwidget.cpp:388 +#: widgets/floatingtextwidget.cpp:393 msgid "ERROR" msgstr "त्रुटि" -#: widgets/floatingtextwidget.cpp:676 +#: widgets/floatingtextwidget.cpp:697 #, fuzzy msgctxt "operation name" msgid "Name" msgstr "नाम" -#: widgets/floatingtextwidget.cpp:677 +#: widgets/floatingtextwidget.cpp:698 msgid "Enter operation name:" msgstr "ऑपरेशन नाम भरें:" @@ -6451,11 +6451,11 @@ msgid "Enter the precondition :" msgstr "पूर्वशर्त भरें :" -#: widgets/signalwidget.cpp:321 +#: widgets/signalwidget.cpp:330 msgid "Enter signal name" msgstr "सिग्नल नाम भरें" -#: widgets/signalwidget.cpp:322 +#: widgets/signalwidget.cpp:331 msgid "Enter the signal name :" msgstr "सिग्नल नाम भरें :" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/display.po kde-l10n-hi-4.13.0/messages/kde-workspace/display.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/display.po 2013-09-28 03:15:27.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/display.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: display\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-09-28 01:42+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2007-10-21 12:15+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -18,26 +18,26 @@ "X-Generator: KBabel 1.11.4\n" "Plural-Forms: nplurals=2; plural=(n!=1);\n" -#: display.cpp:43 +#: display.cpp:44 msgid "Size && Orientation" msgstr "आकार एवं दिशा" -#: display.cpp:44 +#: display.cpp:45 msgid "Graphics Adaptor" msgstr "ग्राफिक्स एडाप्टर" -#: display.cpp:45 +#: display.cpp:46 msgid "3D Options" msgstr "3डी विकल्प" -#: display.cpp:46 +#: display.cpp:47 msgid "Monitor Gamma" msgstr "मॉनिटर गामा" -#: display.cpp:48 +#: display.cpp:49 msgid "Multiple Monitors" msgstr "अनेक मॉनिटर" -#: display.cpp:49 +#: display.cpp:50 msgid "Power Control" msgstr "ऊर्जा नियंत्रण" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/freespacenotifier.po kde-l10n-hi-4.13.0/messages/kde-workspace/freespacenotifier.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/freespacenotifier.po 2014-03-19 06:15:59.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/freespacenotifier.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: freespacenotifier\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-19 04:21+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-12-09 00:20+0530\n" "Last-Translator: G Karunakar\n" "Language-Team: Hindi <en@li.org>\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/joystick.po kde-l10n-hi-4.13.0/messages/kde-workspace/joystick.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/joystick.po 2013-09-28 03:15:27.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/joystick.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: joystick\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-09-28 01:42+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-12-09 00:23+0530\n" "Last-Translator: G Karunakar\n" "Language-Team: Hindi <en@li.org>\n" @@ -24,7 +24,7 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" #: caldialog.cpp:41 joywidget.cpp:380 msgid "Calibration" @@ -90,22 +90,22 @@ msgid "Value Axis %1: %2" msgstr "अक्ष मूल्य %1: %2" -#: joydevice.cpp:56 +#: joydevice.cpp:55 #, kde-format msgid "The given device %1 could not be opened: %2" msgstr "दिया गया उपकरण %1 खोला नहीं जा सका: %2" -#: joydevice.cpp:62 +#: joydevice.cpp:61 #, kde-format msgid "The given device %1 is not a joystick." msgstr "दिया गया उपकरण %1 जॉयस्टिक नहीं है." -#: joydevice.cpp:67 +#: joydevice.cpp:66 #, kde-format msgid "Could not get kernel driver version for joystick device %1: %2" msgstr "जॉयस्टिक उपकरण %1: के लिए कर्नेल ड्राइवर संस्करण प्राप्त नहीं कर सका %2" -#: joydevice.cpp:81 +#: joydevice.cpp:80 #, kde-format msgid "" "The current running kernel driver version (%1.%2.%3) is not the one this " @@ -114,54 +114,54 @@ "मौजूदा चल रहा कर्नेल ड्राइवर संस्करण है (%1.%2.%3) जो वह नहीं है जो कि (%4.%5.%6) के " "लिए कम्पाइल्ड है." -#: joydevice.cpp:93 +#: joydevice.cpp:92 #, kde-format msgid "Could not get number of buttons for joystick device %1: %2" msgstr "जॉयस्टिक उपकरण %1 के लिए बटनों की संख्या प्राप्त नहीं किया जा सका: %2" -#: joydevice.cpp:99 +#: joydevice.cpp:98 #, kde-format msgid "Could not get number of axes for joystick device %1: %2" msgstr "जॉयस्टिक उपकरण %1 के लिए अक्षों की संख्या प्राप्त नहीं किया जा सका: %2" -#: joydevice.cpp:105 +#: joydevice.cpp:104 #, kde-format msgid "Could not get calibration values for joystick device %1: %2" msgstr "जॉयस्टिक उपकरण %1 के लिए कैलिब्रेशम मान नहीं मिला: %2" -#: joydevice.cpp:111 +#: joydevice.cpp:110 #, kde-format msgid "Could not restore calibration values for joystick device %1: %2" msgstr "जॉयस्टिक उपकरण %1 के लिए कैलिब्रेशम मान पुनर्स्थापित नहीं किया जा सका: %2" -#: joydevice.cpp:117 +#: joydevice.cpp:116 #, kde-format msgid "Could not initialize calibration values for joystick device %1: %2" msgstr "जॉयस्टिक उपकरण %1 के लिए कैलिब्रेशम मान प्रारंभ नहीं किया जा सका: %2" -#: joydevice.cpp:123 +#: joydevice.cpp:122 #, kde-format msgid "Could not apply calibration values for joystick device %1: %2" msgstr "जॉयस्टिक उपकरण %1 के लिए कैलिब्रेशम मान लागू नहीं किया जा सका: %2" -#: joydevice.cpp:127 +#: joydevice.cpp:126 #, kde-format msgid "internal error - code %1 unknown" msgstr "आंतरिक त्रुटि - कोड %1 अज्ञात" -#: joystick.cpp:47 +#: joystick.cpp:48 msgid "KDE Joystick Control Module" msgstr "केडीई जॉयस्टिक नियंत्रण मॉड्यूल" -#: joystick.cpp:48 +#: joystick.cpp:49 msgid "KDE System Settings Module to test Joysticks" msgstr "जॉयस्टिक को जाँचने का एक केडीई नियंत्रण केंद्र मॉड्यूल " -#: joystick.cpp:49 +#: joystick.cpp:50 msgid "(c) 2004, Martin Koller" msgstr "(c) 2004, मार्टिन कोलर" -#: joystick.cpp:52 +#: joystick.cpp:53 msgid "" "<h1>Joystick</h1>This module helps to check if your joystick is working " "correctly.<br />If it delivers wrong values for the axes, you can try to " diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kaccess.po kde-l10n-hi-4.13.0/messages/kde-workspace/kaccess.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kaccess.po 2013-10-18 03:26:37.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kaccess.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kaccess\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-10-18 01:42+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-12-29 02:51+0530\n" "Last-Translator: G Karunakar\n" "Language-Team: Hindi <en@li.org>\n" @@ -24,234 +24,234 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" -#: kaccess.cpp:47 +#: kaccess.cpp:48 msgid "" "The Shift key has been locked and is now active for all of the following " "keypresses." msgstr "शिफ़्ट कुंजी ताला बंद है और अभी निम्न कीप्रेस हेतु सक्रिय रहेगा" -#: kaccess.cpp:48 +#: kaccess.cpp:49 msgid "The Shift key is now active." msgstr "शिफ़्ट कुंजी अभी सक्रिय है" -#: kaccess.cpp:49 +#: kaccess.cpp:50 msgid "The Shift key is now inactive." msgstr "शिफ़्ट कुंजी अभी अक्रिय है" -#: kaccess.cpp:51 +#: kaccess.cpp:52 msgid "" "The Control key has been locked and is now active for all of the following " "keypresses." msgstr "कंट्रोल कुंजी ताला बंद है और अभी निम्न कीप्रेस हेतु सक्रिय रहेगा" -#: kaccess.cpp:52 +#: kaccess.cpp:53 msgid "The Control key is now active." msgstr "कंट्रोल कुंजी अभी सक्रिय है" -#: kaccess.cpp:53 +#: kaccess.cpp:54 msgid "The Control key is now inactive." msgstr "कंट्रोल कुंजी अभी अक्रिय है" -#: kaccess.cpp:55 +#: kaccess.cpp:56 msgid "" "The Alt key has been locked and is now active for all of the following " "keypresses." msgstr "ऑल्ट कुंजी ताला बंद है और अभी निम्न कीप्रेस हेतु सक्रिय रहेगा" -#: kaccess.cpp:56 +#: kaccess.cpp:57 msgid "The Alt key is now active." msgstr "ऑल्ट कुंजी अभी सक्रिय है" -#: kaccess.cpp:57 +#: kaccess.cpp:58 msgid "The Alt key is now inactive." msgstr "ऑल्ट कुंजी अभी अक्रिय है" -#: kaccess.cpp:59 +#: kaccess.cpp:60 msgid "" "The Win key has been locked and is now active for all of the following " "keypresses." msgstr "विन कुंजी ताला बंद है और अभी निम्न कीप्रेस हेतु सक्रिय रहेगा" -#: kaccess.cpp:60 +#: kaccess.cpp:61 msgid "The Win key is now active." msgstr "विन कुंजी अभी सक्रिय है" -#: kaccess.cpp:61 +#: kaccess.cpp:62 msgid "The Win key is now inactive." msgstr "विन कुंजी अभी अक्रिय है" -#: kaccess.cpp:63 +#: kaccess.cpp:64 msgid "" "The Meta key has been locked and is now active for all of the following " "keypresses." msgstr "मेटा कुंजी ताला बंद है और अभी निम्न कीप्रेस हेतु सक्रिय रहेगा" -#: kaccess.cpp:64 +#: kaccess.cpp:65 msgid "The Meta key is now active." msgstr "मेटा कुंजी अभी सक्रिय है" -#: kaccess.cpp:65 +#: kaccess.cpp:66 msgid "The Meta key is now inactive." msgstr "मेटा कुंजी अभी अक्रिय है" -#: kaccess.cpp:67 +#: kaccess.cpp:68 msgid "" "The Super key has been locked and is now active for all of the following " "keypresses." msgstr "सुपर कुंजी ताला बंद है और अभी निम्न कीप्रेस हेतु सक्रिय रहेगा" -#: kaccess.cpp:68 +#: kaccess.cpp:69 msgid "The Super key is now active." msgstr "सुपर कुंजी अभी सक्रिय है" -#: kaccess.cpp:69 +#: kaccess.cpp:70 msgid "The Super key is now inactive." msgstr "सुपर कुंजी अभी अक्रिय है" -#: kaccess.cpp:71 +#: kaccess.cpp:72 msgid "" "The Hyper key has been locked and is now active for all of the following " "keypresses." msgstr "हायपर कुंजी ताला बंद है और अभी निम्न कीप्रेस हेतु सक्रिय रहेगा" -#: kaccess.cpp:72 +#: kaccess.cpp:73 msgid "The Hyper key is now active." msgstr "हायपर कुंजी अभी सक्रिय है" -#: kaccess.cpp:73 +#: kaccess.cpp:74 msgid "The Hyper key is now inactive." msgstr "हायपर कुंजी अभी अक्रिय है" -#: kaccess.cpp:75 +#: kaccess.cpp:76 msgid "" "The Alt Graph key has been locked and is now active for all of the following " "keypresses." msgstr "ऑल्ट ग्राफ कुंजी ताला बंद है और अभी निम्न कीप्रेस हेतु सक्रिय रहेगा" -#: kaccess.cpp:76 +#: kaccess.cpp:77 msgid "The Alt Graph key is now active." msgstr "ऑल्ट ग्राफ कुंजी अभी सक्रिय है" -#: kaccess.cpp:77 +#: kaccess.cpp:78 msgid "The Alt Graph key is now inactive." msgstr "ऑल्ट ग्राफ कुंजी अभी अक्रिय है" -#: kaccess.cpp:79 +#: kaccess.cpp:80 msgid "The Num Lock key has been activated." msgstr "न्यूम लॉक कुंजी सक्रिय किया जा चुका है" -#: kaccess.cpp:81 +#: kaccess.cpp:82 msgid "The Num Lock key is now inactive." msgstr "न्यूम लॉक कुंजी अब अक्रिय है" -#: kaccess.cpp:83 +#: kaccess.cpp:84 msgid "The Caps Lock key has been activated." msgstr "कैप्स लॉक कुंजी सक्रिय किया जा चुका है" -#: kaccess.cpp:85 +#: kaccess.cpp:86 msgid "The Caps Lock key is now inactive." msgstr "कैप्स लॉक कुंजी अब अक्रिय है" -#: kaccess.cpp:87 +#: kaccess.cpp:88 msgid "The Scroll Lock key has been activated." msgstr "स्क्रॉल लॉक कुंजी सक्रिय किया जा चुका है" -#: kaccess.cpp:89 +#: kaccess.cpp:90 msgid "The Scroll Lock key is now inactive." msgstr "स्क्रॉल लॉक कुंजी अब अक्रिय है" -#: kaccess.cpp:564 +#: kaccess.cpp:563 msgid "AltGraph" msgstr "आल्ट-ग्राफ" -#: kaccess.cpp:566 +#: kaccess.cpp:565 msgid "Hyper" msgstr "हाइपर" -#: kaccess.cpp:568 +#: kaccess.cpp:567 msgid "Super" msgstr "सुपर" -#: kaccess.cpp:570 +#: kaccess.cpp:569 msgid "Meta" msgstr "मेटा" -#: kaccess.cpp:586 +#: kaccess.cpp:585 msgid "Warning" msgstr "चेतावनी" -#: kaccess.cpp:627 +#: kaccess.cpp:626 msgid "&When a gesture was used:" msgstr "जब एक मुख_मुद्रा इस्तेमाल किया जाए (&W) :" -#: kaccess.cpp:633 +#: kaccess.cpp:632 msgid "Change Settings Without Asking" msgstr "विन्यास में परिवर्तनों को बिना पूछे लागू करें" -#: kaccess.cpp:634 +#: kaccess.cpp:633 msgid "Show This Confirmation Dialog" msgstr "इस पुष्टिकरण संवाद को दिखाएँ" -#: kaccess.cpp:635 +#: kaccess.cpp:634 msgid "Deactivate All AccessX Features & Gestures" msgstr "सभी एक्सेसएक्स विशेषताओं व मुखमुद्राओं को अक्रिय करें" -#: kaccess.cpp:673 kaccess.cpp:675 +#: kaccess.cpp:672 kaccess.cpp:674 msgid "Sticky keys" msgstr "चिपकती कुंजियाँ " -#: kaccess.cpp:678 kaccess.cpp:680 +#: kaccess.cpp:677 kaccess.cpp:679 msgid "Slow keys" msgstr "धीमी कुंजियाँ " -#: kaccess.cpp:683 kaccess.cpp:685 +#: kaccess.cpp:682 kaccess.cpp:684 msgid "Bounce keys" msgstr "उछलती (बाउंस) कुंजियाँ" -#: kaccess.cpp:688 kaccess.cpp:690 +#: kaccess.cpp:687 kaccess.cpp:689 msgid "Mouse keys" msgstr "माउस कुंजियाँ" -#: kaccess.cpp:695 +#: kaccess.cpp:694 #, kde-format msgid "Do you really want to deactivate \"%1\"?" msgstr "क्या आप सचमुच \"%1\" को अक्रिय करना चाहते हैं?" -#: kaccess.cpp:698 +#: kaccess.cpp:697 #, kde-format msgid "Do you really want to deactivate \"%1\" and \"%2\"?" msgstr "क्या आप सचमुच \"%1\" तथा \"%2\" को अक्रिय करना चाहते हैं?" -#: kaccess.cpp:701 +#: kaccess.cpp:700 #, kde-format msgid "Do you really want to deactivate \"%1\", \"%2\" and \"%3\"?" msgstr "क्या आप सचमुच \"%1\", \"%2\" तथा \"%3\" को अक्रिय करना चाहते हैं?" -#: kaccess.cpp:705 +#: kaccess.cpp:704 #, kde-format msgid "Do you really want to deactivate \"%1\", \"%2\", \"%3\" and \"%4\"?" msgstr "क्या आप सचमुच \"%1\", \"%2\", \"%3\" तथा \"%4\" को अक्रिय करना चाहते हैं?" -#: kaccess.cpp:712 +#: kaccess.cpp:711 #, kde-format msgid "Do you really want to activate \"%1\"?" msgstr "क्या आप सचमुच \"%1\" को सक्रिय करना चाहते हैं?" -#: kaccess.cpp:715 +#: kaccess.cpp:714 #, kde-format msgid "Do you really want to activate \"%1\" and to deactivate \"%2\"?" msgstr "क्या आप सचमुच \"%1\" को सक्रिय तथा \"%2\" को अक्रिय करना चाहते हैं?" -#: kaccess.cpp:718 +#: kaccess.cpp:717 #, kde-format msgid "" "Do you really want to activate \"%1\" and to deactivate \"%2\" and \"%3\"?" msgstr "" "क्या आप सचमुच \"%1\" को सक्रिय तथा \"%2\" तथा \"%3\" को अक्रिय करना चाहते हैं?" -#: kaccess.cpp:722 +#: kaccess.cpp:721 #, kde-format msgid "" "Do you really want to activate \"%1\" and to deactivate \"%2\", \"%3\" and " @@ -260,19 +260,19 @@ "क्या आप सचमुच \"%1\" को सक्रिय तथा \"%2\", \"%3\" तथा \"%4\" को अक्रिय करना चाहते " "हैं?" -#: kaccess.cpp:729 +#: kaccess.cpp:728 #, kde-format msgid "Do you really want to activate \"%1\" and \"%2\"?" msgstr "क्या आप सचमुच \"%1\" तथा \"%2\" को सक्रिय करना चाहते हैं?" -#: kaccess.cpp:732 +#: kaccess.cpp:731 #, kde-format msgid "" "Do you really want to activate \"%1\" and \"%2\" and to deactivate \"%3\"?" msgstr "" "क्या आप सचमुच \"%1\" तथा \"%2\" को सक्रिय हैं तथा \"%3\" को अक्रिय करना चाहते हैं?" -#: kaccess.cpp:736 +#: kaccess.cpp:735 #, kde-format msgid "" "Do you really want to activate \"%1\", and \"%2\" and to deactivate \"%3\" " @@ -281,12 +281,12 @@ "क्या आप सचमुच \"%1\", तथा \"%2\" को सक्रिय तथा \"%3\" तथा \"%4\" को अक्रिय करना " "चाहते हैं?" -#: kaccess.cpp:743 +#: kaccess.cpp:742 #, kde-format msgid "Do you really want to activate \"%1\", \"%2\" and \"%3\"?" msgstr "क्या आप सचमुच \"%1\", \"%2\" तथा \"%3\" को सक्रिय करना चाहते हैं?" -#: kaccess.cpp:747 +#: kaccess.cpp:746 #, kde-format msgid "" "Do you really want to activate \"%1\", \"%2\" and \"%3\" and to deactivate " @@ -295,16 +295,16 @@ "क्या आप सचमुच \"%1\", \"%2\" तथा \"%3\" को सक्रिय तथा \"%4\" को अक्रिय करना चाहते " "हैं?" -#: kaccess.cpp:753 +#: kaccess.cpp:752 #, kde-format msgid "Do you really want to activate \"%1\", \"%2\", \"%3\" and \"%4\"?" msgstr "क्या आप सचमुच \"%1\", \"%2\", \"%3\" तथा \"%4\" को सक्रिय करना चाहते हैं?" -#: kaccess.cpp:760 +#: kaccess.cpp:759 msgid "An application has requested to change this setting." msgstr "एक अनुप्रयोग ने इस सेटिंग को बदलने के लिए निवेदन किया है." -#: kaccess.cpp:764 +#: kaccess.cpp:763 msgid "" "You held down the Shift key for 8 seconds or an application has requested to " "change this setting." @@ -312,7 +312,7 @@ "या तो आपने शिफ़्ट कुंजी को ८ सेकण्ड के लिए दबाया हुआ था या किसी अनुप्रयोग ने इस सेटिंग को " "बदलने के लिए पूछा है." -#: kaccess.cpp:766 +#: kaccess.cpp:765 msgid "" "You pressed the Shift key 5 consecutive times or an application has " "requested to change this setting." @@ -320,12 +320,12 @@ "आपने शिफ़्ट कुंजी को लगातार ५ बार दबाया है या किसी अनुप्रयोग ने इस विन्यास को बदलने के " "लिए निवेदन किया है." -#: kaccess.cpp:770 +#: kaccess.cpp:769 #, kde-format msgid "You pressed %1 or an application has requested to change this setting." msgstr "आपने %1 को दबाया या किसी अनुप्रयोग ने इस सेटिंग को बदलने के लिए पूछा है." -#: kaccess.cpp:776 +#: kaccess.cpp:775 msgid "" "An application has requested to change these settings, or you used a " "combination of several keyboard gestures." @@ -333,11 +333,11 @@ "किसी अनुप्रयोग ने इन सेटिंग को बदलने के लिए पूछा है या आपने बहुत से कुंजीपट मुखमुद्राओं के " "संयोजन का इस्तेमाल किया है" -#: kaccess.cpp:778 +#: kaccess.cpp:777 msgid "An application has requested to change these settings." msgstr "किसी अनुप्रयोग ने इन विन्यासों को बदलने के लिए पूछा है." -#: kaccess.cpp:783 +#: kaccess.cpp:782 msgid "" "These AccessX settings are needed for some users with motion impairments and " "can be configured in the KDE System Settings. You can also turn them on and " @@ -347,7 +347,7 @@ "and gestures\"." msgstr "" -#: kaccess.cpp:800 +#: kaccess.cpp:799 msgid "" "Slow keys has been enabled. From now on, you need to press each key for a " "certain length of time before it gets accepted." @@ -355,11 +355,11 @@ "धीमी कुंजियाँ सक्षम की गई हैं. अब से आपको प्रत्येक कुंजी को एक निश्चित देर तक दबाना होगा " "ताकि वो स्वीकारा जा सकें" -#: kaccess.cpp:802 +#: kaccess.cpp:801 msgid "Slow keys has been disabled." msgstr "धीमी कुंजियाँ अक्षम की गई हैं" -#: kaccess.cpp:805 +#: kaccess.cpp:804 msgid "" "Bounce keys has been enabled. From now on, each key will be blocked for a " "certain length of time after it was used." @@ -367,11 +367,11 @@ "बाउंस कुंजियाँ सक्षम की गई हैं. अब से प्रत्येक कुंजी को उसके निश्चित इस्तेमाल की संख्या के बाद " "अवरोधित कर दिया जाएगा." -#: kaccess.cpp:807 +#: kaccess.cpp:806 msgid "Bounce keys has been disabled." msgstr "बाउंस कुंजियाँ अक्षम की गई हैं" -#: kaccess.cpp:810 +#: kaccess.cpp:809 msgid "" "Sticky keys has been enabled. From now on, modifier keys will stay latched " "after you have released them." @@ -379,11 +379,11 @@ "चिपकती कुंजियाँ सक्षम की गई हैं. अब से आपके द्वारा रिलीज किए जाने के बाद मॉडीफायर कुंजियां " "लैच्ड रहेंगी." -#: kaccess.cpp:812 +#: kaccess.cpp:811 msgid "Sticky keys has been disabled." msgstr "चिपकती कुंजियाँ अक्षम की गई हैं" -#: kaccess.cpp:815 +#: kaccess.cpp:814 msgid "" "Mouse keys has been enabled. From now on, you can use the number pad of your " "keyboard in order to control the mouse." @@ -391,26 +391,26 @@ "माउस कुंजियां सक्षम की गई हैं. अब से आप अपने कुंजीपट के नंबर पैड का इस्तेमाल माउस संकेतक को " "नियंत्रित करने के लिए कर सकते हैं." -#: kaccess.cpp:817 +#: kaccess.cpp:816 msgid "Mouse keys has been disabled." msgstr "माउस कुंजियाँ अक्षम की गई हैं" -#: main.cpp:12 +#: main.cpp:9 msgid "kaccess" msgstr "के-एक्सेस" -#: main.cpp:12 +#: main.cpp:9 msgid "KDE Accessibility Tool" msgstr "केडीई पहुँच औज़ार" -#: main.cpp:14 +#: main.cpp:11 msgid "(c) 2000, Matthias Hoelzer-Kluepfel" msgstr "(c) 2000, मैथियास होल्ज़र-क्लूपफेल" -#: main.cpp:16 +#: main.cpp:13 msgid "Matthias Hoelzer-Kluepfel" msgstr "मैथियास होल्ज़र-क्लूपफेल" -#: main.cpp:16 +#: main.cpp:13 msgid "Author" msgstr "लेखक" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kblankscrn.po kde-l10n-hi-4.13.0/messages/kde-workspace/kblankscrn.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kblankscrn.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kblankscrn.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,43 @@ +# translation of kblankscrn.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007. +msgid "" +msgstr "" +"Project-Id-Version: kblankscrn\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2007-10-21 14:14+0530\n" +"Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" + +msgctxt "NAME OF TRANSLATORS" +msgid "Your names" +msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर" + +msgctxt "EMAIL OF TRANSLATORS" +msgid "Your emails" +msgstr "raviratlami@aol.in" + +#: blankscrn.cpp:33 +msgid "KBlankScreen" +msgstr "के-ब्लैंक-स्क्रीन" + +#: blankscrn.cpp:34 +msgid "Blank Screen Saver" +msgstr "ब्लैंक स्क्रीन सेवर" + +#: blankscrn.cpp:62 +msgid "Setup Blank Screen Saver" +msgstr "ब्लैंक स्क्रीन सेवर सेटअप करें" + +#: blankscrn.cpp:73 +msgid "Color:" +msgstr "रंगः" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmaccess.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmaccess.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmaccess.po 2013-10-18 03:26:37.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmaccess.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcmaccess\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-10-18 01:42+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-12-29 02:49+0530\n" "Last-Translator: G Karunakar\n" "Language-Team: Hindi <en@li.org>\n" @@ -24,93 +24,93 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" -#: kcmaccess.cpp:129 +#: kcmaccess.cpp:126 msgid "AltGraph" msgstr "आल्ट-ग्राफ" -#: kcmaccess.cpp:131 +#: kcmaccess.cpp:128 msgid "Hyper" msgstr "हाइपर" -#: kcmaccess.cpp:133 +#: kcmaccess.cpp:130 msgid "Super" msgstr "सुपर" -#: kcmaccess.cpp:147 +#: kcmaccess.cpp:144 #, kde-format msgid "Press %1 while NumLock, CapsLock and ScrollLock are active" msgstr "जब न्यूम-लॉक, स्क्रॉल-लॉक तथा केप्स-लॉक सक्रिय हों तो %1 दबाएँ" -#: kcmaccess.cpp:149 +#: kcmaccess.cpp:146 #, kde-format msgid "Press %1 while CapsLock and ScrollLock are active" msgstr "जब स्क्रॉल-लॉक तथा केप्स-लॉक सक्रिय हों तो %1 दबाएँ" -#: kcmaccess.cpp:151 +#: kcmaccess.cpp:148 #, kde-format msgid "Press %1 while NumLock and ScrollLock are active" msgstr "जब न्यूम-लॉक तथा स्क्रॉल-लॉक सक्रिय हों तो %1 दबाएँ" -#: kcmaccess.cpp:153 +#: kcmaccess.cpp:150 #, kde-format msgid "Press %1 while ScrollLock is active" msgstr "जब स्क्रॉल-लॉक सक्रिय हो तो %1 दबाएँ" -#: kcmaccess.cpp:156 +#: kcmaccess.cpp:153 #, kde-format msgid "Press %1 while NumLock and CapsLock are active" msgstr "जब न्यूम-लॉक तथा केप्स-लॉक सक्रिय हों तो %1 दबाएँ" -#: kcmaccess.cpp:158 +#: kcmaccess.cpp:155 #, kde-format msgid "Press %1 while CapsLock is active" msgstr "जब केप्स-लॉक सक्रिय हो तो %1 दबाएँ" -#: kcmaccess.cpp:160 +#: kcmaccess.cpp:157 #, kde-format msgid "Press %1 while NumLock is active" msgstr "जब न्यूम-लॉक सक्रिय हो तो %1 दबाएँ" -#: kcmaccess.cpp:162 +#: kcmaccess.cpp:159 #, kde-format msgid "Press %1" msgstr "दबाएँ %1" -#: kcmaccess.cpp:172 +#: kcmaccess.cpp:169 msgid "kaccess" msgstr "के-एक्सेस" -#: kcmaccess.cpp:172 +#: kcmaccess.cpp:169 msgid "KDE Accessibility Tool" msgstr "केडीई पहुँच औज़ार" -#: kcmaccess.cpp:174 +#: kcmaccess.cpp:171 msgid "(c) 2000, Matthias Hoelzer-Kluepfel" msgstr "(c) 2000, मैथियास होल्ज़र-क्लूपफेल" -#: kcmaccess.cpp:176 +#: kcmaccess.cpp:173 msgid "Matthias Hoelzer-Kluepfel" msgstr "मैथियास होल्ज़र-क्लूपफेल" -#: kcmaccess.cpp:176 +#: kcmaccess.cpp:173 msgid "Author" msgstr "लेखक" -#: kcmaccess.cpp:190 +#: kcmaccess.cpp:187 msgid "Audible Bell" msgstr "सुनने योग्य घंटी" -#: kcmaccess.cpp:198 +#: kcmaccess.cpp:195 msgid "Use &system bell" msgstr "तंत्र घंटी इस्तेमाल करें (&s)" -#: kcmaccess.cpp:200 +#: kcmaccess.cpp:197 msgid "Us&e customized bell" msgstr "मनपसंद घंटी इस्तेमाल करें (&e)" -#: kcmaccess.cpp:202 +#: kcmaccess.cpp:199 msgid "" "If this option is checked, the default system bell will be used. See the " "\"System Bell\" control module for how to customize the system bell. " @@ -120,7 +120,7 @@ "Bell\" नियंत्रण मॉड्यूल तंत्र घंटी को मनपसंद बनाने के लिए. सामान्यतः यह बस एक छोटा सा " "बीप \"beep\" होता है." -#: kcmaccess.cpp:205 +#: kcmaccess.cpp:202 msgid "" "<p>Check this option if you want to use a customized bell, playing a sound " "file. If you do this, you will probably want to turn off the system bell.</" @@ -128,15 +128,15 @@ "event causing the bell and the sound being played.</p>" msgstr "" -#: kcmaccess.cpp:213 +#: kcmaccess.cpp:210 msgid "Sound &to play:" msgstr "बजाई जाने वाली ध्वनि. (&t)" -#: kcmaccess.cpp:217 +#: kcmaccess.cpp:214 msgid "Browse..." msgstr "ब्राउज़..." -#: kcmaccess.cpp:219 +#: kcmaccess.cpp:216 msgid "" "If the option \"Use customized bell\" is enabled, you can choose a sound " "file here. Click \"Browse...\" to choose a sound file using the file dialog." @@ -144,15 +144,15 @@ "यदि विकल्प \"मनपसंद घंटी इस्तेमाल करें\" सक्षम किया जाता है, आप यहाँ ध्वनि फ़ाइल चुन सकते " "हैं. फ़ाइल संवाद के उपयोग से ध्वनि फ़ाइल चुनने के लिए. क्लिक करें \"ब्राउज़...\" पर." -#: kcmaccess.cpp:236 +#: kcmaccess.cpp:233 msgid "Visible Bell" msgstr "दृश्यमय घंटी" -#: kcmaccess.cpp:244 +#: kcmaccess.cpp:241 msgid "&Use visible bell" msgstr "दृश्यमय घंटी इस्तेमाल करें (&U)" -#: kcmaccess.cpp:246 +#: kcmaccess.cpp:243 msgid "" "This option will turn on the \"visible bell\", i.e. a visible notification " "shown every time that normally just a bell would occur. This is especially " @@ -161,77 +161,77 @@ "यह विकल्प \"दृश्यमय घंटी\" को चालू करता है, यानी कि एक दृष्टिगोचर सूचना हर बार दिखेगी " "सिर्फ घंटी बजने के बजाए. यह बहरे व्यक्तियों के लिए विशेष उपयोगी है." -#: kcmaccess.cpp:253 +#: kcmaccess.cpp:250 msgid "I&nvert screen" msgstr "स्क्रीन उलटें (&n)" -#: kcmaccess.cpp:257 +#: kcmaccess.cpp:254 msgid "" "All screen colors will be inverted for the amount of time specified below." msgstr "सभी स्क्रीन रंग उल्लेखित समय के लिए उलटे हो जाएँगे." -#: kcmaccess.cpp:259 +#: kcmaccess.cpp:256 msgid "F&lash screen" msgstr "स्क्रीन फ्लैश करें (&l)" -#: kcmaccess.cpp:261 +#: kcmaccess.cpp:258 msgid "" "The screen will turn to a custom color for the amount of time specified " "below." msgstr "स्क्रीन रंग उल्लेखित समय के लिए मनपसंद रंग के हो जाएँगे." -#: kcmaccess.cpp:267 +#: kcmaccess.cpp:264 msgid "" "Click here to choose the color used for the \"flash screen\" visible bell." msgstr "\"फ्लैश स्क्रीन\" दृश्यमय घंटी के लिए उपयोग में आने वाले रंग चुनने के लिए यहाँ क्लिक करें." -#: kcmaccess.cpp:277 +#: kcmaccess.cpp:274 msgid "Duration:" msgstr "अवधिः" -#: kcmaccess.cpp:278 kcmaccess.cpp:392 kcmaccess.cpp:432 +#: kcmaccess.cpp:275 kcmaccess.cpp:389 kcmaccess.cpp:429 msgid " msec" msgstr "मि.से." -#: kcmaccess.cpp:280 +#: kcmaccess.cpp:277 msgid "" "Here you can customize the duration of the \"visible bell\" effect being " "shown." msgstr "यहाँ आप \"दृश्यमय घंटी\" के प्रभाव जो दिखाए जाते हैं, उनकी अवधि मनपसंद कर सकते हैं." -#: kcmaccess.cpp:297 +#: kcmaccess.cpp:294 msgid "&Bell" msgstr "घंटी (&B)" -#: kcmaccess.cpp:305 +#: kcmaccess.cpp:302 msgid "S&ticky Keys" msgstr "चिपकती कुंजियाँ (&t)" -#: kcmaccess.cpp:313 +#: kcmaccess.cpp:310 msgid "Use &sticky keys" msgstr "चिपकती कुंजियाँ इस्तेमाल करें (&s)" -#: kcmaccess.cpp:319 +#: kcmaccess.cpp:316 msgid "&Lock sticky keys" msgstr "चिपकती कुंजियाँ तालाबंद करें (&L)" -#: kcmaccess.cpp:325 +#: kcmaccess.cpp:322 msgid "Turn sticky keys off when two keys are pressed simultaneously" msgstr "जब दो कुंजियों को एक साथ दबाया जाए तो चिपकती कुंजियाँ अक्षम करें" -#: kcmaccess.cpp:331 +#: kcmaccess.cpp:328 msgid "Use system bell whenever a modifier gets latched, locked or unlocked" msgstr "जब कोई मॉडीफ़ॉयर लैच, तालाबंद या तालाखोला जाता है तो तंत्र घंटी बजाएँ" -#: kcmaccess.cpp:334 +#: kcmaccess.cpp:331 msgid "Locking Keys" msgstr "तालाबंद कुंजियाँ" -#: kcmaccess.cpp:342 +#: kcmaccess.cpp:339 msgid "Use system bell whenever a locking key gets activated or deactivated" msgstr "जब कोई तालाबंद कुंजी सक्रिय या अक्रिय किया जाता है तो तंत्र घंटी बजाएँ" -#: kcmaccess.cpp:345 +#: kcmaccess.cpp:342 msgid "" "Use KDE's system notification mechanism whenever a modifier or locking key " "changes its state" @@ -239,67 +239,67 @@ "जब भी मॉडीफ़ॉयर या तालाबंद कुंजी अपनी स्थिति बदलता है तो केडीई तंत्र सूचना सेवा इस्तेमाल " "करें" -#: kcmaccess.cpp:351 kcmaccess.cpp:518 +#: kcmaccess.cpp:348 kcmaccess.cpp:515 msgid "Configure &Notifications..." msgstr "अधिसूचना कॉन्फ़िगर करें ...(&N)" -#: kcmaccess.cpp:368 +#: kcmaccess.cpp:365 msgid "&Modifier Keys" msgstr "परिवर्धक कुंजियाँ (&M)" -#: kcmaccess.cpp:374 +#: kcmaccess.cpp:371 msgid "Slo&w Keys" msgstr "धीमी कुंजियाँ (&w)" -#: kcmaccess.cpp:382 +#: kcmaccess.cpp:379 msgid "&Use slow keys" msgstr "धीमी कुंजियाँ इस्तेमाल करें (&U)" -#: kcmaccess.cpp:393 +#: kcmaccess.cpp:390 msgid "Acceptance dela&y:" msgstr "स्वीकारने में देरी (&y):" -#: kcmaccess.cpp:399 +#: kcmaccess.cpp:396 msgid "&Use system bell whenever a key is pressed" msgstr "जब भी कोई कुंजी दबाया जाए तो तंत्र घंटी का इस्तेमाल करें (&U)" -#: kcmaccess.cpp:405 +#: kcmaccess.cpp:402 msgid "&Use system bell whenever a key is accepted" msgstr "जब भी कोई कुंजी स्वीकारा जाए तो तंत्र घंटी का इस्तेमाल करें (&U)" -#: kcmaccess.cpp:411 +#: kcmaccess.cpp:408 msgid "&Use system bell whenever a key is rejected" msgstr "जब भी कोई कुंजी अस्वीकारा जाए तो तंत्र घंटी का इस्तेमाल करें (&U)" -#: kcmaccess.cpp:414 +#: kcmaccess.cpp:411 msgid "Bounce Keys" msgstr "उछलती (बाउंस) कुंजियाँ" -#: kcmaccess.cpp:422 +#: kcmaccess.cpp:419 msgid "Use bou&nce keys" msgstr "उछलती (बाउंस) कुंजियाँ इस्तेमाल करें (&n)" -#: kcmaccess.cpp:433 +#: kcmaccess.cpp:430 msgid "D&ebounce time:" msgstr "डिबाउन्स समय (&e):" -#: kcmaccess.cpp:439 +#: kcmaccess.cpp:436 msgid "Use the system bell whenever a key is rejected" msgstr "जब भी कोई कुंजी अस्वीकारा जाए तो तंत्र घंटी इस्तेमाल करें" -#: kcmaccess.cpp:457 +#: kcmaccess.cpp:454 msgid "&Keyboard Filters" msgstr "कुंजीपट फिल्टर (&K)" -#: kcmaccess.cpp:464 kcmaccess.cpp:534 +#: kcmaccess.cpp:461 kcmaccess.cpp:531 msgid "Activation Gestures" msgstr "एक्टिवेशन गेस्चर" -#: kcmaccess.cpp:472 +#: kcmaccess.cpp:469 msgid "Use gestures for activating sticky keys and slow keys" msgstr "उपरोक्त विशेषताओं को सक्रिय करने के लिए गेस्चर्स उपयोग करें" -#: kcmaccess.cpp:476 +#: kcmaccess.cpp:473 msgid "" "Here you can activate keyboard gestures that turn on the following " "features: \n" @@ -310,7 +310,7 @@ "स्टिकी कुंजियाँ: शिफ़्ट कुंजी को लगातार 5 बार दबाएँ \n" "धीमी कुंजियाँ: शिफ़्ट को 8 सेकेण्ड तक दबाए रखें" -#: kcmaccess.cpp:480 +#: kcmaccess.cpp:477 #, kde-format msgid "" "Here you can activate keyboard gestures that turn on the following " @@ -324,31 +324,31 @@ "स्टिकी कुंजियाँ: शिफ़्ट कुंजी को लगातार 5 बार दबाएँ \n" "धीमी कुंजियाँ: शिफ़्ट को 8 सेकेण्ड तक दबाए रखें" -#: kcmaccess.cpp:485 +#: kcmaccess.cpp:482 msgid "" "Turn sticky keys and slow keys off after a certain period of inactivity." msgstr "निश्चित समय की अक्रियता के पश्चात् चिपकती व धीमी कुंजियाँ बन्द कर दें" -#: kcmaccess.cpp:492 +#: kcmaccess.cpp:489 msgid " min" msgstr "मि." -#: kcmaccess.cpp:494 +#: kcmaccess.cpp:491 msgid "Timeout:" msgstr "टाइम-आउटः" -#: kcmaccess.cpp:497 +#: kcmaccess.cpp:494 msgid "Notification" msgstr "अधिसूचना" -#: kcmaccess.cpp:505 +#: kcmaccess.cpp:502 msgid "" "Use the system bell whenever a gesture is used to turn an accessibility " "feature on or off" msgstr "" "जब भी किसी एक्सेसिबिलिटी विशेषताओं को चालू या बन्द किया जाए, तंत्र घंटी का इस्तेमाल करें" -#: kcmaccess.cpp:508 +#: kcmaccess.cpp:505 msgid "" "Show a confirmation dialog whenever a keyboard accessibility feature is " "turned on or off" @@ -356,7 +356,7 @@ "जब भी किसी कुंजीपट एक्सेसिबिलिटी विशेषताओं को चालू या बन्द किया जाए, पुष्टिकरण संवाद " "दिखाएँ" -#: kcmaccess.cpp:510 +#: kcmaccess.cpp:507 msgid "" "If this option is checked, KDE will show a confirmation dialog whenever a " "keyboard accessibility feature is turned on or off.\n" @@ -364,7 +364,7 @@ "accessibility settings will then always be applied without confirmation." msgstr "" -#: kcmaccess.cpp:512 +#: kcmaccess.cpp:509 msgid "" "Use KDE's system notification mechanism whenever a keyboard accessibility " "feature is turned on or off" @@ -372,5 +372,6 @@ "जब भी किसी कुंजीपट एक्सेसिबिलिटी विशेषताओं को चालू या बन्द किया जाए, केडीई तंत्र सूचना " "सेवा का इस्तेमाल करें" -#~ msgid "*.wav|WAV Files" -#~ msgstr "*.wav|वेव फ़ाइलें" +#: kcmaccess.cpp:558 +msgid "*.wav|WAV Files" +msgstr "*.wav|वेव फ़ाइलें" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcm_autostart.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcm_autostart.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcm_autostart.po 2014-03-21 04:12:46.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcm_autostart.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcm_autostart\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-21 02:05+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2008-07-08 10:12+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" "Language-Team: Hindi <Indlinux-hindi@lists.sourceforge.net>\n" @@ -24,55 +24,55 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" -#: addscriptdialog.cpp:40 +#: addscriptdialog.cpp:41 #, fuzzy #| msgid "Shell script:" msgid "Shell script path:" msgstr "शेल स्क्रिप्ट:" -#: addscriptdialog.cpp:44 +#: addscriptdialog.cpp:45 msgid "Create as symlink" msgstr "सिमलिंक के रूप में बनाएं" -#: addscriptdialog.cpp:79 +#: addscriptdialog.cpp:77 #, kde-format msgid "\"%1\" is not an absolute path." msgstr "" -#: addscriptdialog.cpp:82 +#: addscriptdialog.cpp:80 #, kde-format msgid "\"%1\" does not exist." msgstr "" -#: addscriptdialog.cpp:85 +#: addscriptdialog.cpp:83 #, kde-format msgid "\"%1\" is not a file." msgstr "" -#: addscriptdialog.cpp:88 +#: addscriptdialog.cpp:86 #, kde-format msgid "\"%1\" is not readable." msgstr "" -#: advanceddialog.cpp:32 +#: advanceddialog.cpp:34 msgid "Autostart only in KDE" msgstr "सिर्फ केडीई में स्वचालित चालू करें" -#: autostart.cpp:54 +#: autostart.cpp:58 msgid "Name" msgstr "नाम" -#: autostart.cpp:55 +#: autostart.cpp:59 msgid "Command" msgstr "कमांड" -#: autostart.cpp:56 +#: autostart.cpp:60 msgid "Status" msgstr "स्थिति" -#: autostart.cpp:57 +#: autostart.cpp:61 #, fuzzy #| msgid "Run On" msgctxt "" @@ -81,71 +81,71 @@ msgid "Run On" msgstr "तब चलाएँ" -#: autostart.cpp:74 +#: autostart.cpp:77 msgid "KDE Autostart Manager" msgstr "केडीई स्वचालित-प्रारंभ प्रबंधक" -#: autostart.cpp:76 +#: autostart.cpp:78 msgid "KDE Autostart Manager Control Panel Module" msgstr "केडीई स्वचालित-प्रारंभ प्रबंधक नियंत्रण फलक मॉड्यूल" -#: autostart.cpp:78 +#: autostart.cpp:80 #, fuzzy #| msgid "(c) 2006-2007-2008 Autostart Manager team" msgid "Copyright © 2006–2010 Autostart Manager team" msgstr "(c) 2006-2007-2008 स्वचालित-प्रारंभ प्रबंधक टोली" -#: autostart.cpp:79 +#: autostart.cpp:81 msgid "Stephen Leaf" msgstr "स्टीफन लीफ" -#: autostart.cpp:80 +#: autostart.cpp:82 msgid "Montel Laurent" msgstr "मोंटेल लारेंट" -#: autostart.cpp:80 +#: autostart.cpp:82 msgid "Maintainer" msgstr "मेंटेनर" -#: autostart.cpp:107 autostart.cpp:121 +#: autostart.cpp:109 autostart.cpp:123 #, fuzzy #| msgid "Disabled" msgctxt "The program won't be run" msgid "Disabled" msgstr "निष्क्रिय किया हुआ" -#: autostart.cpp:109 autostart.cpp:121 autostartitem.cpp:77 +#: autostart.cpp:111 autostart.cpp:123 autostartitem.cpp:77 #, fuzzy #| msgid "Enabled" msgctxt "The program will be run" msgid "Enabled" msgstr "सक्रिय किया हुआ" -#: autostart.cpp:145 +#: autostart.cpp:148 msgid "Startup" msgstr "प्रारंभ में" -#: autostart.cpp:146 +#: autostart.cpp:149 msgid "Shutdown" msgstr "बन्दकरें" -#: autostart.cpp:147 +#: autostart.cpp:150 msgid "Pre-KDE startup" msgstr "केडीई प्रारंभ होने से पहले" -#: autostart.cpp:152 +#: autostart.cpp:155 #, fuzzy #| msgid "Desktop file" msgid "Desktop File" msgstr "डेस्कटॉप फ़ाइल" -#: autostart.cpp:160 +#: autostart.cpp:163 #, fuzzy #| msgid "Script file" msgid "Script File" msgstr "स्क्रिप्ट फ़ाइल" -#: autostart.cpp:415 +#: autostart.cpp:417 #, fuzzy #| msgid "" #| "KDE only reads files with sh extensions for setting up the environment." diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmbackground.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmbackground.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmbackground.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmbackground.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,705 @@ +# translation of kcmbackground.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007. +msgid "" +msgstr "" +"Project-Id-Version: kcmbackground\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2007-10-17 13:50+0530\n" +"Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" + +#: bgadvanced.cpp:53 +msgid "Advanced Background Settings" +msgstr "विस्तृत पृष्ठभूमि विन्यास" + +#: bgadvanced.cpp:213 +#, kde-format +msgid "%1 min." +msgstr "%1 मि." + +#: bgadvanced.cpp:247 +msgid "" +"Unable to remove the program: the program is global and can only be removed " +"by the system administrator." +msgstr "" +"प्रोग्राम मिटा पाने में अक्षम: प्रोग्राम वैश्विक है तथा सिर्फ तंत्र प्रशासक द्वारा ही मिटाया " +"जा सकेगा." + +#: bgadvanced.cpp:249 +msgid "Cannot Remove Program" +msgstr "प्रोग्राम मिटा नहीं सका" + +#: bgadvanced.cpp:253 +#, kde-format +msgid "Are you sure you want to remove the program `%1'?" +msgstr "क्या आप वाक़ई प्रोग्राम `%1' को मिटाना चाहते हैं?" + +#: bgadvanced.cpp:255 +msgid "Remove Background Program" +msgstr "पृष्ठ भूमि प्रोग्राम मिटाएँ" + +#. i18n: ectx: property (text), widget (QPushButton, m_buttonRemove) +#: bgadvanced.cpp:256 bgadvanced_ui.ui:47 bgwallpaper_ui.ui:115 +msgid "&Remove" +msgstr "मिटाएँ (&R)" + +#: bgadvanced.cpp:339 +msgid "Configure Background Program" +msgstr "पृष्ठ भूमि प्रोग्राम कॉन्फ़िगर करें" + +#: bgadvanced.cpp:350 +msgid "&Name:" +msgstr "नाम: (&N)" + +#: bgadvanced.cpp:356 +msgid "Co&mment:" +msgstr "टिप्पणीः (&m)" + +#: bgadvanced.cpp:362 +msgid "Comman&d:" +msgstr "कमांड (&d)" + +#: bgadvanced.cpp:368 +msgid "&Preview cmd:" +msgstr "पूर्वावलोकन कमांडः (&P)" + +#: bgadvanced.cpp:374 +msgid "&Executable:" +msgstr "चलाने-योग्यः (&E)" + +#: bgadvanced.cpp:380 +msgid "&Refresh time:" +msgstr "रिफ्रेश समय: (&R)" + +#: bgadvanced.cpp:385 +msgid " min" +msgstr "मि." + +#: bgadvanced.cpp:392 +msgid "New Command" +msgstr "नया कमांड" + +#: bgadvanced.cpp:395 +#, kde-format +msgid "New Command <%1>" +msgstr "नया कमांड <%1>" + +#: bgadvanced.cpp:422 +msgid "" +"You did not fill in the `Name' field.\n" +"This is a required field." +msgstr "" +"आपने 'नाम' फील्ड नहीं भरा.\n" +"यह एक आवश्यक फील्ड है." + +#: bgadvanced.cpp:430 +#, kde-format +msgid "" +"There is already a program with the name `%1'.\n" +"Do you want to overwrite it?" +msgstr "" +"इस नाम `%1' का प्रोग्राम पहले से ही मौजूद है. \n" +"क्या आप इसके ऊपर लिखना चाहते हैं?" + +#: bgadvanced.cpp:431 +msgid "Overwrite" +msgstr "मिटाकर लिखें" + +#: bgadvanced.cpp:437 +msgid "" +"You did not fill in the `Executable' field.\n" +"This is a required field." +msgstr "" +"आपने 'चलाने योग्य' फील्ड नहीं भरा.\n" +"यह एक आवश्यक फील्ड है." + +#: bgadvanced.cpp:442 +msgid "" +"You did not fill in the `Command' field.\n" +"This is a required field." +msgstr "" +"आपने 'कमांड' फील्ड नहीं भरा.\n" +"यह एक आवश्यक फील्ड है." + +#. i18n: ectx: property (title), widget (QGroupBox, m_groupProgram) +#: bgadvanced_ui.ui:16 +msgid "Background Program" +msgstr "पृष्ठभूमि प्रोग्राम" + +#. i18n: ectx: property (whatsThis), widget (QPushButton, m_buttonAdd) +#: bgadvanced_ui.ui:31 +msgid "" +"<qt>\n" +"<p>Click here if you want to add a program to the listbox. This button opens " +"a dialog where you are asked to give details about the program you want to " +"run. To successfully add a program, you must know if it is compatible, the " +"name of the executable file and, if necessary, its options.</p>\n" +"<p>You usually can get the available options to a suitable program by typing " +"in a terminal emulator the name of the executable file plus --help (foobar --" +"help).</p>\n" +"</qt>" +msgstr "" + +#. i18n: ectx: property (text), widget (QPushButton, m_buttonAdd) +#: bgadvanced_ui.ui:34 bgwallpaper_ui.ui:92 +msgid "&Add..." +msgstr "जोड़ें...(&A)" + +#. i18n: ectx: property (whatsThis), widget (QPushButton, m_buttonRemove) +#: bgadvanced_ui.ui:44 +msgid "" +"Click here to remove programs from this list. Please note that it does not " +"remove the program from your system, it only removes it from the available " +"options in the background drawing programs list." +msgstr "" + +#. i18n: ectx: property (whatsThis), widget (QPushButton, m_buttonModify) +#: bgadvanced_ui.ui:59 +msgid "" +"<qt>\n" +"<p>Click here to modify the programs options. You usually can get the " +"available options to a suitable program by typing in a terminal emulator the " +"name of the executable file plus --help. (example: kwebdesktop --help).</p>\n" +"</qt>" +msgstr "" + +#. i18n: ectx: property (text), widget (QPushButton, m_buttonModify) +#: bgadvanced_ui.ui:62 +msgid "&Modify..." +msgstr "सुधारें... (&M)" + +#. i18n: ectx: property (whatsThis), widget (QTreeWidget, m_listPrograms) +#: bgadvanced_ui.ui:101 +msgid "" +"<qt>\n" +"<p>Select from this listbox the program you want to use to draw your desktop " +"background.</p>\n" +"<p>The <b>Program</b> column shows the name of the program.<br>\n" +"The <b>Comment</b> column brings a short description.<br>\n" +"The <b>Refresh</b> column indicates the time interval between redraws of the " +"desktop.</p>\n" +"<p>You can also add new compliant programs. To do that, click on the <b>Add</" +"b> button.<br>\n" +"You can also remove programs from this list clicking on the <b>Remove</b> " +"button. Please note that it does not remove the program from your system, it " +"only removes it from the available options in this listbox.</p>\n" +"</qt>" +msgstr "" + +#. i18n: ectx: property (text), widget (QTreeWidget, m_listPrograms) +#: bgadvanced_ui.ui:105 +msgid "Program" +msgstr "प्रोग्राम" + +#. i18n: ectx: property (text), widget (QTreeWidget, m_listPrograms) +#: bgadvanced_ui.ui:110 +msgid "Comment" +msgstr "टिप्पणी" + +#. i18n: ectx: property (text), widget (QTreeWidget, m_listPrograms) +#: bgadvanced_ui.ui:115 +msgid "Refresh" +msgstr "ताज़ा करें" + +#. i18n: ectx: property (whatsThis), widget (QCheckBox, m_cbProgram) +#: bgadvanced_ui.ui:123 +msgid "" +"Check here if you want to allow a program to draw your desktop background. " +"Below you can find the list of programs currently available for drawing the " +"background. You may use one of the available programs, add new ones or " +"modify the existing ones to fit your needs." +msgstr "" + +#. i18n: ectx: property (text), widget (QCheckBox, m_cbProgram) +#: bgadvanced_ui.ui:126 +msgid "Use the following program for drawing the background:" +msgstr "पृष्ठ भूमि बनाने के लिए निम्न प्रोग्राम इस्तेमाल करें:" + +#. i18n: ectx: property (title), widget (QGroupBox, m_groupCache) +#: bgadvanced_ui.ui:136 +msgid "Memory Usage" +msgstr "मेमोरी उपयोग" + +#. i18n: ectx: property (whatsThis), widget (QLabel, m_lblCache) +#. i18n: ectx: property (whatsThis), widget (KIntSpinBox, m_spinCache) +#: bgadvanced_ui.ui:142 bgadvanced_ui.ui:155 +msgid "" +"In this box you can enter how much memory KDE should use for caching the " +"background(s). If you have different backgrounds for the different desktops " +"caching can make switching desktops smoother at the expense of higher memory " +"use." +msgstr "" + +#. i18n: ectx: property (text), widget (QLabel, m_lblCache) +#: bgadvanced_ui.ui:145 +msgid "Size of background cache:" +msgstr "पृष्ठभूमि कैश आकारः" + +#. i18n: ectx: property (suffix), widget (KIntSpinBox, m_spinCache) +#: bgadvanced_ui.ui:158 +#, fuzzy +#| msgid " KB" +msgid " KiB" +msgstr "कि.बा." + +#: bgdialog.cpp:110 +msgid "Open file dialog" +msgstr "फ़ाइल खोलने का संवाद" + +#: bgdialog.cpp:334 +msgid "" +"<p><h1>Background</h1> This module allows you to control the appearance of " +"the virtual desktops. KDE offers a variety of options for customization, " +"including the ability to specify different settings for each virtual " +"desktop, or a common background for all of them.</p> <p>The appearance of " +"the desktop results from the combination of its background colors and " +"patterns, and optionally, wallpaper, which is based on the image from a " +"graphic file.</p> <p>The background can be made up of a single color, or a " +"pair of colors which can be blended in a variety of patterns. Wallpaper is " +"also customizable, with options for tiling and stretching images. The " +"wallpaper can be overlaid opaquely, or blended in different ways with the " +"background colors and patterns.</p> <p>KDE allows you to have the wallpaper " +"change automatically at specified intervals of time. You can also replace " +"the background with a program that updates the desktop dynamically. For " +"example, the \"kdeworld\" program shows a day/night map of the world which " +"is updated periodically.</p>" +msgstr "" + +#: bgdialog.cpp:386 +#, kde-format +msgid "Screen %1" +msgstr "स्क्रीन %1" + +#: bgdialog.cpp:389 +msgid "Single Color" +msgstr "एक रंग" + +#: bgdialog.cpp:390 +msgid "Horizontal Gradient" +msgstr "क्षैतिज अनुपात" + +#: bgdialog.cpp:391 +msgid "Vertical Gradient" +msgstr "खड़ा अनुपात" + +#: bgdialog.cpp:392 +msgid "Pyramid Gradient" +msgstr "पिरामिड अनुपात" + +#: bgdialog.cpp:393 +msgid "Pipecross Gradient" +msgstr "पाइपक्रास अनुपात" + +#: bgdialog.cpp:394 +msgid "Elliptic Gradient" +msgstr "दीर्घवृत्त अनुपात" + +#: bgdialog.cpp:408 +msgid "Centered" +msgstr "केंद्रित" + +#: bgdialog.cpp:409 +msgid "Tiled" +msgstr "चटाई" + +#: bgdialog.cpp:410 +msgid "Center Tiled" +msgstr "मध्य चटाई" + +#: bgdialog.cpp:411 +msgid "Centered Maxpect" +msgstr "केंद्रित मेक्सपेक्ट" + +#: bgdialog.cpp:412 +msgid "Tiled Maxpect" +msgstr "चटाई मेक्सपेक्ट" + +#: bgdialog.cpp:413 +msgid "Scaled" +msgstr "स्केल्ड" + +#: bgdialog.cpp:414 +msgid "Centered Auto Fit" +msgstr "केंद्रित स्वतः फिट" + +#: bgdialog.cpp:415 +msgid "Scale & Crop" +msgstr "नया आकार तथा कांटछांट" + +#: bgdialog.cpp:418 +msgid "No Blending" +msgstr "कोई ब्लेंडिंग नहीं" + +#: bgdialog.cpp:419 +msgid "Flat" +msgstr "समतल" + +#: bgdialog.cpp:420 +msgid "Horizontal" +msgstr "आड़ा" + +#: bgdialog.cpp:421 +msgid "Vertical" +msgstr "खड़ा" + +#: bgdialog.cpp:422 +msgid "Pyramid" +msgstr "पिरामिड" + +#: bgdialog.cpp:423 +msgid "Pipecross" +msgstr "पाइपक्रास" + +#: bgdialog.cpp:424 +msgid "Elliptic" +msgstr "दीर्घवृत्त" + +#: bgdialog.cpp:425 +msgid "Intensity" +msgstr "तीव्रता" + +#: bgdialog.cpp:426 +msgid "Saturation" +msgstr "संतृप्ति" + +#: bgdialog.cpp:427 +msgid "Contrast" +msgstr "कंट्रास्ट" + +#: bgdialog.cpp:428 +msgid "Hue Shift" +msgstr "ह्यू शिफ्ट" + +#: bgdialog.cpp:563 +msgid "Select Wallpaper" +msgstr "वालपेपर चुनें" + +#. i18n: ectx: property (whatsThis), widget (QPushButton, m_buttonIdentifyScreens) +#: bgdialog_ui.ui:80 +msgid "Click this button to show the identifying number for each screen." +msgstr "" + +#. i18n: ectx: property (text), widget (QPushButton, m_buttonIdentifyScreens) +#: bgdialog_ui.ui:83 +msgid "Identify Screens" +msgstr "" + +#. i18n: ectx: property (whatsThis), widget (QPushButton, m_buttonAdvanced) +#: bgdialog_ui.ui:132 +msgid "" +"Click this button to set the icon text colors and shadow, set up a program " +"to run for the background picture or control the size of the background " +"cache." +msgstr "" +"प्रतीक पाठ रंग तथा छाया नियत करने के लिए इस बटन को क्लिक करें, तथा पृष्ठ भूमि छवि या " +"पृष्ठ भूमि कैश आकार सेट अप के लिए प्रोग्राम चलाए." + +#. i18n: ectx: property (text), widget (QPushButton, m_buttonAdvanced) +#: bgdialog_ui.ui:135 +msgid "Advanced Options" +msgstr "विस्तृत विकल्प" + +#. i18n: ectx: property (whatsThis), widget (QPushButton, m_buttonGetNew) +#: bgdialog_ui.ui:184 +msgid "" +"Click this button to give you a list of new wallpapers to download from the " +"Internet." +msgstr "" +"इंटरनेट से नए वालपेपर्स डाउनलोड करने के लिए इस बटन को क्लिक करें जो आपको इसके लिए एक " +"सूची प्रदान करेगा." + +#. i18n: ectx: property (text), widget (QPushButton, m_buttonGetNew) +#: bgdialog_ui.ui:187 +msgid "Get New Wallpapers" +msgstr "नया वालपेपर लाएँ" + +#. i18n: ectx: property (title), widget (QGroupBox, groupBox3) +#: bgdialog_ui.ui:232 +msgid "Options" +msgstr "विकल्प" + +#. i18n: ectx: property (whatsThis), widget (QLabel, m_lblWallpaperPos) +#. i18n: ectx: property (whatsThis), widget (QComboBox, m_comboWallpaperPos) +#: bgdialog_ui.ui:247 bgdialog_ui.ui:438 +msgid "" +"<qt>You can choose here how a background picture is shown on the desktop:\n" +"<ul>\n" +"<li><em>Centered:</em> Center the picture on the desktop.</li>\n" +" <li><em>Tiled:</em> Tile the picture beginning at the top left of the " +"desktop, so the desktop is totally covered up.</li>\n" +"<li><em>Center Tiled:</em> Center the picture on the desktop and then tile " +"around it so that the background is totally covered up.</li>\n" +"<li><em>Centered Maxpect:</em> Magnify the picture without distorting it " +"until it fills either the width or height of the desktop, and then center it " +"on the desktop.</li>\n" +"<li><em>Scaled:</em> Magnify the picture, until the entire desktop is " +"covered. This may result in some distortion of the picture.</li>\n" +"<li><em>Centered Auto Fit:</em> If the picture fits the desktop this mode " +"works like the Centered option. If the picture is larger than the desktop it " +"is scaled down to fit while keeping the aspect ratio.</li>\n" +"<li><em>Scale and Crop:</em> Magnify the picture without distorting it until " +"it fills both the width and height of the desktop (cropping the picture if " +"necessary), and then center it on the desktop.</li>\n" +"</ul></qt>" +msgstr "" + +#. i18n: ectx: property (text), widget (QLabel, m_lblWallpaperPos) +#: bgdialog_ui.ui:250 +msgid "Posi&tion:" +msgstr "स्थितिः (&t)" + +#. i18n: ectx: property (whatsThis), widget (QComboBox, m_comboBlend) +#: bgdialog_ui.ui:266 +msgid "" +"If you have selected to use a background picture you can choose various " +"methods of blending the background colors with the picture. The default " +"option of \"No Blending\" means that the picture simply obscures the " +"background colors below." +msgstr "" + +#. i18n: ectx: property (whatsThis), widget (KColorButton, m_colorPrimary) +#: bgdialog_ui.ui:275 +msgid "Click to choose the primary background color." +msgstr "प्राथमिक पृष्ठ भूमि रंग चुनने के लिए क्लिक करें." + +#. i18n: ectx: property (whatsThis), widget (KColorButton, m_colorSecondary) +#: bgdialog_ui.ui:285 +msgid "" +"Click to choose the secondary background color. If no secondary color is " +"required by the pattern selected this button will be disabled." +msgstr "" +"द्वैतियक पृष्ठ भूमि रंग चुनने के लिए क्लिक करें. यदि कोई द्वैतियक रंग चुने गए पैटर्न पर आवश्यक " +"नहीं होगा तो यह बटन अक्षम रहेगा." + +#. i18n: ectx: property (text), widget (QLabel, m_lblColors) +#: bgdialog_ui.ui:297 +msgid "Co&lors:" +msgstr "रंग: (&l)" + +#. i18n: ectx: property (text), widget (QLabel, m_lblBlending) +#: bgdialog_ui.ui:313 +msgid "&Blending:" +msgstr "ब्लेंडिंगः (&B)" + +#. i18n: ectx: property (whatsThis), widget (QLabel, m_lblBlendBalance) +#. i18n: ectx: property (whatsThis), widget (QSlider, m_sliderBlend) +#: bgdialog_ui.ui:331 bgdialog_ui.ui:347 +msgid "" +"You can use this slider to control the degree of blending. You can " +"experiment by moving the slider and looking at the effects in the preview " +"image." +msgstr "" +"इस स्लाइडर का उपयोग आप ब्लेंडिंग की श्रेणी नियंत्रित करने के लिए कर सकते हैं. आप स्लाइडर को " +"खिसकाकर प्रभाव का पूर्वावलोकन कर प्रयोग कर सकते हैं." + +#. i18n: ectx: property (text), widget (QLabel, m_lblBlendBalance) +#: bgdialog_ui.ui:334 +msgid "Balance:" +msgstr "संतुलनः" + +#. i18n: ectx: property (whatsThis), widget (QCheckBox, m_cbBlendReverse) +#: bgdialog_ui.ui:374 +msgid "" +"For some types of blending, you can reverse the role of the background and " +"the picture by checking this option." +msgstr "" +"इस विकल्प को चुनकर आप कुछ ब्लेंडिंग प्रकार के लिए, पृष्ठ भूमि तथा छवि की भूमिका को उलट " +"सकते हैं." + +#. i18n: ectx: property (text), widget (QCheckBox, m_cbBlendReverse) +#: bgdialog_ui.ui:377 +msgid "Reverse roles" +msgstr "विपरीत भूमिका" + +#. i18n: ectx: property (title), widget (KButtonGroup, m_buttonGroupBackground) +#: bgdialog_ui.ui:448 +msgid "Background" +msgstr "पृष्ठभूमि" + +#. i18n: ectx: property (toolTip), widget (QRadioButton, m_radioNoPicture) +#: bgdialog_ui.ui:454 +msgid "No picture, color only" +msgstr "कोई छवि नहीं, सिर्फ रंग" + +#. i18n: ectx: property (text), widget (QRadioButton, m_radioNoPicture) +#: bgdialog_ui.ui:457 +msgid "&No picture" +msgstr "कोई छवि नहीं (&N)" + +#. i18n: ectx: property (text), widget (QRadioButton, m_radioSlideShow) +#: bgdialog_ui.ui:464 +msgid "&Slide show:" +msgstr "स्लाइड शोः (&S)" + +#. i18n: ectx: property (text), widget (QRadioButton, m_radioPicture) +#: bgdialog_ui.ui:471 +msgid "&Picture:" +msgstr "छविः (&P)" + +#. i18n: ectx: property (whatsThis), widget (QPushButton, m_buttonSetupWallpapers) +#: bgdialog_ui.ui:497 +msgid "" +"Click this button to select a set of images to be used as background " +"pictures. One picture at a time will be shown for a specified amount of " +"time, after which another image from the set will be shown. Images can be " +"shown at random or in the order you specify them." +msgstr "" + +#. i18n: ectx: property (text), widget (QPushButton, m_buttonSetupWallpapers) +#: bgdialog_ui.ui:500 +msgid "Set&up..." +msgstr "सेट अप... (&u)" + +#. i18n: ectx: property (whatsThis), widget (KComboBox, m_comboScreen) +#: bgdialog_ui.ui:558 +msgid "" +"Choose the screen you wish to configure the background for from this list." +msgstr "" + +#. i18n: ectx: property (text), item, widget (KComboBox, m_comboScreen) +#: bgdialog_ui.ui:562 +msgid "Across All Screens" +msgstr "" + +#. i18n: ectx: property (text), item, widget (KComboBox, m_comboScreen) +#: bgdialog_ui.ui:567 +msgid "On Each Screen" +msgstr "" + +#: bgmonitor.cpp:51 +msgid "" +"This picture of a monitor contains a preview of what the current settings " +"will look like on your desktop." +msgstr "मॉनीटर का छवि पूर्वावलोकन रखता है कि मौज़ूदा विन्यास आपके डेस्कटॉप में कैसे दिखेगा." + +#: bgwallpaper.cpp:108 +msgid "Setup Slide Show" +msgstr "सेटअप स्लाइड शो" + +#: bgwallpaper.cpp:116 +#, fuzzy +#| msgid " min" +msgid " minute" +msgid_plural " minutes" +msgstr[0] "मि." +msgstr[1] "मि." + +#: bgwallpaper.cpp:164 +msgid "Select Image" +msgstr "छवि चुनें" + +#. i18n: ectx: property (text), widget (QLabel, textLabel2) +#: bgwallpaper_ui.ui:19 +msgid "Show the following pictures:" +msgstr "निम्न छवि दिखाएँ:" + +#. i18n: ectx: property (text), widget (QCheckBox, m_cbRandom) +#: bgwallpaper_ui.ui:29 +msgid "&Show pictures in random order" +msgstr "छवि बेतरतीब क्रम में दिखाएँ (&S)" + +#. i18n: ectx: property (text), widget (QLabel, textLabel1) +#: bgwallpaper_ui.ui:38 +msgid "Change &picture after:" +msgstr "के बाद छवि बदलें (&p)" + +#. i18n: ectx: property (text), widget (QPushButton, m_buttonMoveDown) +#: bgwallpaper_ui.ui:122 +msgid "Move &Down" +msgstr "नीचे जाएं (&D)" + +#. i18n: ectx: property (text), widget (QPushButton, m_buttonMoveUp) +#: bgwallpaper_ui.ui:129 +msgid "Move &Up" +msgstr "ऊपर जाएं (&U)" + +#~ msgid " k" +#~ msgstr "के" + +#~ msgid "Unlimited" +#~ msgstr "असीमित" + +#~ msgid "Background Icon Text" +#~ msgstr "पृष्ठभूमि प्रतीक पाठ" + +#~ msgid "Click here to change the color of the desktop font." +#~ msgstr "डेस्कटॉप फ़ॉन्ट रंग बदलने के लिए यहाँ क्लिक करें." + +#~ msgid "&Text color:" +#~ msgstr "पाठ रंगः (&T)" + +#~ msgid "" +#~ "Click here to select the solid background color. Choose a different color " +#~ "from the background text color to assure readability." +#~ msgstr "" +#~ "ठोस पृष्ठ भूमि रंग चुनने के लिए यहाँ क्लिक करें. पढ़ा जा सकने योग्य बनाने के लिए पृष्ठ भूमि " +#~ "पाठ रंग से भिन्न रंग इस्तेमाल करें." + +#~ msgid "&Use solid color behind text:" +#~ msgstr "पाठ के पीछे ठोस रंग इस्तेमाल करें: (&U)" + +#~ msgid "&Enable shadow" +#~ msgstr "आभा सक्षम करें (&E)" + +#~ msgid "&Lines for icon text:" +#~ msgstr "प्रतीक पाठ की पंक्तियाँ (&L)" + +#~ msgid "Auto" +#~ msgstr "स्वतः" + +#~ msgid "&Width for icon text:" +#~ msgstr "प्रतीक पाठ की चौड़ाई (&W)" + +#~ msgid "Setting for &desktop:" +#~ msgstr "डेस्कटॉप के लिए विन्यास (&d)" + +#~ msgid "All Desktops" +#~ msgstr "सभी डेस्कटॉप" + +#~ msgid "kcmbackground" +#~ msgstr "केसीएम-बेकग्राउंड" + +#~ msgid "KDE Background Control Module" +#~ msgstr "केडीई पृष्ठभूमि नियंत्रण मॉड्यूल" + +#~ msgid "(c) 1997-2002 Martin R. Jones" +#~ msgstr "(c) 1997-2002 मार्टिन आर. जोन्स" + +#~ msgid "Waldo Bastian" +#~ msgstr "वाल्दो बास्तियान" + +#~ msgid "George Staikos" +#~ msgstr "जॉर्ज स्टायकॉस" + +#~ msgid "Martin R. Jones" +#~ msgstr "मार्टिन आर. जोन्स" + +#~ msgid "Matthias Hoelzer-Kluepfel" +#~ msgstr "मैथियास होल्ज़र-क्लूपफेल" + +#~ msgid "Stephan Kulow" +#~ msgstr "स्टीफन कुलोव" + +#~ msgid "Mark Donohoe" +#~ msgstr "मार्क डोनाह्यू" + +#~ msgid "Matej Koss" +#~ msgstr "मातेज कॉस" + +#~ msgctxt "NAME OF TRANSLATORS" +#~ msgid "Your names" +#~ msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर" + +#~ msgctxt "EMAIL OF TRANSLATORS" +#~ msgid "Your emails" +#~ msgstr "raviratlami@aol.in" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmbell.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmbell.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmbell.po 2013-10-18 03:26:37.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmbell.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcmbell\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-10-18 01:42+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2007-10-21 14:27+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -24,24 +24,24 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" -#: bell.cpp:84 +#: bell.cpp:83 msgid "Bell Settings" msgstr "घंटी विन्यास " -#: bell.cpp:90 +#: bell.cpp:88 msgid "&Use system bell instead of system notification" msgstr "तंत्र अधिसूचना के बदले तंत्र घंटी इस्तेमाल करें (&U)" -#: bell.cpp:91 +#: bell.cpp:89 msgid "" "You can use the standard system bell (PC speaker) or a more sophisticated " "system notification, see the \"System Notifications\" control module for the " "\"Something Special Happened in the Program\" event." msgstr "" -#: bell.cpp:98 +#: bell.cpp:96 msgid "" "<h1>System Bell</h1> Here you can customize the sound of the standard system " "bell, i.e. the \"beep\" you always hear when there is something wrong. Note " @@ -54,11 +54,11 @@ "और भी मनपसंद बना सकते हैं \"पहुँच\" नियंत्रण मॉड्यूल के द्वारा: उदाहरण के लिए, आप एक ध्वनि " "फ़ाइल चुन सकते हैं बजने के लिए, बजाए मानक घंटी बजने के." -#: bell.cpp:107 +#: bell.cpp:105 msgid "&Volume:" msgstr "आवाज़ निर्धारक: (&V)" -#: bell.cpp:108 +#: bell.cpp:106 msgid "" "Here you can customize the volume of the system bell. For further " "customization of the bell, see the \"Accessibility\" control module." @@ -66,15 +66,15 @@ "यहाँ आप तंत्र घंटी की आवाज़ का अनुकूलन कर सकते हैं. घंटी के अतिरिक्त अनुकूलन के लिए देखें \"पहुँच" "\" नियंत्रण मॉड्यूल." -#: bell.cpp:113 +#: bell.cpp:111 msgid " Hz" msgstr "हर्त्ज" -#: bell.cpp:115 +#: bell.cpp:113 msgid "&Pitch:" msgstr "पिचः (&P)" -#: bell.cpp:116 +#: bell.cpp:114 msgid "" "Here you can customize the pitch of the system bell. For further " "customization of the bell, see the \"Accessibility\" control module." @@ -82,15 +82,15 @@ "यहाँ आप तंत्र घंटी के पिच का अनुकूलन कर सकते हैं. घंटी के अतिरिक्त अनुकूलन के लिए देखें \"पहुँच" "\" नियंत्रण मॉड्यूल." -#: bell.cpp:121 +#: bell.cpp:119 msgid " msec" msgstr "मि.से." -#: bell.cpp:123 +#: bell.cpp:121 msgid "&Duration:" msgstr "अवधिः (&D)" -#: bell.cpp:124 +#: bell.cpp:122 msgid "" "Here you can customize the duration of the system bell. For further " "customization of the bell, see the \"Accessibility\" control module." @@ -98,11 +98,11 @@ "यहाँ आप तंत्र घंटी की अवधि का अनुकूलन कर सकते हैं. घंटी के अतिरिक्त अनुकूलन के लिए देखें \"पहुँच" "\" नियंत्रण मॉड्यूल." -#: bell.cpp:127 +#: bell.cpp:125 msgid "&Test" msgstr "जांच (&T)" -#: bell.cpp:131 +#: bell.cpp:129 msgid "" "Click \"Test\" to hear how the system bell will sound using your changed " "settings." @@ -110,38 +110,38 @@ "\"जाँच\" पर क्लिक करें यह सुनने के लिए कि विन्यासों में परिवर्तन के बाद आपकी तंत्र घंटी की " "आवाज़ कैसी होगी." -#: bell.cpp:139 +#: bell.cpp:137 msgid "kcmbell" msgstr "केसीएम-बेल" -#: bell.cpp:139 +#: bell.cpp:137 msgid "KDE Bell Control Module" msgstr "केसीएम घड़ी नियंत्रण मॉड्यूल" -#: bell.cpp:141 +#: bell.cpp:139 msgid "(c) 1997 - 2001 Christian Czezatke, Matthias Elter" msgstr "(c) 1997 - 2001 क्रिश्चियन ज़ेझात्के, मैथियास एल्टर" -#: bell.cpp:143 +#: bell.cpp:141 msgid "Christian Czezatke" msgstr "क्रिश्चियन ज़ेझात्के" -#: bell.cpp:143 +#: bell.cpp:141 msgid "Original author" msgstr "मूल लेखक" -#: bell.cpp:144 +#: bell.cpp:142 msgid "Bernd Wuebben" msgstr "बर्नद वुएबेन" -#: bell.cpp:145 +#: bell.cpp:143 msgid "Matthias Elter" msgstr "मैथियास एल्टर" -#: bell.cpp:145 +#: bell.cpp:143 msgid "Current maintainer" msgstr "वर्तमान मेंटेनर" -#: bell.cpp:146 +#: bell.cpp:144 msgid "Carsten Pfeiffer" msgstr "कार्स्टेन फेइफर" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmcolors.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmcolors.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmcolors.po 2013-10-12 03:13:07.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmcolors.po 2013-11-05 12:40:10.000000000 +0000 @@ -8,7 +8,7 @@ msgstr "" "Project-Id-Version: kcmcolors\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-10-12 01:42+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-01-27 01:29+0530\n" "Last-Translator: G Karunakar <karunakar@indlinux.org>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -25,56 +25,56 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" #. i18n: ectx: attribute (title), widget (QWidget, pageColors) -#: colorscm.cpp:83 colorsettings.ui:267 +#: colorscm.cpp:82 colorsettings.ui:267 msgid "Colors" msgstr "रंग" -#: colorscm.cpp:85 +#: colorscm.cpp:84 msgid "(c) 2007 Matthew Woehlke" msgstr "(c) 2007 मैथ्यू वोहके" -#: colorscm.cpp:87 +#: colorscm.cpp:86 msgid "Matthew Woehlke" msgstr "मैथ्यू वोहके" -#: colorscm.cpp:89 +#: colorscm.cpp:88 msgid "Jeremy Whiting" msgstr "जेरेमी व्हिटिंग" -#: colorscm.cpp:140 colorscm.cpp:268 colorscm.cpp:1274 +#: colorscm.cpp:139 colorscm.cpp:267 colorscm.cpp:1273 msgctxt "Default color scheme" msgid "Default" msgstr "डिफ़ॉल्ट" -#: colorscm.cpp:145 colorscm.cpp:280 colorscm.cpp:1098 colorscm.cpp:1184 +#: colorscm.cpp:144 colorscm.cpp:279 colorscm.cpp:1097 colorscm.cpp:1183 msgctxt "Current color scheme" msgid "Current" msgstr "मौज़ूदा" -#: colorscm.cpp:252 +#: colorscm.cpp:251 msgid "Selecting another scheme will discard any changes you have made" msgstr "अन्य स्कीम को चुनने पर जो भी परिवर्तन आपने यहाँ किए हैं वो मिट जाएंगे" -#: colorscm.cpp:253 +#: colorscm.cpp:252 msgid "Are you sure?" msgstr "क्या आप सुनिश्चित हैं?" -#: colorscm.cpp:319 +#: colorscm.cpp:318 msgid "You do not have permission to delete that scheme" msgstr "उक्त स्कीम को मिटाने के लिए आपके पास अनुमति नहीं है." -#: colorscm.cpp:319 colorscm.cpp:535 +#: colorscm.cpp:318 colorscm.cpp:534 msgid "Error" msgstr "त्रुटि" -#: colorscm.cpp:327 +#: colorscm.cpp:326 msgid "Import Color Scheme" msgstr "रंग योजना आयात करें" -#: colorscm.cpp:340 +#: colorscm.cpp:339 msgid "" "The scheme you have selected appears to be a KDE3 scheme.\n" "\n" @@ -84,27 +84,27 @@ "This scheme will not be saved automatically." msgstr "" -#: colorscm.cpp:344 +#: colorscm.cpp:343 msgid "Notice" msgstr "सूचना" -#: colorscm.cpp:416 +#: colorscm.cpp:415 msgid "Please save the color scheme before uploading it." msgstr "" -#: colorscm.cpp:417 +#: colorscm.cpp:416 msgid "Please save" msgstr "" -#: colorscm.cpp:447 colorscm.cpp:478 +#: colorscm.cpp:446 colorscm.cpp:477 msgid "Save Color Scheme" msgstr "रंग योजना सहेजें" -#: colorscm.cpp:448 +#: colorscm.cpp:447 msgid "&Enter a name for the color scheme:" msgstr "रंग योजना के लिए एक नाम भरें: (&E)" -#: colorscm.cpp:477 +#: colorscm.cpp:476 msgid "" "A color scheme with that name already exists.\n" "Do you want to overwrite it?" @@ -112,68 +112,68 @@ "इस नाम की रंग योजना पहले ही मौजूद है.\n" "क्या आप इसे मिटाकर लिखना चाहते हैं?" -#: colorscm.cpp:535 +#: colorscm.cpp:534 msgid "You do not have permission to overwrite that scheme" msgstr "उक्त स्कीम को मिटाकर लिखने के लिए आपके पास अनुमति नहीं है." -#: colorscm.cpp:738 colorscm.cpp:754 +#: colorscm.cpp:737 colorscm.cpp:753 msgid "Varies" msgstr "बदलता है" -#: colorscm.cpp:779 +#: colorscm.cpp:778 msgid "Normal Background" msgstr "सामान्य पृष्ठभूमि" -#: colorscm.cpp:780 +#: colorscm.cpp:779 msgid "Alternate Background" msgstr "वैकल्पिक पृष्ठभूमि" -#: colorscm.cpp:781 +#: colorscm.cpp:780 msgid "Normal Text" msgstr "सामान्य पाठ" #. i18n: ectx: property (text), item, widget (QTableWidget, commonColorTable) -#: colorscm.cpp:782 colorsettings.ui:540 +#: colorscm.cpp:781 colorsettings.ui:540 msgid "Inactive Text" msgstr "अक्रिय पाठ" #. i18n: ectx: property (text), item, widget (QTableWidget, commonColorTable) -#: colorscm.cpp:783 colorsettings.ui:545 +#: colorscm.cpp:782 colorsettings.ui:545 msgid "Active Text" msgstr "सक्रिय पाठ" #. i18n: ectx: property (text), item, widget (QTableWidget, commonColorTable) -#: colorscm.cpp:784 colorsettings.ui:550 +#: colorscm.cpp:783 colorsettings.ui:550 msgid "Link Text" msgstr "कड़ी पाठ" #. i18n: ectx: property (text), item, widget (QTableWidget, commonColorTable) -#: colorscm.cpp:785 colorsettings.ui:555 +#: colorscm.cpp:784 colorsettings.ui:555 msgid "Visited Text" msgstr "भ्रमण किया जा चुका पाठ" #. i18n: ectx: property (text), item, widget (QTableWidget, commonColorTable) -#: colorscm.cpp:786 colorsettings.ui:560 +#: colorscm.cpp:785 colorsettings.ui:560 msgid "Negative Text" msgstr "ऋणात्मक पाठ" #. i18n: ectx: property (text), item, widget (QTableWidget, commonColorTable) -#: colorscm.cpp:787 colorsettings.ui:565 +#: colorscm.cpp:786 colorsettings.ui:565 msgid "Neutral Text" msgstr "सामान्य पाठ" #. i18n: ectx: property (text), item, widget (QTableWidget, commonColorTable) -#: colorscm.cpp:788 colorsettings.ui:570 +#: colorscm.cpp:787 colorsettings.ui:570 msgid "Positive Text" msgstr "धनात्मक पाठ" #. i18n: ectx: property (text), item, widget (QTableWidget, commonColorTable) -#: colorscm.cpp:789 colorsettings.ui:575 +#: colorscm.cpp:788 colorsettings.ui:575 msgid "Focus Decoration" msgstr "फोकस सजावट" #. i18n: ectx: property (text), item, widget (QTableWidget, commonColorTable) -#: colorscm.cpp:790 colorsettings.ui:580 +#: colorscm.cpp:789 colorsettings.ui:580 msgid "Hover Decoration" msgstr "होवर सजावट" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcm_desktoppaths.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcm_desktoppaths.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcm_desktoppaths.po 2013-10-19 03:00:29.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcm_desktoppaths.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcm_desktoppaths\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-10-19 01:37+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-12-09 00:49+0530\n" "Last-Translator: G Karunakar\n" "Language-Team: Hindi <en@li.org>\n" @@ -18,7 +18,7 @@ "Plural-Forms: nplurals=2; plural=(n!=1);\n" "X-Generator: KBabel 1.11.4\n" -#: globalpaths.cpp:113 +#: globalpaths.cpp:76 msgid "" "<h1>Paths</h1>\n" "This module allows you to choose where in the filesystem the files on your " @@ -26,11 +26,11 @@ "Use the \"Whats This?\" (Shift+F1) to get help on specific options." msgstr "" -#: globalpaths.cpp:118 +#: globalpaths.cpp:81 msgid "Desktop path:" msgstr "डेस्कटॉप पथ:" -#: globalpaths.cpp:119 +#: globalpaths.cpp:82 msgid "" "This folder contains all the files which you see on your desktop. You can " "change the location of this folder if you want to, and the contents will " @@ -40,11 +40,11 @@ "change the location of this folder if you want to, and the contents will " "move automatically to the new location as well." -#: globalpaths.cpp:124 +#: globalpaths.cpp:87 msgid "Autostart path:" msgstr "स्वतः प्रारंभ पथः" -#: globalpaths.cpp:125 +#: globalpaths.cpp:88 msgid "" "This folder contains applications or links to applications (shortcuts) that " "you want to have started automatically whenever KDE starts. You can change " @@ -52,78 +52,78 @@ "automatically to the new location as well." msgstr "" -#: globalpaths.cpp:131 +#: globalpaths.cpp:94 msgid "Documents path:" msgstr "दस्तावेज़ का पथः" -#: globalpaths.cpp:132 +#: globalpaths.cpp:95 msgid "" "This folder will be used by default to load or save documents from or to." msgstr "यह फ़ोल्डर डिफ़ॉल्ट द्वारा दस्तावेज़ को लोड करने या सहेजने में उपयोग में लिया जाएगा." -#: globalpaths.cpp:135 +#: globalpaths.cpp:98 msgid "Downloads path:" msgstr "डॉउनलोड का पथः" -#: globalpaths.cpp:136 +#: globalpaths.cpp:99 msgid "This folder will be used by default to save your downloaded items." msgstr "" "यह फ़ोल्डर डिफ़ॉल्ट द्वारा डॉउलोड किए हुए को लोड करने या सहेजने में उपयोग में लिया जाएगा." -#: globalpaths.cpp:139 +#: globalpaths.cpp:102 msgid "Movies path:" msgstr "चलचित्रों का पथः" -#: globalpaths.cpp:140 +#: globalpaths.cpp:103 msgid "This folder will be used by default to load or save movies from or to." msgstr "यह फ़ोल्डर डिफ़ॉल्ट द्वारा चलचित्रों को लोड करने या सहेजने में उपयोग में लिया जाएगा." -#: globalpaths.cpp:143 +#: globalpaths.cpp:106 msgid "Pictures path:" msgstr "छवियों का पथः" -#: globalpaths.cpp:144 +#: globalpaths.cpp:107 msgid "" "This folder will be used by default to load or save pictures from or to." msgstr "यह फ़ोल्डर डिफ़ॉल्ट द्वारा छवियों को लोड करने या सहेजने में उपयोग में लिया जाएगा." -#: globalpaths.cpp:147 +#: globalpaths.cpp:110 msgid "Music path:" msgstr "संगीत का पथः" -#: globalpaths.cpp:148 +#: globalpaths.cpp:111 msgid "This folder will be used by default to load or save music from or to." msgstr "यह फ़ोल्डर डिफ़ॉल्ट द्वारा संगीत को लोड करने या सहेजने में उपयोग में लिया जाएगा." -#: globalpaths.cpp:277 globalpaths.cpp:295 +#: globalpaths.cpp:241 globalpaths.cpp:259 msgid "Autostart" msgstr "स्वतः चालू" -#: globalpaths.cpp:281 +#: globalpaths.cpp:245 msgid "Desktop" msgstr "डेस्कटॉप" -#: globalpaths.cpp:305 +#: globalpaths.cpp:269 msgid "Documents" msgstr "दस्तावेज़" -#: globalpaths.cpp:308 +#: globalpaths.cpp:272 msgid "Downloads" msgstr "डॉउनलोड" -#: globalpaths.cpp:311 +#: globalpaths.cpp:275 msgid "Movies" msgstr "चलचित्र" -#: globalpaths.cpp:314 +#: globalpaths.cpp:278 msgid "Pictures" msgstr "छवियाँ" -#: globalpaths.cpp:317 +#: globalpaths.cpp:281 msgid "Music" msgstr "संगीत" -#: globalpaths.cpp:376 +#: globalpaths.cpp:340 #, kde-format msgid "" "The path for '%1' has been changed.\n" @@ -132,17 +132,17 @@ " '%1' के लिए पथ बदल दिया गया है;\n" "क्या आप चाहते हैं कि फ़ाइलों को '%2' से '%3' पर ले जाया जाए?" -#: globalpaths.cpp:379 +#: globalpaths.cpp:343 msgctxt "Move files from old to new place" msgid "Move" msgstr "खिसकाएँ" -#: globalpaths.cpp:380 +#: globalpaths.cpp:344 msgctxt "Use the new directory but do not move files" msgid "Do not Move" msgstr "नहीं खिसकाएँ" -#: globalpaths.cpp:382 +#: globalpaths.cpp:346 #, kde-format msgid "" "The path for '%1' has been changed.\n" @@ -151,16 +151,16 @@ " '%1' के लिए पथ बदल दिया गया है;\n" "क्या आप चाहते हैं कि फ़ाइलों को '%2' से '%3' पर ले जाया जाए?" -#: globalpaths.cpp:385 +#: globalpaths.cpp:349 msgctxt "Move the directory" msgid "Move" msgstr "खिसकाएँ" -#: globalpaths.cpp:386 +#: globalpaths.cpp:350 msgctxt "Use the new directory but do not move anything" msgid "Do not Move" msgstr "खिसकाएँ नहीं" -#: globalpaths.cpp:390 +#: globalpaths.cpp:354 msgid "Confirmation Required" msgstr "पुष्टि आवश्यक" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcm_desktopthemedetails.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcm_desktopthemedetails.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcm_desktopthemedetails.po 2014-03-26 03:45:43.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcm_desktopthemedetails.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcm_desktopthemedetails\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-26 01:54+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-12-29 03:15+0530\n" "Last-Translator: G Karunakar\n" "Language-Team: Hindi <en@li.org>\n" @@ -31,165 +31,156 @@ msgid "Theme" msgstr "प्रसंग" -#. i18n: ectx: property (text), widget (QPushButton, m_fileInstallButton) -#: DesktopTheme.ui:27 -msgid "Insta&ll from File" -msgstr "" - #. i18n: ectx: property (text), widget (KPushButton, m_newThemeButton) -#: DesktopTheme.ui:43 +#: DesktopTheme.ui:46 msgid "Get New Themes..." msgstr "नये प्रसंग लाएँ..." #. i18n: ectx: attribute (title), widget (QWidget, tab_2) -#: DesktopTheme.ui:77 +#: DesktopTheme.ui:54 msgid "Details" msgstr "विवरण" -#: desktopthemedetails.cpp:45 +#: desktopthemedetails.cpp:37 msgctxt "plasma name" msgid "Color Scheme" msgstr "रंग योजना" -#: desktopthemedetails.cpp:46 +#: desktopthemedetails.cpp:38 msgctxt "plasma name" msgid "Panel Background" msgstr "फलक पृष्ठभूमि" -#: desktopthemedetails.cpp:47 +#: desktopthemedetails.cpp:39 msgctxt "plasma name" msgid "Kickoff" msgstr "किकऑफ" -#: desktopthemedetails.cpp:48 +#: desktopthemedetails.cpp:40 msgctxt "plasma name" msgid "Task Items" msgstr "कार्य वस्तुएँ" -#: desktopthemedetails.cpp:49 +#: desktopthemedetails.cpp:41 msgctxt "plasma name" msgid "Widget Background" msgstr "विडजट पृष्ठभूमि" -#: desktopthemedetails.cpp:50 +#: desktopthemedetails.cpp:42 msgctxt "plasma name" msgid "Translucent Background" msgstr "" -#: desktopthemedetails.cpp:51 +#: desktopthemedetails.cpp:43 msgctxt "plasma name" msgid "Dialog Background" msgstr "संवाद पृष्ठभूमि" -#: desktopthemedetails.cpp:52 +#: desktopthemedetails.cpp:44 msgctxt "plasma name" msgid "Analog Clock" msgstr "एनॉलॉग घड़ी" -#: desktopthemedetails.cpp:53 +#: desktopthemedetails.cpp:45 msgctxt "plasma name" msgid "Notes" msgstr "टीप" -#: desktopthemedetails.cpp:54 +#: desktopthemedetails.cpp:46 msgctxt "plasma name" msgid "Tooltip" msgstr "टूल टिप्पणी" -#: desktopthemedetails.cpp:55 +#: desktopthemedetails.cpp:47 msgctxt "plasma name" msgid "Pager" msgstr "पेजर" -#: desktopthemedetails.cpp:56 +#: desktopthemedetails.cpp:48 msgctxt "plasma name" msgid "Run Command Dialog" msgstr "कमांड संवाद चलाएँ " -#: desktopthemedetails.cpp:57 +#: desktopthemedetails.cpp:49 msgctxt "plasma name" msgid "Shutdown Dialog" msgstr "संवाद बन्दकरें" -#: desktopthemedetails.cpp:58 +#: desktopthemedetails.cpp:50 msgctxt "plasma name" msgid "Icons" msgstr "" -#: desktopthemedetails.cpp:216 +#: desktopthemedetails.cpp:208 msgid "(Customized)" msgstr "" -#: desktopthemedetails.cpp:217 +#: desktopthemedetails.cpp:209 msgid "User customized theme" msgstr "" -#: desktopthemedetails.cpp:249 +#: desktopthemedetails.cpp:241 #, kde-format msgid "" "Theme items have been changed. Do you still wish remove the \"%1\" theme?" msgstr "" -#: desktopthemedetails.cpp:249 desktopthemedetails.cpp:254 -#: desktopthemedetails.cpp:257 +#: desktopthemedetails.cpp:241 desktopthemedetails.cpp:246 +#: desktopthemedetails.cpp:249 msgid "Remove Desktop Theme" msgstr "डेस्कटॉप प्रसंग हटाएँ" -#: desktopthemedetails.cpp:254 +#: desktopthemedetails.cpp:246 msgid "Removal of the default desktop theme is not allowed." msgstr "" -#: desktopthemedetails.cpp:257 +#: desktopthemedetails.cpp:249 #, kde-format msgid "Are you sure you wish remove the \"%1\" theme?" msgstr "" -#: desktopthemedetails.cpp:285 +#: desktopthemedetails.cpp:277 msgid "" "Please apply theme item changes (with a new theme name) before attempting to " "export theme." msgstr "" -#: desktopthemedetails.cpp:285 +#: desktopthemedetails.cpp:277 msgid "Export Desktop Theme" msgstr "डेस्कटॉप प्रसंग निर्यात" -#: desktopthemedetails.cpp:292 +#: desktopthemedetails.cpp:284 msgid "Export theme to file" msgstr "फ़ाइल को निर्यात" -#: desktopthemedetails.cpp:292 -msgid "Archive (*.zip)" -msgstr "" - -#: desktopthemedetails.cpp:387 +#: desktopthemedetails.cpp:379 msgid "Theme Item" msgstr "प्रसंग वस्तु" -#: desktopthemedetails.cpp:387 +#: desktopthemedetails.cpp:379 msgid "Source" msgstr "स्रोत" -#: desktopthemedetails.cpp:418 +#: desktopthemedetails.cpp:410 #, kde-format msgid "%1 %2" msgstr "%1 %2" -#: desktopthemedetails.cpp:421 desktopthemedetails.cpp:447 +#: desktopthemedetails.cpp:413 desktopthemedetails.cpp:439 msgid "File..." msgstr "फ़ाइल..." -#: desktopthemedetails.cpp:450 +#: desktopthemedetails.cpp:442 #, kde-format msgid "Select File to Use for %1" msgstr "फ़ाइल को उपयोग के लिए चुनें %1" -#: desktopthemedetails.cpp:493 +#: desktopthemedetails.cpp:485 #, kde-format msgid " Author: %1" msgstr "लेखक: %1" -#: desktopthemedetails.cpp:499 +#: desktopthemedetails.cpp:491 #, kde-format msgid "Version: %1" msgstr "संस्करण: %1" @@ -361,55 +352,32 @@ "important items not listed below will use this start theme." msgstr "" -#: kcmdesktoptheme.cpp:56 +#: kcmdesktoptheme.cpp:52 msgid "" "<h1>Desktop Theme</h1>This module allows you to modify the visual appearance " "of the desktop." msgstr "" -#: kcmdesktoptheme.cpp:71 +#: kcmdesktoptheme.cpp:67 msgid "KCMDesktopTheme" msgstr "KCMDesktopTheme" -#: kcmdesktoptheme.cpp:72 +#: kcmdesktoptheme.cpp:68 msgid "KDE Desktop Theme Module" msgstr "केडीई डेस्कटॉप प्रसंग मोड्यूल" -#: kcmdesktoptheme.cpp:74 +#: kcmdesktoptheme.cpp:70 msgid "(c) 2002 Karol Szwed, Daniel Molkentin" msgstr "(c) 2002 Karol Szwed, Daniel Molkentin" -#: kcmdesktoptheme.cpp:76 +#: kcmdesktoptheme.cpp:72 msgid "Karol Szwed" msgstr "Karol Szwed" -#: kcmdesktoptheme.cpp:77 +#: kcmdesktoptheme.cpp:73 msgid "Daniel Molkentin" msgstr "Daniel Molkentin" -#: kcmdesktoptheme.cpp:78 +#: kcmdesktoptheme.cpp:74 msgid "Ralf Nolden" msgstr "Ralf Nolden" - -#: kcmdesktoptheme.cpp:191 -#, fuzzy -#| msgid "Theme" -msgid "Open Theme" -msgstr "प्रसंग" - -#: kcmdesktoptheme.cpp:193 -msgid "Theme Files (*.zip *.tar.gz *.tar.bz2)" -msgstr "" - -#: kcmdesktoptheme.cpp:241 -msgid "Theme installed successfully." -msgstr "" - -#: kcmdesktoptheme.cpp:244 -#, kde-format -msgid "Theme installation failed. (%1)" -msgstr "" - -#: kcmdesktoptheme.cpp:252 -msgid "Theme installation failed." -msgstr "" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmdevinfo.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmdevinfo.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmdevinfo.po 2014-01-24 20:15:06.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmdevinfo.po 2013-11-30 06:14:44.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcmdevinfo\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-01-24 18:58+0000\n" +"POT-Creation-Date: 2013-11-30 05:13+0000\n" "PO-Revision-Date: 2010-11-27 03:30+0530\n" "Last-Translator: G Karunakar\n" "Language-Team: Hindi <en@li.org>\n" @@ -51,37 +51,37 @@ msgid "Show Relevant Devices" msgstr "प्रासंगिक औज़ार दिखाएँ " -#: devicelisting.cpp:113 soldevicetypes.cpp:797 +#: devicelisting.cpp:113 soldevicetypes.cpp:795 #, fuzzy #| msgid "Unknown" msgctxt "unknown device type" msgid "Unknown" msgstr "अज्ञात" -#: devicelisting.cpp:163 devinfo.cpp:88 +#: devicelisting.cpp:163 devinfo.cpp:87 #, fuzzy #| msgid "None" msgctxt "no device UDI" msgid "None" msgstr "कुछ नहीं" -#: devinfo.cpp:35 +#: devinfo.cpp:34 msgid "kcmdevinfo" msgstr "kcmdevinfo" -#: devinfo.cpp:35 +#: devinfo.cpp:34 msgid "KDE Solid Based Device Viewer" msgstr "केडीई ठोस औजार प्रदर्शक" -#: devinfo.cpp:37 +#: devinfo.cpp:36 msgid "(c) 2010 David Hubner" msgstr "(c) 2010 David Hubner" -#: devinfo.cpp:67 +#: devinfo.cpp:66 msgid "UDI: " msgstr "UDI: " -#: devinfo.cpp:75 +#: devinfo.cpp:74 msgctxt "Udi Whats This" msgid "Shows the current device's UDI (Unique Device Identifier)" msgstr "" @@ -101,7 +101,7 @@ "Solid Based Device Viewer Module" msgstr "" "\n" -"सोलिड अधारित औजार प्रदर्शक मॉडयूल" +"<br>सोलिड अधारित औजार प्रदर्शक मॉडयूल" #: infopanel.cpp:122 msgid "Product: " @@ -119,7 +119,7 @@ msgid "No" msgstr "नहीं" -#: infopanel.h:57 +#: infopanel.h:59 #, fuzzy #| msgid "Unknown" msgctxt "name of something is not known" @@ -138,518 +138,522 @@ msgid "A Device" msgstr "एक औजार" -#: soldevicetypes.cpp:43 +#: soldevice.h:80 soldevice.h:92 +msgid "Device unable to be cast to correct device" +msgstr "" + +#: soldevicetypes.cpp:41 msgid "Processors" msgstr "प्रोसेसर" -#: soldevicetypes.cpp:57 +#: soldevicetypes.cpp:55 #, kde-format msgid "Processor %1" msgstr "प्रोसेसर %1" -#: soldevicetypes.cpp:71 +#: soldevicetypes.cpp:69 msgid "Intel MMX" msgstr "इंटेल MMX" -#: soldevicetypes.cpp:72 +#: soldevicetypes.cpp:70 msgid "Intel SSE" msgstr "इंटेल SSE" -#: soldevicetypes.cpp:73 +#: soldevicetypes.cpp:71 msgid "Intel SSE2" msgstr "इंटेल SSE2" -#: soldevicetypes.cpp:74 +#: soldevicetypes.cpp:72 msgid "Intel SSE3" msgstr "इंटेल SSE3" -#: soldevicetypes.cpp:75 +#: soldevicetypes.cpp:73 msgid "Intel SSE4" msgstr "इंटेल SSE4" -#: soldevicetypes.cpp:76 +#: soldevicetypes.cpp:74 msgid "AMD 3DNow" msgstr "AMD 3DNow" -#: soldevicetypes.cpp:77 +#: soldevicetypes.cpp:75 msgid "ATI IVEC" msgstr "ATI IVEC" -#: soldevicetypes.cpp:78 +#: soldevicetypes.cpp:76 #, fuzzy #| msgid "None" msgctxt "no instruction set extensions" msgid "None" msgstr "कुछ नहीं" -#: soldevicetypes.cpp:80 +#: soldevicetypes.cpp:78 msgid "Processor Number: " msgstr "प्रोसेसर संख्या:" -#: soldevicetypes.cpp:82 +#: soldevicetypes.cpp:80 msgid "Max Speed: " msgstr "अधिकतम गति:" -#: soldevicetypes.cpp:84 +#: soldevicetypes.cpp:82 msgid "Supported Instruction Sets: " msgstr "समर्थित दिशा निर्देश:" -#: soldevicetypes.cpp:111 +#: soldevicetypes.cpp:109 msgid "Storage Drives" msgstr "भंडारण औजार" -#: soldevicetypes.cpp:129 +#: soldevicetypes.cpp:127 msgid "Hard Disk Drive" msgstr "हार्ड डिस्क" -#: soldevicetypes.cpp:131 +#: soldevicetypes.cpp:129 msgid "Compact Flash Reader" msgstr "सघन फ्लैश रीडर" -#: soldevicetypes.cpp:133 +#: soldevicetypes.cpp:131 msgid "Smart Media Reader" msgstr "स्मार्ट मीडिया रीडर" -#: soldevicetypes.cpp:135 +#: soldevicetypes.cpp:133 msgid "SD/MMC Reader" msgstr "SD/MMC रीडर" -#: soldevicetypes.cpp:137 +#: soldevicetypes.cpp:135 msgid "Optical Drive" msgstr "ऑपटिकल ड्राइव" -#: soldevicetypes.cpp:139 +#: soldevicetypes.cpp:137 msgid "Memory Stick Reader" msgstr "मेमोरी छडी रीडर" -#: soldevicetypes.cpp:141 +#: soldevicetypes.cpp:139 msgid "xD Reader" msgstr "xD रीडर" -#: soldevicetypes.cpp:143 +#: soldevicetypes.cpp:141 msgid "Unknown Drive" msgstr "अज्ञात ड्राइव" -#: soldevicetypes.cpp:162 +#: soldevicetypes.cpp:160 msgid "IDE" msgstr "आईडीई" -#: soldevicetypes.cpp:164 soldevicetypes.cpp:844 +#: soldevicetypes.cpp:162 soldevicetypes.cpp:842 msgid "USB" msgstr "यूएसबी" -#: soldevicetypes.cpp:166 +#: soldevicetypes.cpp:164 msgid "IEEE1394" msgstr "IEEE1394" -#: soldevicetypes.cpp:168 +#: soldevicetypes.cpp:166 msgid "SCSI" msgstr "एससीएसआई" -#: soldevicetypes.cpp:170 +#: soldevicetypes.cpp:168 msgid "SATA" msgstr "साटा" -#: soldevicetypes.cpp:172 +#: soldevicetypes.cpp:170 #, fuzzy #| msgid "Platform" msgctxt "platform storage bus" msgid "Platform" msgstr "मंच" -#: soldevicetypes.cpp:174 +#: soldevicetypes.cpp:172 #, fuzzy #| msgid "Unknown" msgctxt "unknown storage bus" msgid "Unknown" msgstr "अज्ञात" -#: soldevicetypes.cpp:177 +#: soldevicetypes.cpp:175 msgid "Bus: " msgstr "बस:" -#: soldevicetypes.cpp:179 +#: soldevicetypes.cpp:177 msgid "Hotpluggable?" msgstr "" -#: soldevicetypes.cpp:181 +#: soldevicetypes.cpp:179 msgid "Removable?" msgstr "" -#: soldevicetypes.cpp:205 +#: soldevicetypes.cpp:203 msgid "Network Interfaces" msgstr "नेटवर्क इंटरफेसेस" -#: soldevicetypes.cpp:216 +#: soldevicetypes.cpp:214 msgid "Connected" msgstr "जुडा हुआ" -#: soldevicetypes.cpp:222 +#: soldevicetypes.cpp:220 msgid "Wireless" msgstr "बेतार" -#: soldevicetypes.cpp:222 +#: soldevicetypes.cpp:220 msgid "Wired" msgstr "तारसहित" -#: soldevicetypes.cpp:249 +#: soldevicetypes.cpp:247 msgid "Hardware Address: " msgstr "हार्डवेयर पता:" -#: soldevicetypes.cpp:251 +#: soldevicetypes.cpp:249 msgid "Wireless?" msgstr "बेतार?" -#: soldevicetypes.cpp:299 +#: soldevicetypes.cpp:297 msgid "Unused" msgstr "उपयोग में नहीं" -#: soldevicetypes.cpp:301 +#: soldevicetypes.cpp:299 msgid "File System" msgstr "फ़ाइल सिस्टम" -#: soldevicetypes.cpp:303 +#: soldevicetypes.cpp:301 msgid "Partition Table" msgstr "विभाजन,तक़सीम सारणी" -#: soldevicetypes.cpp:305 +#: soldevicetypes.cpp:303 msgid "Raid" msgstr "रेड" -#: soldevicetypes.cpp:307 +#: soldevicetypes.cpp:305 msgid "Encrypted" msgstr "" -#: soldevicetypes.cpp:309 +#: soldevicetypes.cpp:307 #, fuzzy #| msgid "Unknown" msgctxt "unknown volume usage" msgid "Unknown" msgstr "अज्ञात" -#: soldevicetypes.cpp:312 +#: soldevicetypes.cpp:310 msgid "File System Type: " msgstr "फ़ाइल तंत्र क़िस्म:" -#: soldevicetypes.cpp:314 +#: soldevicetypes.cpp:312 msgid "Label: " msgstr "लेबल:" -#: soldevicetypes.cpp:315 +#: soldevicetypes.cpp:313 msgid "Not Set" msgstr "Not सेट" -#: soldevicetypes.cpp:316 +#: soldevicetypes.cpp:314 msgid "Volume Usage: " msgstr "माप उपयोग:" -#: soldevicetypes.cpp:318 +#: soldevicetypes.cpp:316 msgid "UUID: " msgstr "UUID: " -#: soldevicetypes.cpp:324 +#: soldevicetypes.cpp:322 msgid "Mounted At: " msgstr "पर आरोहित:" -#: soldevicetypes.cpp:325 +#: soldevicetypes.cpp:323 msgid "Not Mounted" msgstr "आरोहित नही" -#: soldevicetypes.cpp:331 +#: soldevicetypes.cpp:329 msgid "Volume Space:" msgstr "वाल्यूम स्थान:" -#: soldevicetypes.cpp:339 +#: soldevicetypes.cpp:337 #, kde-format msgctxt "Available space out of total partition size (percent used)" msgid "%1 free of %2 (%3% used)" msgstr "%2 का खाली %1 (%3% उपयोग में)" -#: soldevicetypes.cpp:347 +#: soldevicetypes.cpp:345 msgid "No data available" msgstr "" -#: soldevicetypes.cpp:373 +#: soldevicetypes.cpp:371 msgid "Audio Interfaces" msgstr "ऑडियो इंटरफेसेस" -#: soldevicetypes.cpp:416 +#: soldevicetypes.cpp:414 msgid "Alsa Interfaces" msgstr "आलसा इंटरफेसेस" -#: soldevicetypes.cpp:420 +#: soldevicetypes.cpp:418 msgid "Open Sound System Interfaces" msgstr "ध्वनि तंत्र इंटरफेसेस खोलें" -#: soldevicetypes.cpp:456 +#: soldevicetypes.cpp:454 msgid "Control" msgstr "नियंत्रण" -#: soldevicetypes.cpp:458 +#: soldevicetypes.cpp:456 msgid "Input" msgstr "इनपुट" -#: soldevicetypes.cpp:460 +#: soldevicetypes.cpp:458 msgid "Output" msgstr "आउटपुट" -#: soldevicetypes.cpp:462 +#: soldevicetypes.cpp:460 #, fuzzy #| msgid "Unknown" msgctxt "unknown audio interface type" msgid "Unknown" msgstr "अज्ञात" -#: soldevicetypes.cpp:469 +#: soldevicetypes.cpp:467 msgid "Internal Soundcard" msgstr "आंतरिक साउंडकार्ड" -#: soldevicetypes.cpp:471 +#: soldevicetypes.cpp:469 msgid "USB Soundcard" msgstr "यूएसबी साउंडकार्ड" -#: soldevicetypes.cpp:473 +#: soldevicetypes.cpp:471 msgid "Firewire Soundcard" msgstr "फ़ायरवायर साउंडकार्ड" -#: soldevicetypes.cpp:475 +#: soldevicetypes.cpp:473 msgid "Headset" msgstr "हेडसेड" -#: soldevicetypes.cpp:477 +#: soldevicetypes.cpp:475 msgid "Modem" msgstr "मॉडेम" -#: soldevicetypes.cpp:479 +#: soldevicetypes.cpp:477 #, fuzzy #| msgid "Unknown" msgctxt "unknown sound card type" msgid "Unknown" msgstr "अज्ञात" -#: soldevicetypes.cpp:482 +#: soldevicetypes.cpp:480 msgid "Audio Interface Type: " msgstr "ऑडियो इंटरफेस क़िस्म " -#: soldevicetypes.cpp:484 +#: soldevicetypes.cpp:482 msgid "Soundcard Type: " msgstr "साउंडकार्ड क़िस्म:" -#: soldevicetypes.cpp:507 +#: soldevicetypes.cpp:505 msgid "Device Buttons" msgstr "औजार बटन" -#: soldevicetypes.cpp:533 +#: soldevicetypes.cpp:531 msgid "Lid Button" msgstr "ढक्कन बटन" -#: soldevicetypes.cpp:535 +#: soldevicetypes.cpp:533 msgid "Power Button" msgstr "पावर बटन" -#: soldevicetypes.cpp:537 +#: soldevicetypes.cpp:535 msgid "Sleep Button" msgstr "सुप्त बटन" -#: soldevicetypes.cpp:539 +#: soldevicetypes.cpp:537 msgid "Tablet Button" msgstr "टेबलेट बटन" -#: soldevicetypes.cpp:541 +#: soldevicetypes.cpp:539 msgid "Unknown Button" msgstr "अज्ञात बटन" -#: soldevicetypes.cpp:544 +#: soldevicetypes.cpp:542 msgid "Button type: " msgstr "बटन क़िस्म:" -#: soldevicetypes.cpp:546 +#: soldevicetypes.cpp:544 msgid "Has State?" msgstr "स्थिति है?" -#: soldevicetypes.cpp:567 +#: soldevicetypes.cpp:565 msgid "Multimedia Players" msgstr "मल्टीमीडिया चालक" -#: soldevicetypes.cpp:584 soldevicetypes.cpp:624 soldevicetypes.cpp:941 +#: soldevicetypes.cpp:582 soldevicetypes.cpp:622 soldevicetypes.cpp:939 msgid "Supported Drivers: " msgstr "समर्थित ड्राइवर:" -#: soldevicetypes.cpp:586 soldevicetypes.cpp:626 soldevicetypes.cpp:943 +#: soldevicetypes.cpp:584 soldevicetypes.cpp:624 soldevicetypes.cpp:941 msgid "Supported Protocols: " msgstr "समर्थित प्रोटोकॉल्स:" -#: soldevicetypes.cpp:607 +#: soldevicetypes.cpp:605 msgid "Cameras" msgstr "कैमरे" -#: soldevicetypes.cpp:647 +#: soldevicetypes.cpp:645 msgid "Batteries" msgstr "बैटरी" -#: soldevicetypes.cpp:668 +#: soldevicetypes.cpp:666 msgid "PDA" msgstr "PDA" -#: soldevicetypes.cpp:670 +#: soldevicetypes.cpp:668 msgid "UPS" msgstr "UPS" -#: soldevicetypes.cpp:672 +#: soldevicetypes.cpp:670 msgid "Mouse" msgstr "माउस" -#: soldevicetypes.cpp:674 +#: soldevicetypes.cpp:672 msgid "Primary" msgstr "प्राथमिक" -#: soldevicetypes.cpp:676 +#: soldevicetypes.cpp:674 msgid "Keyboard" msgstr "कुंजीपट" -#: soldevicetypes.cpp:678 +#: soldevicetypes.cpp:676 msgid "Keyboard + Mouse" msgstr "कुंजीपट + माउस" -#: soldevicetypes.cpp:680 +#: soldevicetypes.cpp:678 msgid "Camera" msgstr "कैमरा" -#: soldevicetypes.cpp:682 +#: soldevicetypes.cpp:680 #, fuzzy #| msgid "Unknown" msgctxt "unknown battery type" msgid "Unknown" msgstr "अज्ञात" -#: soldevicetypes.cpp:689 +#: soldevicetypes.cpp:687 msgid "Charging" msgstr "चार्ज हो रहा है" -#: soldevicetypes.cpp:691 +#: soldevicetypes.cpp:689 msgid "Discharging" msgstr "रिसाव" -#: soldevicetypes.cpp:693 +#: soldevicetypes.cpp:691 msgid "No Charge" msgstr "चार्ज नहीं" -#: soldevicetypes.cpp:696 +#: soldevicetypes.cpp:694 msgid "Battery Type: " msgstr "बेटरी क़िस्म:" -#: soldevicetypes.cpp:698 +#: soldevicetypes.cpp:696 msgid "Charge Status: " msgstr "चार्ज स्थिति:" -#: soldevicetypes.cpp:719 +#: soldevicetypes.cpp:717 msgid "AC Adapters" msgstr "एसी एडेपटर" -#: soldevicetypes.cpp:736 +#: soldevicetypes.cpp:734 msgid "Is plugged in?" msgstr "क्या जुडा है?" -#: soldevicetypes.cpp:757 +#: soldevicetypes.cpp:755 msgid "Digital Video Broadcasting Devices" msgstr "डिजिटल वीडियो प्रसारण औज़ार" -#: soldevicetypes.cpp:778 +#: soldevicetypes.cpp:776 msgid "Audio" msgstr "ऑडियो" -#: soldevicetypes.cpp:780 +#: soldevicetypes.cpp:778 msgid "Conditional access system" msgstr "" -#: soldevicetypes.cpp:782 +#: soldevicetypes.cpp:780 msgid "Demux" msgstr "डिमक्स" -#: soldevicetypes.cpp:784 +#: soldevicetypes.cpp:782 msgid "Digital video recorder" msgstr "डिजिटल वीडियो रिकार्डर" -#: soldevicetypes.cpp:786 +#: soldevicetypes.cpp:784 msgid "Front end" msgstr "अग्रभाग" -#: soldevicetypes.cpp:788 +#: soldevicetypes.cpp:786 msgid "Network" msgstr "नेटवर्क" -#: soldevicetypes.cpp:790 +#: soldevicetypes.cpp:788 msgid "On-Screen display" msgstr "" -#: soldevicetypes.cpp:792 +#: soldevicetypes.cpp:790 msgid "Security and content protection" msgstr "" -#: soldevicetypes.cpp:794 +#: soldevicetypes.cpp:792 msgid "Video" msgstr "वीडियो" -#: soldevicetypes.cpp:800 +#: soldevicetypes.cpp:798 msgid "Device Type: " msgstr "औजार क़िस्म:" -#: soldevicetypes.cpp:821 +#: soldevicetypes.cpp:819 msgid "Serial Devices" msgstr "सीरियल औज़ार" -#: soldevicetypes.cpp:842 +#: soldevicetypes.cpp:840 #, fuzzy #| msgid "Platform" msgctxt "platform serial interface type" msgid "Platform" msgstr "मंच" -#: soldevicetypes.cpp:846 +#: soldevicetypes.cpp:844 #, fuzzy #| msgid "Unknown" msgctxt "unknown serial interface type" msgid "Unknown" msgstr "अज्ञात" -#: soldevicetypes.cpp:849 +#: soldevicetypes.cpp:847 #, fuzzy #| msgid "Unknown" msgctxt "unknown port" msgid "Unknown" msgstr "अज्ञात" -#: soldevicetypes.cpp:852 +#: soldevicetypes.cpp:850 msgid "Serial Type: " msgstr "सीरियल क़िस्म:" -#: soldevicetypes.cpp:854 +#: soldevicetypes.cpp:852 msgid "Port: " msgstr "पोर्टः" -#: soldevicetypes.cpp:875 +#: soldevicetypes.cpp:873 msgid "Smart Card Devices" msgstr "स्मार्ट कार्ड औज़ार" -#: soldevicetypes.cpp:896 +#: soldevicetypes.cpp:894 msgid "Card Reader" msgstr "कार्ड रीडर" -#: soldevicetypes.cpp:898 +#: soldevicetypes.cpp:896 msgid "Crypto Token" msgstr "क्रिप्टो टोकन" -#: soldevicetypes.cpp:900 +#: soldevicetypes.cpp:898 #, fuzzy #| msgid "Unknown" msgctxt "unknown smart card type" msgid "Unknown" msgstr "अज्ञात" -#: soldevicetypes.cpp:903 +#: soldevicetypes.cpp:901 msgid "Smart Card Type: " msgstr "स्मार्ट कार्ड क़िस्म:" -#: soldevicetypes.cpp:924 +#: soldevicetypes.cpp:922 msgid "Video Devices" msgstr "विडियो उपकरण" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmfonts.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmfonts.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmfonts.po 2013-11-29 03:37:47.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmfonts.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcmfonts\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-11-29 01:44+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-12-29 03:07+0530\n" "Last-Translator: G Karunakar\n" "Language-Team: Hindi <en@li.org>\n" @@ -18,23 +18,23 @@ "X-Generator: KBabel 1.11.4\n" "Plural-Forms: nplurals=2; plural=(n!=1);\n" -#: fonts.cpp:229 +#: fonts.cpp:231 msgid "Configure Anti-Alias Settings" msgstr "एन्टी अलियासिंग विन्यास कॉन्फ़िगर करें" -#: fonts.cpp:237 +#: fonts.cpp:238 msgid "E&xclude range:" msgstr "रेंज बाहर करें: (&x)" -#: fonts.cpp:240 fonts.cpp:245 +#: fonts.cpp:241 fonts.cpp:246 msgid " pt" msgstr " pt" -#: fonts.cpp:242 +#: fonts.cpp:243 msgid " to " msgstr " to " -#: fonts.cpp:249 +#: fonts.cpp:250 msgid "" "<p>If you have a TFT or LCD screen you can further improve the quality of " "displayed fonts by selecting this option.<br />Sub-pixel rendering is also " @@ -46,139 +46,139 @@ "</p>" msgstr "" -#: fonts.cpp:260 +#: fonts.cpp:261 msgid "&Use sub-pixel rendering:" msgstr "सब पिक्सल रेंडरिंग इस्तेमाल करें: (&U)" -#: fonts.cpp:272 +#: fonts.cpp:273 msgid "Hinting style: " msgstr "हिन्टिंग शैली:" -#: fonts.cpp:279 +#: fonts.cpp:280 msgid "" "Hinting is a process used to enhance the quality of fonts at small sizes." msgstr "हिन्टिंग एक प्रक्रिया है जो कि छोटे आकारों के फ़ॉन्ट्स के गुणों को उभारता है" -#: fonts.cpp:505 +#: fonts.cpp:506 msgctxt "font usage" msgid "General" msgstr "सामान्य" -#: fonts.cpp:506 +#: fonts.cpp:507 msgctxt "font usage" msgid "Fixed width" msgstr "निश्चित चौड़ाई" -#: fonts.cpp:507 +#: fonts.cpp:508 msgctxt "font usage" msgid "Small" msgstr "छोटा" -#: fonts.cpp:508 +#: fonts.cpp:509 msgctxt "font usage" msgid "Toolbar" msgstr "औज़ार पट्टी" -#: fonts.cpp:509 +#: fonts.cpp:510 msgctxt "font usage" msgid "Menu" msgstr "मेन्यू" -#: fonts.cpp:510 +#: fonts.cpp:511 msgctxt "font usage" msgid "Window title" msgstr "विंडो शीर्षक" -#: fonts.cpp:511 +#: fonts.cpp:512 msgctxt "font usage" msgid "Taskbar" msgstr "कार्यपट्टी" -#: fonts.cpp:512 +#: fonts.cpp:513 msgctxt "font usage" msgid "Desktop" msgstr "डेस्कटॉप" -#: fonts.cpp:552 +#: fonts.cpp:553 msgid "Used for normal text (e.g. button labels, list items)." msgstr "सामान्य पाठ के लिए उपयोग में (जैसे बटन लेबल, वस्तु सूची)." -#: fonts.cpp:553 +#: fonts.cpp:554 msgid "A non-proportional font (i.e. typewriter font)." msgstr "एक अ-समानुपातिक फ़ॉन्ट (जैसे टाइपराइटर फ़ॉन्ट)." -#: fonts.cpp:554 +#: fonts.cpp:555 msgid "Smallest font that is still readable well." msgstr "सबसे छोटा फ़ॉन्ट जो फिर भी पढा जा सकता है" -#: fonts.cpp:555 +#: fonts.cpp:556 msgid "Used to display text beside toolbar icons." msgstr "औज़ार पट्टी प्रतीक के बाज़ू से दिखाए जाने वाले पाठ के लिए उपयोग में आता है." -#: fonts.cpp:556 +#: fonts.cpp:557 msgid "Used by menu bars and popup menus." msgstr "मेन्यू बार तथा पॉपअप मेन्यू द्वारा उपयोग में आता है." -#: fonts.cpp:557 +#: fonts.cpp:558 msgid "Used by the window titlebar." msgstr "विंडो शीर्षक पट्टी के द्वारा उपयोग में" -#: fonts.cpp:558 +#: fonts.cpp:559 msgid "Used by the taskbar." msgstr "कार्य पट्टी द्वारा उपयोग में" -#: fonts.cpp:559 +#: fonts.cpp:560 msgid "Used for desktop icons." msgstr "डेस्कटॉप प्रतीक के लिए उपयोग में" -#: fonts.cpp:598 +#: fonts.cpp:599 #, kde-format msgctxt "Font role" msgid "%1: " msgstr "%1: " -#: fonts.cpp:611 +#: fonts.cpp:612 msgid "Ad&just All Fonts..." msgstr "सभी फ़ॉन्ट्स समंजित करें... (&j)" -#: fonts.cpp:612 +#: fonts.cpp:613 msgid "Click to change all fonts" msgstr "सभी फ़ॉन्ट्स को परिवर्तित करने के लिए क्लिक करें" -#: fonts.cpp:623 +#: fonts.cpp:624 msgid "Use a&nti-aliasing:" msgstr "एंटी-अलियासिंग इस्तेमाल करें (&n)" -#: fonts.cpp:627 +#: fonts.cpp:628 msgctxt "Use anti-aliasing" msgid "Enabled" msgstr "सक्षम" -#: fonts.cpp:628 +#: fonts.cpp:629 msgctxt "Use anti-aliasing" msgid "System Settings" msgstr "तंत्र विन्यास" -#: fonts.cpp:629 +#: fonts.cpp:630 msgctxt "Use anti-aliasing" msgid "Disabled" msgstr "अक्षम" -#: fonts.cpp:630 +#: fonts.cpp:631 msgid "" "If this option is selected, KDE will smooth the edges of curves in fonts." msgstr "" "यदि यह विकल्प चुना जाता है, केडीई फ़ॉन्ट्स के किनारों की गोलाइयों को चिकना बनाता है." -#: fonts.cpp:632 +#: fonts.cpp:633 msgid "Configure..." msgstr "कॉन्फ़िगर..." -#: fonts.cpp:640 +#: fonts.cpp:641 msgid "Force fonts DPI:" msgstr "फ़ॉन्ट्स डीपीआई बाध्य करें:" -#: fonts.cpp:646 +#: fonts.cpp:647 msgid "" "<p>This option forces a specific DPI value for fonts. It may be useful when " "the real DPI of the hardware is not detected properly and it is also often " @@ -191,7 +191,7 @@ "fonts should be used or configuration of font hinting should be checked.</p>" msgstr "" -#: fonts.cpp:793 +#: fonts.cpp:794 #, fuzzy #| msgid "" #| "<p>Some changes such as anti-aliasing will only affect newly started " @@ -203,11 +203,11 @@ "<p>आपने एन्टी-अलियासिंग से जुड़े विन्यासों को परिवर्तित किया है. यह परिवर्तन नए प्रारंभ " "किए अनुप्रयोगों में ही लागू होगा</p>" -#: fonts.cpp:794 fonts.cpp:804 +#: fonts.cpp:795 fonts.cpp:805 msgid "Font Settings Changed" msgstr "फ़ॉन्ट विन्यास परिवर्तित" -#: fonts.cpp:803 +#: fonts.cpp:804 msgid "" "<p>Some changes such as DPI will only affect newly started applications.</p>" msgstr "" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcm_infobase.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcm_infobase.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcm_infobase.po 2014-03-12 03:49:22.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcm_infobase.po 2013-11-30 06:14:44.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcm_infobase\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-12 01:52+0000\n" +"POT-Creation-Date: 2013-11-30 05:13+0000\n" "PO-Revision-Date: 2010-07-13 01:05+0530\n" "Last-Translator: G Karunakar <karunakar@indlinux.org>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -18,7 +18,7 @@ "Plural-Forms: nplurals=2; plural=(n!=1);\n" "X-Generator: KBabel 1.11.4\n" -#: info_aix.cpp:68 info_wayland.cpp:125 +#: info_aix.cpp:68 msgid "Name" msgstr "नाम" @@ -73,15 +73,15 @@ msgid "PA-RISC Revision" msgstr "PA-RISC संशोधन" -#: info_linux.cpp:107 +#: info_linux.cpp:103 msgid "DMA-Channel" msgstr "DMA-चैनेल" -#: info_linux.cpp:107 info_linux.cpp:158 +#: info_linux.cpp:103 info_linux.cpp:154 msgid "Used By" msgstr "द्वारा उपयोग में" -#: info_linux.cpp:158 +#: info_linux.cpp:154 msgid "I/O-Range" msgstr "आई/ओ-रेंज" @@ -105,135 +105,27 @@ msgid "No SCSI devices found." msgstr "कोई एससीएसआई औज़ार नहीं मिला." -#: info_wayland.cpp:38 -msgid "Output" -msgstr "" - -#: info_wayland.cpp:39 -msgid "Manufacturer" -msgstr "उत्पादक" - -#: info_wayland.cpp:40 -msgid "Model" -msgstr "मॉडल" - -#: info_wayland.cpp:41 -#, fuzzy -#| msgid "Physical Path:" -msgid "Physical Width" -msgstr "फिज़ीकल पथः" - -#: info_wayland.cpp:42 -#, fuzzy -#| msgid "Physical Path:" -msgid "Physical Height" -msgstr "फिज़ीकल पथः" - -#: info_wayland.cpp:43 -msgid "X" -msgstr "" - -#: info_wayland.cpp:44 -msgid "Y" -msgstr "" - -#: info_wayland.cpp:45 -msgid "Subpixel" -msgstr "" - -#: info_wayland.cpp:49 -msgid "Normal" -msgstr "" - -#: info_wayland.cpp:61 -msgid "Flipped" -msgstr "" - -#: info_wayland.cpp:64 -msgid "Flipped 90" -msgstr "" - -#: info_wayland.cpp:67 -msgid "Flipped 180" -msgstr "" - -#: info_wayland.cpp:70 -msgid "Flipped 270" -msgstr "" - -#: info_wayland.cpp:73 -msgid "Transform" -msgstr "" - -#: info_wayland.cpp:111 -msgid "Pointer" -msgstr "" - -#: info_wayland.cpp:114 -msgid "Keyboard" -msgstr "" - -#: info_wayland.cpp:117 -msgid "Touch" -msgstr "" - -#: info_wayland.cpp:141 -#, fuzzy -#| msgid "Output Channels" -msgid "Outputs" -msgstr "आउटपुट चैनल्स" - -#: info_wayland.cpp:147 -msgid "Seat" -msgstr "" - -#: info_wayland.cpp:197 os_base.h:231 -msgid "Information" -msgstr "जानकारी" - -#: info_wayland.cpp:197 os_base.h:231 -msgid "Value" -msgstr "मान" - -#: info_wayland.cpp:200 -#, fuzzy -#| msgid "Information" -msgid "Compositor Information" -msgstr "जानकारी" - -#: info_wayland.cpp:204 os_base.h:242 -msgid "Name of the Display" -msgstr "प्रदर्शक का नाम" - -#: info_wayland.cpp:206 -msgid "Interfaces" -msgstr "" - -#: info_wayland.cpp:206 -msgid "Interface Version" -msgstr "" - -#: os_base.h:62 +#: os_base.h:60 msgid "LSBFirst" msgstr "LSBFirst" -#: os_base.h:64 +#: os_base.h:62 msgid "MSBFirst" msgstr "MSBFirst" -#: os_base.h:66 +#: os_base.h:64 #, kde-format msgid "Unknown Order %1" msgstr "अज्ञात अनुक्रम %1" -#: os_base.h:71 +#: os_base.h:69 #, kde-format msgid "1 Bit" msgid_plural "%1 Bits" msgstr[0] "1 बिट" msgstr[1] "%1 बिट्स" -#: os_base.h:75 +#: os_base.h:73 #, fuzzy, kde-format #| msgctxt "singular form: '1 Byte' (yes, it is '1', not '%1'!)" #| msgid "1 Byte" @@ -242,185 +134,197 @@ msgstr[0] "1 बाइट" msgstr[1] "1 बाइट" -#: os_base.h:116 +#: os_base.h:114 #, kde-format msgid "Screen # %1" msgstr "स्क्रीन # %1" -#: os_base.h:118 +#: os_base.h:116 msgid "(Default Screen)" msgstr "(डिफ़ॉल्ट स्क्रीन)" -#: os_base.h:127 +#: os_base.h:125 msgid "Dimensions" msgstr "आयाम" -#: os_base.h:127 +#: os_base.h:125 #, kde-format msgid "%1 x %2 Pixels (%3 x %4 mm)" msgstr "%1 x %2 पिक्सेल (%3 x %4 mm)" -#: os_base.h:131 +#: os_base.h:129 msgid "Resolution" msgstr "रिसॉल्यूशन" -#: os_base.h:131 +#: os_base.h:129 #, kde-format msgid "%1 x %2 dpi" msgstr "%1 x %2 डीपीआई" -#: os_base.h:148 +#: os_base.h:146 #, kde-format msgid "Depths (%1)" msgstr "गहराई (%1)" -#: os_base.h:154 +#: os_base.h:152 msgid "Root Window ID" msgstr "रूट विंडो आईडी" -#: os_base.h:158 +#: os_base.h:156 msgid "Depth of Root Window" msgstr "का रूट विंडो" -#: os_base.h:158 +#: os_base.h:156 #, kde-format msgid "%1 plane" msgid_plural "%1 planes" msgstr[0] "%1 समतल" msgstr[1] "%1 समतल" -#: os_base.h:162 +#: os_base.h:160 msgid "Number of Colormaps" msgstr "कलरमेप्स की संख्या" -#: os_base.h:162 +#: os_base.h:160 #, kde-format msgid "minimum %1, maximum %2" msgstr "न्यूनतम %1, अधिकतम %2" -#: os_base.h:166 +#: os_base.h:164 msgid "Default Colormap" msgstr "डिफ़ॉल्ट" -#: os_base.h:170 +#: os_base.h:168 msgid "Default Number of Colormap Cells" msgstr "डिफ़ॉल्ट संख्या का" -#: os_base.h:174 +#: os_base.h:172 msgid "Preallocated Pixels" msgstr "Preallocated Pixelss" -#: os_base.h:174 +#: os_base.h:172 #, kde-format msgid "Black %1, White %2" msgstr "काला %1, सफेद %2" -#: os_base.h:177 +#: os_base.h:175 msgid "Yes" msgstr "हाँ" -#: os_base.h:178 +#: os_base.h:176 msgid "No" msgstr "नहीं" -#: os_base.h:181 +#: os_base.h:179 msgid "Options" msgstr "विकल्प" -#: os_base.h:181 +#: os_base.h:179 msgid "When mapped" msgstr "जब मैप्ड हो" -#: os_base.h:181 +#: os_base.h:179 #, kde-format msgid "backing-store: %1, save-unders: %2" msgstr "बेकिंग-स्टोर: %1, सेव-अंडर्स: %2" -#: os_base.h:187 +#: os_base.h:185 msgid "Largest Cursor" msgstr "सबसे बड़ा संकेतक" -#: os_base.h:189 +#: os_base.h:187 msgid "unlimited" msgstr "असीमित" -#: os_base.h:195 +#: os_base.h:193 msgid "Current Input Event Mask" msgstr "मौज़ूदा इनपुट इवेंट मास्क" -#: os_base.h:201 +#: os_base.h:199 #, kde-format msgid "Event = %1" msgstr "घटना = %1" -#: os_base.h:236 +#: os_base.h:229 +msgid "Information" +msgstr "जानकारी" + +#: os_base.h:229 +msgid "Value" +msgstr "मान" + +#: os_base.h:234 msgid "Server Information" msgstr "सर्वर जानकारी" -#: os_base.h:246 +#: os_base.h:240 +msgid "Name of the Display" +msgstr "प्रदर्शक का नाम" + +#: os_base.h:244 msgid "Vendor String" msgstr "विक्रेता स्ट्रिंग" -#: os_base.h:250 +#: os_base.h:248 msgid "Vendor Release Number" msgstr "विक्रेता जारी क्रमांक" -#: os_base.h:254 +#: os_base.h:252 msgid "Version Number" msgstr "संस्करण क्रमांक" -#: os_base.h:258 +#: os_base.h:256 msgid "Available Screens" msgstr "उपलब्द स्क्रीन" -#: os_base.h:268 +#: os_base.h:266 msgid "Supported Extensions" msgstr "समर्थित एक्सटेंशन्स" -#: os_base.h:283 +#: os_base.h:281 msgid "Supported Pixmap Formats" msgstr "समर्थित पिक्समेप फार्मेट्स" -#: os_base.h:290 +#: os_base.h:288 #, kde-format msgid "Pixmap Format #%1" msgstr "पिक्समेप फार्मेट #%1" -#: os_base.h:290 +#: os_base.h:288 #, kde-format msgid "%1 BPP, Depth: %2, Scanline padding: %3" msgstr "%1 BPP, गहराई: %2, स्कैनलाइन पैडिंग: %3" -#: os_base.h:302 +#: os_base.h:300 msgid "Maximum Request Size" msgstr "अधिकतम निवेदित आकार" -#: os_base.h:306 +#: os_base.h:304 msgid "Motion Buffer Size" msgstr "गति बफर आकार" -#: os_base.h:310 +#: os_base.h:308 msgid "Bitmap" msgstr "बिटमैप" -#: os_base.h:314 +#: os_base.h:312 msgid "Unit" msgstr "इकाई" -#: os_base.h:318 +#: os_base.h:316 msgid "Order" msgstr "अनुक्रम" -#: os_base.h:322 +#: os_base.h:320 msgid "Padding" msgstr "पैडिंग" -#: os_base.h:326 +#: os_base.h:324 msgid "Image Byte Order" msgstr "छवि बाइट अनुक्रम" -#: os_current.h:60 os_current.h:70 os_current.h:92 os_current.h:102 -#: os_current.h:112 os_current.h:123 os_current.h:133 os_current.h:143 +#: os_current.h:58 os_current.h:68 os_current.h:90 os_current.h:100 +#: os_current.h:110 os_current.h:121 os_current.h:131 os_current.h:141 msgid "This system may not be completely supported yet." msgstr "नहीं." @@ -469,6 +373,9 @@ #~ msgid "Machine" #~ msgstr "मशीन" +#~ msgid "Model" +#~ msgstr "मॉडल" + #~ msgid "Machine Identification Number" #~ msgstr "मशीन पहचानकारक क्रमांक" @@ -617,6 +524,9 @@ #~ msgid "Right-Jack" #~ msgstr "दायाँ-जैक" +#~ msgid "Output Channels" +#~ msgstr "आउटपुट चैनल्स" + #~ msgid "Gain" #~ msgstr "गेन" @@ -680,6 +590,9 @@ #~ msgid "Device Name" #~ msgstr "नाम" +#~ msgid "Manufacturer" +#~ msgstr "उत्पादक" + #~ msgid "Instance" #~ msgstr "इंस्टेंस" @@ -726,6 +639,9 @@ #~ msgid "Compatible Names:" #~ msgstr "कम्पेटिबल नामः" +#~ msgid "Physical Path:" +#~ msgstr "फिज़ीकल पथः" + #~ msgid "Properties" #~ msgstr "गुण" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcminfo.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcminfo.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcminfo.po 2014-03-11 04:22:41.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcminfo.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcminfo\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-11 01:51+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-12-29 03:08+0530\n" "Last-Translator: G Karunakar\n" "Language-Team: Hindi <en@li.org>\n" @@ -25,7 +25,7 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" #: info.cpp:40 msgid "System Information Control Module" @@ -47,17 +47,17 @@ msgid "Helge Deller" msgstr "हेल्ग डेलर" -#: info.cpp:67 +#: info.cpp:68 msgid "This list displays system information on the selected category." msgstr "यह सूची चुने गए वर्गों में तंत्र जानकारी प्रदर्शित करती है." -#: info.cpp:83 +#: info.cpp:84 #, kde-format msgctxt "%1 is one of the modules of the kinfocenter, cpu info, os info, etc" msgid "No information available about %1." msgstr "%1 के बारे में कोई जानकारी उपलब्ध नहीं." -#: info.cpp:114 +#: info.cpp:115 msgid "" "All the information modules return information about a certain aspect of " "your computer hardware or your operating system." @@ -65,30 +65,26 @@ "ये सभी जानकारी मॉड्यूल - आपके कम्प्यूटर हार्डवेयर या आपके ऑपरेटिंग सिस्टम के बारे में किसी न " "किसी पहलू के बारे में जानकारियाँ बताते हैं." -#: main.cpp:46 +#: main.cpp:57 msgid "Interrupt" msgstr "इंटरप्ट" -#: main.cpp:49 +#: main.cpp:60 msgid "I/O-Port" msgstr "आई/ओ पोर्ट" -#: main.cpp:52 +#: main.cpp:63 msgid "SCSI" msgstr "एससीएसआई" -#: main.cpp:55 +#: main.cpp:66 msgid "DMA-Channel" msgstr "डीएमए-चैनल" -#: main.cpp:58 +#: main.cpp:69 msgid "X-Server" msgstr "X-सर्वर" -#: main.cpp:61 -msgid "Wayland" -msgstr "" - #~ msgid "Processor(s)" #~ msgstr "प्रोसेसर" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcm_infosummary.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcm_infosummary.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcm_infosummary.po 2014-03-19 06:15:59.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcm_infosummary.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcm_infosummary\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-19 04:21+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-12-09 01:05+0530\n" "Last-Translator: G Karunakar\n" "Language-Team: Hindi <en@li.org>\n" @@ -26,104 +26,104 @@ msgid "Your emails" msgstr "karunakar@indlinux.org" -#: infosum.cpp:36 +#: infosum.cpp:33 msgid "kcm_infosummary" msgstr "kcm_infosummary" -#: infosum.cpp:36 +#: infosum.cpp:33 msgid "Hardware Summary Information" msgstr "हार्डवेयर सारांश जानकारी" -#: infosum.cpp:38 +#: infosum.cpp:35 msgid "(c) 2010 David Hubner" msgstr "(c) डेविड हबनर" -#: infosum.cpp:65 +#: infosum.cpp:62 msgid "OS Version" msgstr "ओएस संस्करण" -#: infosum.cpp:65 +#: infosum.cpp:62 msgid "KDE SC Version" msgstr "केडीई SC संस्करण" -#: infosum.cpp:65 +#: infosum.cpp:62 msgid "Hostname" msgstr "होस्टनाम" -#: infosum.cpp:72 +#: infosum.cpp:69 #, fuzzy msgctxt "OS whats this" msgid "This shows information about your Operating System" msgstr "के बारे में तंत्र" -#: infosum.cpp:89 +#: infosum.cpp:86 msgid "Processor" msgstr "प्रोसेसर" -#: infosum.cpp:89 +#: infosum.cpp:86 msgid "Processor Number" msgstr "प्रोसेसर संख्या" -#: infosum.cpp:89 +#: infosum.cpp:86 msgid "Processor Max Speed" msgstr "प्रोसेसर अधिकतम गति" -#: infosum.cpp:95 +#: infosum.cpp:92 #, fuzzy msgctxt "CPU whats this" msgid "This shows information about a specific CPU in your computer" msgstr "के बारे में ए सीपीयू , केंद्रीय संसाधक इंच" -#: infosum.cpp:106 +#: infosum.cpp:103 msgid "Memory Amount" msgstr "मेमोरी मात्रा" -#: infosum.cpp:106 +#: infosum.cpp:103 msgid "Memory Used/Free" msgstr "मेमोरी उपयोग में /मुक्त" -#: infosum.cpp:124 +#: infosum.cpp:121 msgid "Drive Title" msgstr "ड्राइव शीर्षक" -#: infosum.cpp:124 +#: infosum.cpp:121 msgid "Storage Size" msgstr "भंडारण आकार" -#: infosum.cpp:124 +#: infosum.cpp:121 msgid "Bus" msgstr "बस" -#: infosum.cpp:132 +#: infosum.cpp:129 msgid "IDE" msgstr "IDE" -#: infosum.cpp:134 +#: infosum.cpp:131 msgid "USB" msgstr "USB" -#: infosum.cpp:136 +#: infosum.cpp:133 msgid "IEEE1394" msgstr "IEEE1394" -#: infosum.cpp:138 +#: infosum.cpp:135 msgid "SCSI" msgstr "SCSI" -#: infosum.cpp:140 +#: infosum.cpp:137 msgid "SATA" msgstr "साटा" -#: infosum.cpp:142 +#: infosum.cpp:139 msgid "Platform" msgstr "प्लेटफार्म" -#: infosum.cpp:144 +#: infosum.cpp:141 msgctxt "Unknown device" msgid "Unknown" msgstr "अज्ञात" -#: infosum.cpp:148 +#: infosum.cpp:145 #, fuzzy msgctxt "Hard Drive Whats This" msgid "This shows information about a specific hard drive in your computer" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcminit.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcminit.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcminit.po 2013-12-06 03:43:32.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcminit.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcminit\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-12-06 01:44+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-12-29 03:17+0530\n" "Last-Translator: G Karunakar\n" "Language-Team: Hindi <en@li.org>\n" @@ -18,31 +18,31 @@ "X-Generator: KBabel 1.11.4\n" "Plural-Forms: nplurals=2; plural=(n!=1);\n" -#: main.cpp:170 +msgctxt "NAME OF TRANSLATORS" +msgid "Your names" +msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर" + +msgctxt "EMAIL OF TRANSLATORS" +msgid "Your emails" +msgstr "raviratlami@aol.in" + +#: main.cpp:174 #, kde-format msgid "Module %1 not found" msgstr "मॉड्यूल %1 नहीं मिला" -#: main.cpp:249 +#: main.cpp:251 msgid "KCMInit" msgstr "केसीएमइनिट" -#: main.cpp:251 +#: main.cpp:253 msgid "KCMInit - runs startup initialization for Control Modules." msgstr "केसीएमइनिट - नियंत्रण मॉड्यूलों के लिए स्टार्टअप इनिशियलाइजनेशन चलाता है." -#: main.cpp:256 +#: main.cpp:258 msgid "List modules that are run at startup" msgstr "प्रारंभ में जो मॉड्यूल चलते हैं उनकी सूची दें" -#: main.cpp:257 +#: main.cpp:259 msgid "Configuration module to run" msgstr "चलाने के लिए कॉन्फ़िगरेशन मॉड्यूल." - -#~ msgctxt "NAME OF TRANSLATORS" -#~ msgid "Your names" -#~ msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर" - -#~ msgctxt "EMAIL OF TRANSLATORS" -#~ msgid "Your emails" -#~ msgstr "raviratlami@aol.in," diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcminput.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcminput.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcminput.po 2014-03-22 03:29:17.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcminput.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcminput\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-22 01:48+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-12-29 03:20+0530\n" "Last-Translator: G Karunakar\n" "Language-Team: Hindi <en@li.org>\n" @@ -30,19 +30,19 @@ msgid "Select the cursor theme you want to use:" msgstr "संकेतक प्रसंग चुनें जिसका उपयोग आप करना चाहते हैं:" -#: core/themepage.cpp:59 xcursor/thememodel.cpp:75 +#: core/themepage.cpp:59 xcursor/thememodel.cpp:74 msgid "Name" msgstr "नाम " -#: core/themepage.cpp:59 xcursor/thememodel.cpp:78 +#: core/themepage.cpp:59 xcursor/thememodel.cpp:77 msgid "Description" msgstr "वर्णन" -#: core/themepage.cpp:100 xcursor/themepage.cpp:333 +#: core/themepage.cpp:100 xcursor/themepage.cpp:328 msgid "You have to restart KDE for these changes to take effect." msgstr "परिवर्तनों को प्रभाव में लाने के लिए आपको केडीई को फिर से प्रारंभ करना होगा." -#: core/themepage.cpp:101 xcursor/themepage.cpp:334 +#: core/themepage.cpp:101 xcursor/themepage.cpp:329 msgid "Cursor Settings Changed" msgstr "संकेतक विन्यास परिवर्तित" @@ -78,15 +78,15 @@ msgid "Large white cursors" msgstr "बड़ा सफेद संकेतक" -#: kcmcursortheme.cpp:41 +#: kcmcursortheme.cpp:40 msgid "Cursor Theme" msgstr "संकेतक प्रसंग" -#: kcmcursortheme.cpp:42 +#: kcmcursortheme.cpp:41 msgid "(c) 2003-2007 Fredrik Höglund" msgstr "(c) 2003-2007 Fredrik Höglund" -#: kcmcursortheme.cpp:43 +#: kcmcursortheme.cpp:42 msgid "Fredrik Höglund" msgstr "Fredrik Höglund" @@ -529,47 +529,47 @@ msgid "resolution dependent" msgstr "" -#: xcursor/themepage.cpp:452 +#: xcursor/themepage.cpp:444 msgid "Drag or Type Theme URL" msgstr "प्रसंग यूआरएल खींचलाएँ या टाइप करें" -#: xcursor/themepage.cpp:463 +#: xcursor/themepage.cpp:455 #, kde-format msgid "Unable to find the cursor theme archive %1." msgstr "संकेतक प्रसंग अभिलेख %1 पाने में अक्षम." -#: xcursor/themepage.cpp:466 +#: xcursor/themepage.cpp:458 #, kde-format msgid "" "Unable to download the cursor theme archive; please check that the address " "%1 is correct." msgstr "संकेतक प्रसंग अभिलेख डाउनलोड करने में अक्षम; कृपया जाँचें कि पता %1 सही है." -#: xcursor/themepage.cpp:475 +#: xcursor/themepage.cpp:467 #, kde-format msgid "The file %1 does not appear to be a valid cursor theme archive." msgstr "फ़ाइल %1 वैध संकेतक प्रसंग अभिलेखागार जैसा प्रतीत नहीं होता है." -#: xcursor/themepage.cpp:490 +#: xcursor/themepage.cpp:482 msgid "" "<qt>You cannot delete the theme you are currently using.<br />You have to " "switch to another theme first.</qt>" msgstr "" -#: xcursor/themepage.cpp:496 +#: xcursor/themepage.cpp:488 #, kde-format msgid "" "<qt>Are you sure you want to remove the <i>%1</i> cursor theme?<br />This " "will delete all the files installed by this theme.</qt>" msgstr "" -"<qt>क्या आप वाक़ई संकेतक प्रसंग<i>%1</i> मिटाना चाहते हैं?<br />यह इस प्रसंग द्वारा " +"<qt>क्या आप वाक़ई संकेतक प्रसंग<i>%1</i> मिटाना चाहते हैं?<br>यह इस प्रसंग द्वारा " "संस्थापित सभी फ़ाइलों को मिटा देगा.</qt>" -#: xcursor/themepage.cpp:502 +#: xcursor/themepage.cpp:494 msgid "Confirmation" msgstr "पुष्टिकरण" -#: xcursor/themepage.cpp:559 +#: xcursor/themepage.cpp:551 #, kde-format msgid "" "A theme named %1 already exists in your icon theme folder. Do you want " @@ -578,7 +578,7 @@ "एक प्रसंग %1 नाम से प्रतीक प्रसंग फ़ोल्डर में पहले से ही उपलब्ध है. क्या आप उसे इससे बदलना " "चाहते हैं?" -#: xcursor/themepage.cpp:563 +#: xcursor/themepage.cpp:555 msgid "Overwrite Theme?" msgstr "प्रसंग मिटाकर लिखें?" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmkclock.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmkclock.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmkclock.po 2013-10-18 03:26:37.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmkclock.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcmkclock\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-10-18 01:42+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-12-29 03:21+0530\n" "Last-Translator: G Karunakar\n" "Language-Team: Hindi <en@li.org>\n" @@ -24,7 +24,7 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" #. i18n: ectx: attribute (title), widget (QWidget, tab) #: dateandtime.ui:22 @@ -61,7 +61,7 @@ msgid "Current local time zone:" msgstr "मौज़ूदा स्थानीय समय क्षेत्रः" -#. i18n: ectx: property (placeholderText), widget (KTreeWidgetSearchLine, tzonesearch) +#. i18n: ectx: property (clickMessage), widget (KTreeWidgetSearchLine, tzonesearch) #: dateandtime.ui:155 msgid "Search" msgstr "" @@ -143,43 +143,43 @@ "करेंगे. यदि आपके पास रूट पासवर्ड नहीं है, परंतु चाहते हैं कि तंत्र का समय सही किया जाना " "चाहिए, कृपया अपने तंत्र प्रशासक से संपर्क करें." -#: main.cpp:52 +#: main.cpp:53 msgid "kcmclock" msgstr "केसीएमक्लॉक" -#: main.cpp:52 +#: main.cpp:53 msgid "KDE Clock Control Module" msgstr "केडीई घड़ी नियंत्रण मॉड्यूल" -#: main.cpp:54 +#: main.cpp:55 msgid "(c) 1996 - 2001 Luca Montecchiani" msgstr "(c) 1996 - 2001 लुका मॉन्तेचियानी" -#: main.cpp:56 +#: main.cpp:57 msgid "Luca Montecchiani" msgstr "लुका मॉन्तेचियानी" -#: main.cpp:56 +#: main.cpp:57 msgid "Original author" msgstr "मूल लेखक" -#: main.cpp:57 +#: main.cpp:58 msgid "Paul Campbell" msgstr "पॉल कैम्पबेल" -#: main.cpp:57 +#: main.cpp:58 msgid "Current Maintainer" msgstr "वर्तमान मेंटेनर" -#: main.cpp:58 +#: main.cpp:59 msgid "Benjamin Meyer" msgstr "बेंजामिन मेयर" -#: main.cpp:58 +#: main.cpp:59 msgid "Added NTP support" msgstr "एनटीपी समर्थन जोड़ा गया है" -#: main.cpp:60 +#: main.cpp:61 #, fuzzy #| msgid "" #| "<h1>Date & Time</h1> This control module can be used to set the system " @@ -201,7 +201,7 @@ "करेंगे. यदि आपके पास रूट पासवर्ड नहीं है, परंतु चाहते हैं कि तंत्र का समय सही किया जाना " "चाहिए, कृपया अपने तंत्र प्रशासक से संपर्क करें." -#: main.cpp:94 +#: main.cpp:98 #, kde-format msgid "Unable to authenticate/execute the action: %1, %2" msgstr "" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmkeyboard.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmkeyboard.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmkeyboard.po 2013-10-19 03:00:29.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmkeyboard.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcmkeyboard\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-10-19 01:37+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2008-07-08 10:41+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -58,7 +58,7 @@ #. i18n: ectx: property (text), widget (QPushButton, prevbutton) #. i18n: ectx: property (text), widget (QPushButton, previewbutton) -#: kcm_add_layout_dialog.ui:101 kcm_keyboard.ui:340 +#: kcm_add_layout_dialog.ui:101 kcm_keyboard.ui:337 msgid "Preview" msgstr "" @@ -68,14 +68,14 @@ msgstr "" #. i18n: ectx: property (text), widget (QLabel, label_4) -#: kcm_keyboard.ui:33 +#: kcm_keyboard.ui:30 #, fuzzy #| msgid "Keyboard Repeat" msgid "Keyboard &model:" msgstr "कुंजी का दोहराव" #. i18n: ectx: property (whatsThis), widget (QComboBox, keyboardModelComboBox) -#: kcm_keyboard.ui:53 +#: kcm_keyboard.ui:50 msgid "" "Here you can choose a keyboard model. This setting is independent of your " "keyboard layout and refers to the \"hardware\" model, i.e. the way your " @@ -86,86 +86,86 @@ msgstr "" #. i18n: ectx: attribute (title), widget (QWidget, tabLayouts) -#: kcm_keyboard.ui:94 +#: kcm_keyboard.ui:91 msgid "Layouts" msgstr "" #. i18n: ectx: property (title), widget (KButtonGroup, kbuttongroup) -#: kcm_keyboard.ui:102 +#: kcm_keyboard.ui:99 msgid "Layout Indicator" msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, showIndicatorChk) -#: kcm_keyboard.ui:108 +#: kcm_keyboard.ui:105 msgid "Show layout indicator" msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, showSingleChk) -#: kcm_keyboard.ui:115 +#: kcm_keyboard.ui:112 #, fuzzy #| msgid "&Enable keyboard repeat" msgid "Show for single layout" msgstr "कुंजी का दोहराव सक्षम करें (&E)" #. i18n: ectx: property (text), widget (QRadioButton, showFlagRadioBtn) -#: kcm_keyboard.ui:122 +#: kcm_keyboard.ui:119 msgid "Show flag" msgstr "" #. i18n: ectx: property (text), widget (QRadioButton, showLabelRadioBtn) -#: kcm_keyboard.ui:129 +#: kcm_keyboard.ui:126 msgid "Show label" msgstr "" #. i18n: ectx: property (text), widget (QRadioButton, showLabelOnFlagRadioBtn) -#: kcm_keyboard.ui:136 +#: kcm_keyboard.ui:133 msgid "Show label on flag" msgstr "" #. i18n: ectx: property (whatsThis), widget (KButtonGroup, switchingPolicyButtonGroup) -#: kcm_keyboard.ui:146 +#: kcm_keyboard.ui:143 msgid "" "If you select \"Application\" or \"Window\" switching policy, changing the " "keyboard layout will only affect the current application or window." msgstr "" #. i18n: ectx: property (title), widget (KButtonGroup, switchingPolicyButtonGroup) -#: kcm_keyboard.ui:149 +#: kcm_keyboard.ui:146 msgid "Switching Policy" msgstr "" #. i18n: ectx: property (text), widget (QRadioButton, switchByGlobalRadioBtn) -#: kcm_keyboard.ui:155 +#: kcm_keyboard.ui:152 msgid "&Global" msgstr "" #. i18n: ectx: property (text), widget (QRadioButton, switchByDesktopRadioBtn) -#: kcm_keyboard.ui:165 +#: kcm_keyboard.ui:162 msgid "&Desktop" msgstr "" #. i18n: ectx: property (text), widget (QRadioButton, switchByApplicationRadioBtn) -#: kcm_keyboard.ui:172 +#: kcm_keyboard.ui:169 msgid "&Application" msgstr "" #. i18n: ectx: property (text), widget (QRadioButton, switchByWindowRadioBtn) -#: kcm_keyboard.ui:179 +#: kcm_keyboard.ui:176 msgid "&Window" msgstr "" #. i18n: ectx: property (title), widget (QGroupBox, shortcutsGroupBox) -#: kcm_keyboard.ui:189 +#: kcm_keyboard.ui:186 msgid "Shortcuts for Switching Layout" msgstr "" #. i18n: ectx: property (text), widget (QLabel, label) -#: kcm_keyboard.ui:195 +#: kcm_keyboard.ui:192 msgid "Main shortcuts:" msgstr "" #. i18n: ectx: property (whatsThis), widget (QPushButton, xkbGrpShortcutBtn) -#: kcm_keyboard.ui:208 +#: kcm_keyboard.ui:205 msgid "" "This is a shortcut for switching layouts which is handled by X.org. It " "allows modifier-only shortcuts." @@ -173,36 +173,36 @@ #. i18n: ectx: property (text), widget (QPushButton, xkbGrpShortcutBtn) #. i18n: ectx: property (text), widget (QPushButton, xkb3rdLevelShortcutBtn) -#: kcm_keyboard.ui:211 kcm_keyboard.ui:241 +#: kcm_keyboard.ui:208 kcm_keyboard.ui:238 msgctxt "no shortcut defined" msgid "None" msgstr "" #. i18n: ectx: property (text), widget (QToolButton, xkbGrpClearBtn) #. i18n: ectx: property (text), widget (QToolButton, xkb3rdLevelClearBtn) -#: kcm_keyboard.ui:218 kcm_keyboard.ui:248 +#: kcm_keyboard.ui:215 kcm_keyboard.ui:245 msgid "..." msgstr "" #. i18n: ectx: property (text), widget (QLabel, label_3) -#: kcm_keyboard.ui:225 +#: kcm_keyboard.ui:222 msgid "3rd level shortcuts:" msgstr "" #. i18n: ectx: property (whatsThis), widget (QPushButton, xkb3rdLevelShortcutBtn) -#: kcm_keyboard.ui:238 +#: kcm_keyboard.ui:235 msgid "" "This is a shortcut for switching to a third level of the active layout (if " "it has one) which is handled by X.org. It allows modifier-only shortcuts." msgstr "" #. i18n: ectx: property (text), widget (QLabel, label_2) -#: kcm_keyboard.ui:255 +#: kcm_keyboard.ui:252 msgid "Alternative shortcut:" msgstr "" #. i18n: ectx: property (whatsThis), widget (KKeySequenceWidget, kdeKeySequence) -#: kcm_keyboard.ui:268 +#: kcm_keyboard.ui:265 msgid "" "This is a shortcut for switching layouts which is handled by KDE. It does " "not support modifier-only shortcuts and also may not work in some situations " @@ -210,51 +210,51 @@ msgstr "" #. i18n: ectx: property (title), widget (QGroupBox, layoutsGroupBox) -#: kcm_keyboard.ui:286 +#: kcm_keyboard.ui:283 #, fuzzy #| msgid "&Enable keyboard repeat" msgid "Configure layouts" msgstr "कुंजी का दोहराव सक्षम करें (&E)" #. i18n: ectx: property (text), widget (QPushButton, addLayoutBtn) -#: kcm_keyboard.ui:300 +#: kcm_keyboard.ui:297 msgid "Add" msgstr "" #. i18n: ectx: property (text), widget (QPushButton, removeLayoutBtn) -#: kcm_keyboard.ui:310 +#: kcm_keyboard.ui:307 msgid "Remove" msgstr "" #. i18n: ectx: property (text), widget (QPushButton, moveUpBtn) -#: kcm_keyboard.ui:320 +#: kcm_keyboard.ui:317 msgid "Move Up" msgstr "" #. i18n: ectx: property (text), widget (QPushButton, moveDownBtn) -#: kcm_keyboard.ui:330 +#: kcm_keyboard.ui:327 msgid "Move Down" msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, layoutLoopingCheckBox) -#: kcm_keyboard.ui:375 +#: kcm_keyboard.ui:372 #, fuzzy #| msgid "&Enable keyboard repeat" msgid "Spare layouts" msgstr "कुंजी का दोहराव सक्षम करें (&E)" #. i18n: ectx: property (text), widget (QLabel, label_5) -#: kcm_keyboard.ui:407 +#: kcm_keyboard.ui:404 msgid "Main layout count:" msgstr "" #. i18n: ectx: attribute (title), widget (QWidget, tabAdvanced) -#: kcm_keyboard.ui:437 +#: kcm_keyboard.ui:434 msgid "Advanced" msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, configureKeyboardOptionsChk) -#: kcm_keyboard.ui:443 +#: kcm_keyboard.ui:440 #, fuzzy #| msgid "&Enable keyboard repeat" msgid "&Configure keyboard options" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmkeys.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmkeys.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmkeys.po 2014-03-22 03:29:17.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmkeys.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcmkeys\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-22 01:48+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-12-29 03:24+0530\n" "Last-Translator: G Karunakar\n" "Language-Team: Hindi <en@li.org>\n" @@ -60,48 +60,27 @@ msgid "Remove Component" msgstr "अवयव हटाएँ" -#: kglobalshortcutseditor.cpp:180 -#, kde-format -msgid "" -"Component '%1' is currently active. Only global shortcuts currently not " -"active will be removed from the list.\n" -"All global shortcuts will reregister themselves with their defaults when " -"they are next started." -msgstr "" - -#: kglobalshortcutseditor.cpp:182 kglobalshortcutseditor.cpp:192 -msgid "Remove component" -msgstr "अवयव हटाएँ" - -#: kglobalshortcutseditor.cpp:188 -#, kde-format -msgid "" -"Are you sure you want to remove the registered shortcuts for component '%1'? " -"The component and shortcuts will reregister themselves with their default " -"settings when they are next started." -msgstr "" - -#: kglobalshortcutseditor.cpp:384 +#: kglobalshortcutseditor.cpp:343 msgid "" "Your current changes will be lost if you load another scheme before saving " "this one" msgstr "" "इसे सहेजने से पहले यदि आप अन्य योजना लोड करना चाहेंगे तो आपके मौज़ूदा परिवर्तन गुम हो जाएँगे." -#: kglobalshortcutseditor.cpp:385 +#: kglobalshortcutseditor.cpp:344 msgid "Load Shortcut Scheme" msgstr "शॉर्टकट योजना लोड करें" -#: kglobalshortcutseditor.cpp:386 +#: kglobalshortcutseditor.cpp:345 msgid "Load" msgstr "लोड करें" -#: kglobalshortcutseditor.cpp:399 +#: kglobalshortcutseditor.cpp:358 #, kde-format msgid "This file (%1) does not exist. You can only select local files." msgstr "यह फ़ाइल (%1) मौजूद नहीं है. आप सिर्फ स्थानीय फ़ाइलों से चुन सकते हैं." -#: kglobalshortcutseditor.cpp:427 kglobalshortcutseditor.cpp:450 +#: kglobalshortcutseditor.cpp:386 kglobalshortcutseditor.cpp:409 #, kde-format msgid "" "Message: %1\n" @@ -110,10 +89,31 @@ "संदेश: %1\n" "त्रुटि: %2" -#: kglobalshortcutseditor.cpp:432 kglobalshortcutseditor.cpp:455 +#: kglobalshortcutseditor.cpp:391 kglobalshortcutseditor.cpp:414 msgid "Failed to contact the KDE global shortcuts daemon\n" msgstr "केडीई वैश्विक शॉर्टकट डेमन से सम्पर्क में असफल\n" +#: kglobalshortcutseditor.cpp:522 +#, kde-format +msgid "" +"Component '%1' is currently active. Only global shortcuts currently not " +"active will be removed from the list.\n" +"All global shortcuts will reregister themselves with their defaults when " +"they are next started." +msgstr "" + +#: kglobalshortcutseditor.cpp:524 kglobalshortcutseditor.cpp:534 +msgid "Remove component" +msgstr "अवयव हटाएँ" + +#: kglobalshortcutseditor.cpp:530 +#, kde-format +msgid "" +"Are you sure you want to remove the registered shortcuts for component '%1'? " +"The component and shortcuts will reregister themselves with their default " +"settings when they are next started." +msgstr "" + #. i18n: ectx: property (text), widget (QLabel, label) #: kglobalshortcutseditor.ui:19 msgid "KDE component:" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmkwincompositing.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmkwincompositing.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmkwincompositing.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmkwincompositing.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,740 @@ +# translation of kcmkwincompositing.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007. +msgid "" +msgstr "" +"Project-Id-Version: kcmkwincompositing\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2008-07-08 11:50+0530\n" +"Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"X-Generator: KBabel 1.11.4\n" + +msgctxt "NAME OF TRANSLATORS" +msgid "Your names" +msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर" + +msgctxt "EMAIL OF TRANSLATORS" +msgid "Your emails" +msgstr "raviratlami@aol.in" + +#: ktimerdialog.cpp:167 +#, kde-format +msgid "1 second remaining:" +msgid_plural "%1 seconds remaining:" +msgstr[0] "१ सेकण्ड बाकी:" +msgstr[1] "%1 सेकण्ड बाकी:" + +#: main.cpp:63 +msgid "Confirm Desktop Effects Change" +msgstr "डेस्कटॉप प्रभाव में बदलाव्तन की पुष्टि करें" + +#: main.cpp:67 +msgid "&Accept Configuration" +msgstr "कॉन्फ़िगरेशन स्वीकारें (&A)" + +#: main.cpp:68 +msgid "&Return to Previous Configuration" +msgstr "पिछले कॉन्फ़िगरेशन में वापस जाएँ (&R)" + +#: main.cpp:70 +msgid "" +"Desktop effects settings have changed.\n" +"Do you want to keep the new settings?\n" +"They will be automatically reverted in 10 seconds." +msgstr "" +"डेस्कटॉप प्रभाव सेटिंग बदला गया.\n" +"क्या आप नई सेटिंग को रखना चाहते हैं?\n" +"उन्हें १० सेकण्ड में स्वचालित पहले जैसा कर दिया जाएगा." + +#: main.cpp:85 +msgctxt "" +"Action to open a dialog showing detailed information why an effect could not " +"be loaded" +msgid "Details" +msgstr "" + +#: main.cpp:86 +msgctxt "Prevent warning from bein displayed again" +msgid "Don't show again!" +msgstr "" + +#: main.cpp:130 +msgid "Use GLSL shaders" +msgstr "" + +#: main.cpp:142 +msgid "None" +msgstr "" + +#: main.cpp:143 +msgid "The painting is not synchronized with the screen." +msgstr "" + +#: main.cpp:144 +msgid "Automatic" +msgstr "" + +#: main.cpp:145 +msgid "" +"Tries to re-use older buffers and if that is not possible,\n" +"picks a strategy matching your hardware." +msgstr "" + +#: main.cpp:146 +msgid "Only when Cheap" +msgstr "" + +#: main.cpp:147 +msgid "" +"When major regions of the screen are updated,\n" +"the entire screen will be repainted.\n" +"Can cause tearing with small updates." +msgstr "" + +#: main.cpp:148 +msgid "Full scene repaints" +msgstr "" + +#: main.cpp:149 +msgid "" +"The complete screen is repainted for every frame.\n" +"Can be slow with large blurred areas." +msgstr "" + +#: main.cpp:150 +msgid "Re-use screen content" +msgstr "" + +#: main.cpp:151 +msgid "" +"WARNING:\n" +"This strategy is usually slow with Open Source drivers.\n" +"Undamaged pixels will be copied from GL_FRONT to GL_BACK" +msgstr "" + +#: main.cpp:204 +msgid "kcmkwincompositing" +msgstr "केसीएम_केविन_कम्पोजिशिंग" + +#: main.cpp:205 +msgid "KWin Desktop Effects Configuration Module" +msgstr "के_विन डेस्कटॉप प्रभाव कॉन्फ़िगरेशन मॉड्यूल" + +#: main.cpp:206 +msgid "(c) 2007 Rivo Laks" +msgstr "(c) 2007 रिवो लेक्स" + +#: main.cpp:207 +msgid "Rivo Laks" +msgstr "रिवो लेक्स" + +#: main.cpp:225 +#, fuzzy +#| msgid "All Effects" +msgid "No effect" +msgstr "सभी प्रभाव" + +#: main.cpp:248 +msgid "" +"Failed to activate desktop effects using the given configuration options. " +"Settings will be reverted to their previous values.\n" +"\n" +"Check your X configuration. You may also consider changing advanced options, " +"especially changing the compositing type." +msgstr "" + +#: main.cpp:285 +msgid "Appearance" +msgstr "रूप" + +#: main.cpp:286 +msgid "Accessibility" +msgstr "पहुँच" + +#: main.cpp:287 +msgid "Focus" +msgstr "" + +#: main.cpp:288 +msgid "Window Management" +msgstr "विंडो प्रबंधन" + +#: main.cpp:289 +msgid "Candy" +msgstr "" + +#: main.cpp:290 +msgid "Demos" +msgstr "डेमो" + +#: main.cpp:291 +msgid "Tests" +msgstr "परीक्षण" + +#: main.cpp:292 +msgid "Tools" +msgstr "" + +#: main.cpp:471 +msgid "" +"Desktop effects are not available on this system due to the following " +"technical issues:" +msgstr "" + +#: main.cpp:474 +msgctxt "" +"Reason shown when trying to activate desktop effects and KWin (most likely) " +"crashes" +msgid "Window Manager seems not to be running" +msgstr "" + +#: main.cpp:681 +msgid "" +"Your settings have been saved but as KDE is currently running in failsafe " +"mode desktop effects cannot be enabled at this time.\n" +"\n" +"Please exit failsafe mode to enable desktop effects." +msgstr "" + +#: main.cpp:723 +#, kde-format +msgctxt "Error Message shown when a desktop effect could not be loaded" +msgid "One desktop effect could not be loaded." +msgid_plural "%1 desktop effects could not be loaded." +msgstr[0] "" +msgstr[1] "" + +#: main.cpp:742 +#, kde-format +msgctxt "Effect with given name could not be activated due to unknown reason" +msgid "%1 effect failed to load due to unknown reason." +msgstr "" + +#: main.cpp:744 +#, kde-format +msgctxt "" +"Effect with given name could not be activated as it requires hardware shaders" +msgid "%1 effect requires hardware support." +msgstr "" + +#: main.cpp:746 +#, kde-format +msgctxt "Effect with given name could not be activated as it requires OpenGL" +msgid "%1 effect requires OpenGL." +msgstr "" + +#: main.cpp:748 +#, kde-format +msgctxt "Effect with given name could not be activated as it requires OpenGL 2" +msgid "%1 effect requires OpenGL 2." +msgstr "" + +#: main.cpp:750 +msgctxt "Window title" +msgid "List of effects which could not be loaded" +msgstr "" + +#: main.cpp:757 +msgid "" +"For technical reasons it is not possible to determine all possible error " +"causes." +msgstr "" + +#: main.cpp:823 +#, fuzzy +#| msgid "Confirm Desktop Effects Change" +msgctxt "" +"Error Message shown when compositing is not active after tried activation" +msgid "Desktop effect system is not running." +msgstr "डेस्कटॉप प्रभाव में बदलाव्तन की पुष्टि करें" + +#: main.cpp:899 +msgid "<h1>Desktop Effects</h1>" +msgstr "<h1>डेस्कटॉप प्रभाव</h1>" + +#. i18n: ectx: attribute (title), widget (QWidget, tab) +#: main.ui:31 +#, fuzzy +#| msgid "General" +msgid "General" +msgstr "सामान्य" + +#. i18n: ectx: property (text), widget (QLabel, label_9) +#: main.ui:92 +msgid "Pressing this button can crash the desktop." +msgstr "" + +#. i18n: ectx: property (text), widget (QCheckBox, rearmSafetyCheck) +#: main.ui:115 +msgid "I have saved my data." +msgstr "" + +#. i18n: ectx: property (text), widget (QPushButton, rearmGlSupportButton) +#: main.ui:138 +msgid "Re-enable OpenGL detection" +msgstr "" + +#. i18n: ectx: property (title), widget (QGroupBox, groupBox_2) +#: main.ui:169 +msgid "Activation" +msgstr "" + +#. i18n: ectx: property (text), widget (QCheckBox, useCompositing) +#: main.ui:178 +#, fuzzy +#| msgid "Enable desktop effects" +msgctxt "@option:check" +msgid "Enable desktop effects at startup" +msgstr "डेस्कटॉप प्रभाव को सक्षम करें " + +#. i18n: ectx: property (text), widget (QLabel, label_6) +#: main.ui:209 +msgid "Desktop effects can be toggled anytime using this shortcut:" +msgstr "" + +#. i18n: ectx: property (title), widget (QGroupBox, groupBox) +#: main.ui:240 +msgctxt "@title:group a few general options to set up desktop effects" +msgid "Simple effect setup" +msgstr "" + +#. i18n: ectx: property (text), widget (QCheckBox, effectWinManagement) +#: main.ui:249 +msgid "Improved window management" +msgstr "उन्नत विंडो प्रबंधन" + +#. i18n: ectx: property (text), widget (QCheckBox, effectAnimations) +#: main.ui:259 +msgid "Various animations" +msgstr "भिन्न एनीमेशन" + +#. i18n: ectx: property (text), widget (QLabel, label_4) +#: main.ui:269 +msgid "Effect for desktop switching:" +msgstr "" + +#. i18n: ectx: property (text), widget (QLabel, label_5) +#: main.ui:305 +msgid "Animation speed:" +msgstr "" + +#. i18n: ectx: property (text), item, widget (KComboBox, animationSpeedCombo) +#: main.ui:328 +msgid "Instant" +msgstr "" + +#. i18n: ectx: property (text), item, widget (KComboBox, animationSpeedCombo) +#: main.ui:333 +msgid "Very Fast" +msgstr "" + +#. i18n: ectx: property (text), item, widget (KComboBox, animationSpeedCombo) +#: main.ui:338 +msgid "Fast" +msgstr "" + +#. i18n: ectx: property (text), item, widget (KComboBox, animationSpeedCombo) +#: main.ui:343 +msgid "Normal" +msgstr "" + +#. i18n: ectx: property (text), item, widget (KComboBox, animationSpeedCombo) +#: main.ui:348 +msgid "Slow" +msgstr "" + +#. i18n: ectx: property (text), item, widget (KComboBox, animationSpeedCombo) +#: main.ui:353 +msgid "Very Slow" +msgstr "" + +#. i18n: ectx: property (text), item, widget (KComboBox, animationSpeedCombo) +#: main.ui:358 +msgid "Extremely Slow" +msgstr "" + +#. i18n: ectx: property (text), widget (QLabel, label) +#: main.ui:392 +#, fuzzy +#| msgid "You can find more effects in the 'All Effects' tab" +msgid "" +"You can find more effects, as well as effect-specific settings, in the \"All " +"Effects\" tab above." +msgstr "'सभी प्रभाव' टैब में आपको और भी प्रभाव मिल सकते हैं" + +#. i18n: ectx: attribute (title), widget (QWidget, tab_2) +#: main.ui:440 +msgid "All Effects" +msgstr "सभी प्रभाव" + +#. i18n: ectx: property (text), widget (QLabel, label_2) +#: main.ui:446 +msgid "" +"Hint: To find out or configure how to activate an effect, look at the " +"effect's settings." +msgstr "" +"युक्ति:प्रभाव ढूंढने के लिए या प्रभाव कैसे सक्षम करें यह कॉन्फ़िगर करने के लिए प्रभाव के विन्यास " +"में देखें." + +#. i18n: ectx: property (text), widget (KPushButton, ghns) +#: main.ui:473 +#, fuzzy +#| msgid "All Effects" +msgid "Get New Effects ..." +msgstr "सभी प्रभाव" + +#. i18n: ectx: attribute (title), widget (QWidget, tab_4) +#: main.ui:498 +#, fuzzy +#| msgid "Advanced Options" +msgid "Advanced" +msgstr "विस्तृत विकल्प" + +#. i18n: ectx: property (title), widget (QGroupBox, glGroup) +#: main.ui:552 +msgid "OpenGL Options" +msgstr "ओपन जीएल विकल्प" + +#. i18n: ectx: property (toolTip), widget (QCheckBox, glColorCorrection) +#: main.ui:564 +msgid "" +"<p>Activates color correction if possible, using the Kolor-Manager. Requires " +"OpenGL 2 Shaders to be enabled and Kolor-Manager to be installed. May fail " +"silently.</p><p><strong>Experimental</strong>.</p>" +msgstr "" + +#. i18n: ectx: property (text), widget (QCheckBox, glColorCorrection) +#: main.ui:567 +msgid "Enable color correction (experimental)" +msgstr "" + +#. i18n: ectx: property (text), widget (QLabel, glSwapStrategyLabel) +#: main.ui:576 +msgid "Tearing Prevention (VSync)" +msgstr "" + +#. i18n: ectx: property (title), widget (QGroupBox, groupBox_3) +#: main.ui:629 +#, fuzzy +#| msgid "XRender Options" +msgid "General Options" +msgstr "एक्स-रेंडर विकल्प" + +#. i18n: ectx: property (text), widget (QLabel, label_8) +#: main.ui:644 +msgid "Keep window thumbnails:" +msgstr "" + +#. i18n: ectx: property (text), item, widget (KComboBox, windowThumbnails) +#: main.ui:664 +msgctxt "" +"A window thumbnail requires to have the corresponding window mapped. To have " +"thumbnails at all time, windows are not unmapped. This can break window " +"minimization as it is modelled as unmapping of windows." +msgid "Always (Breaks minimization)" +msgstr "" + +#. i18n: ectx: property (text), item, widget (KComboBox, windowThumbnails) +#: main.ui:669 +msgctxt "" +"Windows are not unmapped if the window is somewhere visible on any of the " +"virtual desktops." +msgid "Only for Shown Windows" +msgstr "" + +#. i18n: ectx: property (text), item, widget (KComboBox, windowThumbnails) +#: main.ui:674 +msgctxt "" +"Windows are unmapped as they are requested. This can lead to not having " +"updated thumbnials for windows on other desktops." +msgid "Never" +msgstr "" + +#. i18n: ectx: property (text), widget (QLabel, scaleMethodLabel) +#: main.ui:688 +msgid "Scale method:" +msgstr "" + +#. i18n: ectx: property (toolTip), widget (QComboBox, xrScaleFilter) +#: main.ui:715 +msgid "" +"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/" +"REC-html40/strict.dtd\">\n" +"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css" +"\">\n" +"p, li { white-space: pre-wrap; }\n" +"</style></head><body style=\" font-family:'Segoe'; font-size:8pt; font-" +"weight:400; font-style:normal;\">\n" +"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-" +"right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-" +"weight:600;\">Crisp:</span></p>\n" +"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-" +"right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:" +"italic;\">XRenderSetPictureFilter(\"fast\")</span> - Pretty fast on all " +"GPUs but looks bricky</p>\n" +"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; " +"margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></" +"p>\n" +"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-" +"right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-" +"weight:600;\">Smooth:</span></p>\n" +"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-" +"right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:" +"italic;\">XRenderSetPictureFilter(\"good\") </span>- linear blending.</p>\n" +"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-" +"right:0px; -qt-block-indent:0; text-indent:0px;\">Fast enough on newer " +"nvidia GPUs and maybe others but also can be <span style=\" text-decoration: " +"underline;\">very</span> slow, you will have to try it.</p></body></html>" +msgstr "" + +#. i18n: ectx: property (text), item, widget (QComboBox, xrScaleFilter) +#. i18n: ectx: property (text), item, widget (QComboBox, glScaleFilter) +#: main.ui:722 main.ui:755 +msgid "Crisp" +msgstr "" + +#. i18n: ectx: property (text), item, widget (QComboBox, xrScaleFilter) +#: main.ui:727 +#, fuzzy +#| msgid "Smooth scaling (slower)" +msgid "Smooth (slower)" +msgstr "स्मूथ स्केलिंग (धीमा)" + +#. i18n: ectx: property (toolTip), widget (QComboBox, glScaleFilter) +#: main.ui:748 +msgid "" +"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/" +"REC-html40/strict.dtd\">\n" +"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css" +"\">\n" +"p, li { white-space: pre-wrap; }\n" +"</style></head><body style=\" font-family:'Segoe'; font-size:8pt; font-" +"weight:400; font-style:normal;\">\n" +"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-" +"right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-" +"weight:600;\">Crisp:</span></p>\n" +"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-" +"right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:" +"italic;\">GL_NEAREST</span> - (very) fast on all GPUs but looks bricky</p>\n" +"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; " +"margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></" +"p>\n" +"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-" +"right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-" +"weight:600;\">Smooth:</span></p>\n" +"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-" +"right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-style:" +"italic;\">GL_LINEAR</span> - fast on most GPUs but a little blurry</p>\n" +"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; " +"margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></" +"p>\n" +"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-" +"right:0px; -qt-block-indent:0; text-indent:0px;\"><span style=\" font-" +"weight:600;\">Accurate:</span></p>\n" +"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-" +"right:0px; -qt-block-indent:0; text-indent:0px;\">Lanczos filter, requires " +"glsl shader support.</p>\n" +"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-" +"right:0px; -qt-block-indent:0; text-indent:0px;\">Might be slow on weaker " +"GPUs and even cause various troubles with broken drivers (from " +"overbrightening to segfaults).</p>\n" +"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-" +"right:0px; -qt-block-indent:0; text-indent:0px;\">Fall back to \"Smooth\" if " +"you have problems.</p></body></html>" +msgstr "" + +#. i18n: ectx: property (text), item, widget (QComboBox, glScaleFilter) +#: main.ui:760 +msgid "Smooth" +msgstr "" + +#. i18n: ectx: property (text), item, widget (QComboBox, glScaleFilter) +#: main.ui:765 +msgid "Accurate" +msgstr "" + +#. i18n: ectx: property (text), widget (QCheckBox, unredirectFullscreen) +#: main.ui:775 +#, fuzzy +#| msgid "Enable desktop effects" +msgid "Suspend desktop effects for fullscreen windows" +msgstr "डेस्कटॉप प्रभाव को सक्षम करें " + +#. i18n: ectx: property (text), widget (QLabel, label_7) +#: main.ui:819 +msgid "Compositing type:" +msgstr "कम्पोजिशिंग क़िस्म:" + +#. i18n: ectx: property (text), item, widget (KComboBox, compositingType) +#: main.ui:839 +#, fuzzy +#| msgid "OpenGL" +msgid "OpenGL 3.1" +msgstr "ओपन-जीएल" + +#. i18n: ectx: property (text), item, widget (KComboBox, compositingType) +#: main.ui:844 +#, fuzzy +#| msgid "OpenGL" +msgid "OpenGL 2.0" +msgstr "ओपन-जीएल" + +#. i18n: ectx: property (text), item, widget (KComboBox, compositingType) +#: main.ui:849 +#, fuzzy +#| msgid "OpenGL" +msgid "OpenGL 1.2" +msgstr "ओपन-जीएल" + +#. i18n: ectx: property (text), item, widget (KComboBox, compositingType) +#: main.ui:854 +msgid "XRender" +msgstr "एक्स रेंडर" + +#. i18n: ectx: property (text), widget (QLabel, label_3) +#: main.ui:862 +msgid "Qt graphics system:" +msgstr "" + +#. i18n: ectx: property (toolTip), widget (QComboBox, graphicsSystem) +#: main.ui:878 +msgid "" +"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/" +"REC-html40/strict.dtd\">\n" +"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css" +"\">\n" +"p, li { white-space: pre-wrap; }\n" +"</style></head><body style=\" font-family:'Segoe'; font-size:8pt; font-" +"weight:400; font-style:normal;\">\n" +"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-" +"right:0px; -qt-block-indent:0; text-indent:0px;\">It is <span style=\" font-" +"weight:600;\">strongly recommended</span> to use the <span style=\" font-" +"weight:600;\">native</span> system when using the <span style=\" font-" +"weight:600;\">XRender</span> backend.</p>\n" +"<p style=\"-qt-paragraph-type:empty; margin-top:0px; margin-bottom:0px; " +"margin-left:0px; margin-right:0px; -qt-block-indent:0; text-indent:0px;\"></" +"p>\n" +"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-" +"right:0px; -qt-block-indent:0; text-indent:0px;\">On the other hand, many " +"decorations perform better with the <span style=\" font-weight:600;" +"\">raster</span> system on the <span style=\" font-weight:600;\">default and " +"generally preferred OpenGL</span> backend (though some don't - also the " +"impact here can be anything between \"slight\" and \"incredible\" depending " +"on the GPU and driver)</p></body></html>" +msgstr "" + +#. i18n: ectx: property (text), item, widget (QComboBox, graphicsSystem) +#: main.ui:882 +msgid "Native" +msgstr "" + +#. i18n: ectx: property (text), item, widget (QComboBox, graphicsSystem) +#: main.ui:887 +msgid "Raster" +msgstr "" + +#~ msgid "Use VSync" +#~ msgstr "वी-सिंक का उपयोग करें" + +#, fuzzy +#~| msgid "Direct rendering" +#~ msgid "Enable direct rendering" +#~ msgstr "प्रत्यक्ष रेंडरिंग" + +#, fuzzy +#~| msgid "Enable desktop effects" +#~ msgid "Suspend Desktop Effects" +#~ msgstr "डेस्कटॉप प्रभाव को सक्षम करें " + +#, fuzzy +#~| msgid "Enable desktop effects" +#~ msgid "Resume Desktop Effects" +#~ msgstr "डेस्कटॉप प्रभाव को सक्षम करें " + +#, fuzzy +#~| msgid "Common Effects" +#~ msgid "Common Settings" +#~ msgstr "सामान्य प्रभाव" + +#, fuzzy +#~| msgid "Compositing type:" +#~ msgid "Compositing State" +#~ msgstr "कम्पोजिशिंग क़िस्म:" + +#~ msgid "Shadows" +#~ msgstr "छाया" + +#~ msgid "OpenGL mode:" +#~ msgstr "ओपनजीएल मोड" + +#~ msgid "Texture From Pixmap" +#~ msgstr "पिक्समैप से टैक्सचर" + +#~ msgid "Shared Memory" +#~ msgstr "साझा मेमोरी" + +#~ msgid "Fallback" +#~ msgstr "फालबैक " + +#~ msgid "Texture filter:" +#~ msgstr "टैक्सचर फिल्टर:" + +#~ msgid "Nearest (fastest)" +#~ msgstr "निकटस्थ (तीव्रतम)" + +#~ msgid "Bilinear" +#~ msgstr "द्विरेखीय" + +#~ msgid "Trilinear (best quality)" +#~ msgstr "ट्राइलिनियर (उच्चतम गुणवत्ता)" + +#~ msgid "Compositing is not supported on your system." +#~ msgstr "कम्पोजिशिंग आपके तंत्र में समर्थित नहीं है." + +#, fuzzy +#~| msgid "Compositing type:" +#~ msgid "Compositing is active" +#~ msgstr "कम्पोजिशिंग क़िस्म:" + +#, fuzzy +#~| msgid "Compositing type:" +#~ msgid "Suspend Compositing" +#~ msgstr "कम्पोजिशिंग क़िस्म:" + +#, fuzzy +#~| msgid "Compositing type:" +#~ msgid "Resume Compositing" +#~ msgstr "कम्पोजिशिंग क़िस्म:" + +#, fuzzy +#~| msgid "Compositing type:" +#~ msgid "Compositing is disabled" +#~ msgstr "कम्पोजिशिंग क़िस्म:" + +#, fuzzy +#~| msgid "All Effects" +#~ msgid "All Desktops" +#~ msgstr "सभी प्रभाव" + +#, fuzzy +#~| msgid "Bilinear" +#~ msgid "Cylinder" +#~ msgstr "द्विरेखीय" + +#~ msgid "Advanced Compositing Options" +#~ msgstr "विस्तृत कम्पोजिशनिंग विकल्प " + +#~ msgid "Misc" +#~ msgstr "विविध" + +#~ msgid "Keep thumbnails of hidden windows up to date" +#~ msgstr "छुपे विंडो के लघुछवियों को अद्यतन बनाए रखता है" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmkwindecoration.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmkwindecoration.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmkwindecoration.po 2014-03-19 06:15:59.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmkwindecoration.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcmkwindecoration\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-19 04:21+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2007-10-22 15:23+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -24,17 +24,17 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" #. i18n: ectx: property (text), widget (QLabel, label) -#: auroraeconfig.ui:23 +#: auroraeconfig.ui:19 #, fuzzy #| msgid "B&order size:" msgid "Border size:" msgstr "किनारा आकार:" #. i18n: ectx: property (text), item, widget (KComboBox, borderSizesCombo) -#: auroraeconfig.ui:34 configdialog.cpp:36 +#: auroraeconfig.ui:30 configdialog.cpp:32 #, fuzzy #| msgid "Tiny" msgctxt "@item:inlistbox Border size:" @@ -42,7 +42,7 @@ msgstr "नन्हा" #. i18n: ectx: property (text), item, widget (KComboBox, borderSizesCombo) -#: auroraeconfig.ui:39 configdialog.cpp:37 +#: auroraeconfig.ui:35 configdialog.cpp:33 #, fuzzy #| msgid "Normal" msgctxt "@item:inlistbox Border size:" @@ -50,7 +50,7 @@ msgstr "सामान्य" #. i18n: ectx: property (text), item, widget (KComboBox, borderSizesCombo) -#: auroraeconfig.ui:44 configdialog.cpp:38 +#: auroraeconfig.ui:40 configdialog.cpp:34 #, fuzzy #| msgid "Large" msgctxt "@item:inlistbox Border size:" @@ -58,7 +58,7 @@ msgstr "बड़ा" #. i18n: ectx: property (text), item, widget (KComboBox, borderSizesCombo) -#: auroraeconfig.ui:49 configdialog.cpp:39 +#: auroraeconfig.ui:45 configdialog.cpp:35 #, fuzzy #| msgid "Very Large" msgctxt "@item:inlistbox Border size:" @@ -66,7 +66,7 @@ msgstr "बहुत बड़ा" #. i18n: ectx: property (text), item, widget (KComboBox, borderSizesCombo) -#: auroraeconfig.ui:54 configdialog.cpp:40 +#: auroraeconfig.ui:50 configdialog.cpp:36 #, fuzzy #| msgid "Huge" msgctxt "@item:inlistbox Border size:" @@ -74,7 +74,7 @@ msgstr "बहुत बड़ा" #. i18n: ectx: property (text), item, widget (KComboBox, borderSizesCombo) -#: auroraeconfig.ui:59 configdialog.cpp:41 +#: auroraeconfig.ui:55 configdialog.cpp:37 #, fuzzy #| msgid "Very Huge" msgctxt "@item:inlistbox Border size:" @@ -82,7 +82,7 @@ msgstr "अत्यंत विशाल" #. i18n: ectx: property (text), item, widget (KComboBox, borderSizesCombo) -#: auroraeconfig.ui:64 configdialog.cpp:42 +#: auroraeconfig.ui:60 configdialog.cpp:38 #, fuzzy #| msgid "Oversized" msgctxt "@item:inlistbox Border size:" @@ -90,14 +90,14 @@ msgstr "वृहताकार" #. i18n: ectx: property (text), widget (QLabel, label_2) -#: auroraeconfig.ui:72 +#: auroraeconfig.ui:68 #, fuzzy #| msgid "Buttons" msgid "Button size:" msgstr "बटन्स" #. i18n: ectx: property (text), item, widget (KComboBox, buttonSizesCombo) -#: auroraeconfig.ui:83 +#: auroraeconfig.ui:79 #, fuzzy #| msgid "Tiny" msgctxt "@item:inlistbox Button size:" @@ -105,7 +105,7 @@ msgstr "नन्हा" #. i18n: ectx: property (text), item, widget (KComboBox, buttonSizesCombo) -#: auroraeconfig.ui:88 +#: auroraeconfig.ui:84 #, fuzzy #| msgid "Normal" msgctxt "@item:inlistbox Button size:" @@ -113,7 +113,7 @@ msgstr "सामान्य" #. i18n: ectx: property (text), item, widget (KComboBox, buttonSizesCombo) -#: auroraeconfig.ui:93 +#: auroraeconfig.ui:89 #, fuzzy #| msgid "Large" msgctxt "@item:inlistbox Button size:" @@ -121,7 +121,7 @@ msgstr "बड़ा" #. i18n: ectx: property (text), item, widget (KComboBox, buttonSizesCombo) -#: auroraeconfig.ui:98 +#: auroraeconfig.ui:94 #, fuzzy #| msgid "Very Large" msgctxt "@item:inlistbox Button size:" @@ -129,7 +129,7 @@ msgstr "बहुत बड़ा" #. i18n: ectx: property (text), item, widget (KComboBox, buttonSizesCombo) -#: auroraeconfig.ui:103 +#: auroraeconfig.ui:99 #, fuzzy #| msgid "Huge" msgctxt "@item:inlistbox Button size:" @@ -137,7 +137,7 @@ msgstr "बहुत बड़ा" #. i18n: ectx: property (text), item, widget (KComboBox, buttonSizesCombo) -#: auroraeconfig.ui:108 +#: auroraeconfig.ui:104 #, fuzzy #| msgid "Very Huge" msgctxt "@item:inlistbox Button size:" @@ -145,7 +145,7 @@ msgstr "अत्यंत विशाल" #. i18n: ectx: property (text), item, widget (KComboBox, buttonSizesCombo) -#: auroraeconfig.ui:113 +#: auroraeconfig.ui:109 #, fuzzy #| msgid "Oversized" msgctxt "@item:inlistbox Button size:" @@ -153,20 +153,20 @@ msgstr "वृहताकार" #. i18n: ectx: property (text), widget (QCheckBox, closeWindowsDoubleClick) -#: auroraeconfig.ui:126 +#: auroraeconfig.ui:122 msgid "Close windows by double clicking the menu button" msgstr "" -#: buttons.cpp:620 +#: buttons.cpp:619 msgid "KDE" msgstr "केडीई" -#: buttons.cpp:649 +#: buttons.cpp:648 #, kde-format msgid "%1 (unavailable)" msgstr "%1 (अनुपलब्ध)" -#: buttons.cpp:672 +#: buttons.cpp:671 msgid "" "To add or remove titlebar buttons, simply <i>drag</i> items between the " "available item list and the titlebar preview. Similarly, drag items within " @@ -176,53 +176,53 @@ "पूर्वावलोकन के बीच <i>खींचें</i>. उसी तरह शीर्षक पट्टी पूर्वावलोकन के अंदर की स्थिति बदलने " "के लिए उन्हें खींचें." -#: buttons.cpp:728 +#: buttons.cpp:726 msgid "Resize" msgstr "आकार बदलें" -#: buttons.cpp:733 +#: buttons.cpp:730 msgid "Shade" msgstr "छाया" -#: buttons.cpp:738 +#: buttons.cpp:734 msgid "Keep Below Others" msgstr "अन्यों के नीचे रखें" -#: buttons.cpp:743 +#: buttons.cpp:738 msgid "Keep Above Others" msgstr "अन्यों के ऊपर रखें" -#: buttons.cpp:748 +#: buttons.cpp:742 msgid "Close" msgstr "बंद करें" -#: buttons.cpp:753 +#: buttons.cpp:746 msgid "Maximize" msgstr "अधिकतम" -#: buttons.cpp:758 +#: buttons.cpp:750 msgid "Minimize" msgstr "न्यूनतम " -#: buttons.cpp:763 +#: buttons.cpp:754 msgid "Help" msgstr "मदद" -#: buttons.cpp:768 +#: buttons.cpp:758 msgid "On All Desktops" msgstr "सभी डेस्कटॉप पर" -#: buttons.cpp:773 +#: buttons.cpp:762 msgctxt "Button showing window actions menu" msgid "Window Menu" msgstr "" -#: buttons.cpp:779 +#: buttons.cpp:767 msgctxt "Button showing application menu imported from dbusmenu" msgid "Application Menu" msgstr "" -#: buttons.cpp:785 +#: buttons.cpp:772 msgid "--- spacer ---" msgstr "---स्पेसर---" @@ -256,7 +256,7 @@ msgid "Use custom titlebar button &positions" msgstr "मनपसंद शीर्षक पट्टी बटन स्थितियाँ इस्तेमाल करें (&p)" -#: buttonsconfigdialog.cpp:44 +#: buttonsconfigdialog.cpp:43 msgid "Buttons" msgstr "बटन्स" @@ -270,17 +270,17 @@ msgid "Use this combobox to change the border size of the decoration." msgstr "सजावट के किनारा आकार को बदलने के लिए इस कॉम्बो-बक्से का उपयोग करें." -#: configdialog.cpp:43 +#: configdialog.cpp:39 msgctxt "@item:inlistbox Border size:" msgid "No Side Border" msgstr "" -#: configdialog.cpp:44 +#: configdialog.cpp:40 msgctxt "@item:inlistbox Border size:" msgid "No Border" msgstr "" -#: configdialog.cpp:81 kwindecoration.cpp:371 +#: configdialog.cpp:77 kwindecoration.cpp:388 msgid "Decoration Options" msgstr "सजावट विकल्प" @@ -289,26 +289,26 @@ msgid "Search" msgstr "" -#. i18n: ectx: property (whatsThis), widget (QScrollArea, decorationList) +#. i18n: ectx: property (whatsThis), widget (QDeclarativeView, decorationList) #: decoration.ui:27 msgid "" "Select the window decoration. This is the look and feel of both the window " "borders and the window handle." msgstr "विंडो सजावट चुने. यह विंडो किनारा तथा विंडो हैंडल का रूप और आकार होता है." -#. i18n: ectx: property (text), widget (QPushButton, configureDecorationButton) +#. i18n: ectx: property (text), widget (KPushButton, configureDecorationButton) #: decoration.ui:58 #, fuzzy #| msgid "&Window Decoration" msgid "Configure Decoration..." msgstr "विंडो सजावट (&W)" -#. i18n: ectx: property (text), widget (QPushButton, configureButtonsButton) +#. i18n: ectx: property (text), widget (KPushButton, configureButtonsButton) #: decoration.ui:65 msgid "Configure Buttons..." msgstr "" -#. i18n: ectx: property (text), widget (QPushButton, ghnsButton) +#. i18n: ectx: property (text), widget (KPushButton, ghnsButton) #: decoration.ui:72 #, fuzzy #| msgid "&Window Decoration" @@ -331,22 +331,11 @@ msgid "Karol Szwed" msgstr "केरोल स्ज़वेड" -#: kwindecoration.cpp:123 -msgid "" -"<h1>Installation error</h1>The resource<h2>kwin/kcm_kwindecoration/main.qml</" -"h2>could not be located in any application data path.<h2>Please contact your " -"distribution</h2>The application will now abort" -msgstr "" - -#: kwindecoration.cpp:126 -msgid "Installation Error" -msgstr "" - -#: kwindecoration.cpp:297 +#: kwindecoration.cpp:312 msgid "Oxygen" msgstr "" -#: kwindecoration.cpp:310 +#: kwindecoration.cpp:325 msgid "" "<h1>Window Manager Decoration</h1><p>This module allows you to choose the " "window border decorations, as well as titlebar button positions and custom " @@ -359,17 +348,11 @@ "positions of the buttons to your liking.</p>" msgstr "" -#: kwindecoration.cpp:385 -msgid "" -"Close by double clicking:\n" -" To open the menu, keep the button pressed until it appears." -msgstr "" - -#: preview.cpp:373 +#: preview.cpp:289 msgid "Active Window" msgstr "सक्रिय विंडो" -#: preview.cpp:373 +#: preview.cpp:289 msgid "Inactive Window" msgstr "निष्क्रिय विंडो" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcm_kwindesktop.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcm_kwindesktop.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcm_kwindesktop.po 2014-03-19 06:15:59.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcm_kwindesktop.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcm_kwindesktop\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-19 04:21+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2008-01-31 11:54+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -36,12 +36,12 @@ msgid "Here you can enter the name for desktop %1" msgstr "यहाँ आप डेस्कटॉप %1 के लिए नाम भर सकते हैं" -#: desktopnameswidget.cpp:108 main.cpp:219 +#: desktopnameswidget.cpp:108 main.cpp:213 #, kde-format msgid "Desktop %1" msgstr "डेस्कटॉप %1" -#: main.cpp:83 +#: main.cpp:80 msgid "" "<h1>Multiple Desktops</h1>In this module, you can configure how many virtual " "desktops you want and how these should be labeled." @@ -49,90 +49,90 @@ "<h1>बहु डेस्कटॉप</h1>इस मॉड्यूल में आप कॉन्फ़िगर कर सकते हैं कि आप कितने आभासी डेस्कटॉप " "चाहते हैं तथा उनमें किस प्रकार लेबल लगाए जाएँ." -#: main.cpp:95 +#: main.cpp:92 msgid "Switch to Next Desktop" msgstr "" -#: main.cpp:96 +#: main.cpp:93 msgid "Switch to Previous Desktop" msgstr "" -#: main.cpp:97 +#: main.cpp:94 msgid "Switch One Desktop to the Right" msgstr "" -#: main.cpp:98 +#: main.cpp:95 msgid "Switch One Desktop to the Left" msgstr "" -#: main.cpp:99 +#: main.cpp:96 msgid "Switch One Desktop Up" msgstr "" -#: main.cpp:100 +#: main.cpp:97 msgid "Switch One Desktop Down" msgstr "" -#: main.cpp:101 +#: main.cpp:98 msgid "Walk Through Desktops" msgstr "" -#: main.cpp:102 +#: main.cpp:99 msgid "Walk Through Desktops (Reverse)" msgstr "" -#: main.cpp:103 +#: main.cpp:100 msgid "Walk Through Desktop List" msgstr "" -#: main.cpp:104 +#: main.cpp:101 msgid "Walk Through Desktop List (Reverse)" msgstr "" -#: main.cpp:106 main.cpp:127 main.cpp:495 main.cpp:496 +#: main.cpp:103 main.cpp:121 main.cpp:481 main.cpp:482 msgid "Desktop Switching" msgstr "" -#: main.cpp:118 main.cpp:475 +#: main.cpp:112 main.cpp:461 #, fuzzy, kde-format #| msgid "Desktop %1" msgid "Switch to Desktop %1" msgstr "डेस्कटॉप %1" -#: main.cpp:146 +#: main.cpp:140 msgid "No Animation" msgstr "" -#: main.cpp:479 +#: main.cpp:465 #, kde-format msgid "No suitable Shortcut for Desktop %1 found" msgstr "" -#: main.cpp:485 +#: main.cpp:471 #, kde-format msgid "Assigned global Shortcut \"%1\" to Desktop %2" msgstr "" -#: main.cpp:488 +#: main.cpp:474 #, kde-format msgid "Shortcut conflict: Could not set Shortcut %1 for Desktop %2" msgstr "" #. i18n: ectx: attribute (title), widget (QWidget, desktop) -#: main.ui:33 +#: main.ui:24 #, fuzzy #| msgid "Desktop %1" msgid "Desktops" msgstr "डेस्कटॉप %1" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_2) -#: main.ui:39 +#: main.ui:30 msgid "Layout" msgstr "" #. i18n: ectx: property (whatsThis), widget (QLabel, numberLabel) -#. i18n: ectx: property (whatsThis), widget (QSpinBox, numberSpinBox) -#: main.ui:51 main.ui:64 +#. i18n: ectx: property (whatsThis), widget (KIntSpinBox, numberSpinBox) +#: main.ui:39 main.ui:52 #, fuzzy #| msgid "" #| "Here you can set how many virtual desktops you want on your KDE desktop. " @@ -144,38 +144,38 @@ "बदलने के लिए स्लाइडर खिसकाएँ." #. i18n: ectx: property (text), widget (QLabel, numberLabel) -#: main.ui:54 +#: main.ui:42 #, fuzzy #| msgid "N&umber of desktops: " msgid "Number of desktops:" msgstr "डेस्कटॉप की संख्याः (&u)" #. i18n: ectx: property (text), widget (QLabel, label) -#: main.ui:83 +#: main.ui:71 #, fuzzy #| msgid "N&umber of desktops: " msgid "Number of rows:" msgstr "डेस्कटॉप की संख्याः (&u)" #. i18n: ectx: property (text), widget (QCheckBox, activityCheckBox) -#: main.ui:100 +#: main.ui:88 msgid "Different widgets for each desktop" msgstr "" #. i18n: ectx: property (title), widget (QGroupBox, nameGroup) -#: main.ui:110 +#: main.ui:98 #, fuzzy #| msgid "Desktop &Names" msgid "Desktop Names" msgstr "डेस्कटॉप नाम (&N)" #. i18n: ectx: attribute (title), widget (QWidget, switching) -#: main.ui:143 +#: main.ui:131 msgid "Switching" msgstr "" #. i18n: ectx: property (whatsThis), widget (QCheckBox, wrapAroundBox) -#: main.ui:149 +#: main.ui:137 msgid "" "Enable this option if you want keyboard or active desktop border navigation " "beyond the edge of a desktop to take you to the opposite edge of the new " @@ -183,54 +183,54 @@ msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, wrapAroundBox) -#: main.ui:152 +#: main.ui:140 msgid "Desktop navigation wraps around" msgstr "" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_3) -#: main.ui:159 +#: main.ui:147 msgid "Desktop Effect Animation" msgstr "" #. i18n: ectx: property (text), widget (QLabel, label_2) -#: main.ui:171 +#: main.ui:156 msgid "Animation:" msgstr "" #. i18n: ectx: property (title), widget (QGroupBox, popupInfoCheckBox) -#: main.ui:211 +#: main.ui:196 msgid "Desktop Switch On-Screen Display" msgstr "" #. i18n: ectx: property (text), widget (QLabel, hideLabel) -#: main.ui:229 +#: main.ui:211 msgid "Duration:" msgstr "" -#. i18n: ectx: property (suffix), widget (QSpinBox, popupHideSpinBox) -#: main.ui:239 +#. i18n: ectx: property (suffix), widget (KIntSpinBox, popupHideSpinBox) +#: main.ui:221 msgid " msec" msgstr "" #. i18n: ectx: property (toolTip), widget (QCheckBox, desktopLayoutIndicatorCheckBox) -#: main.ui:252 +#: main.ui:234 msgid "" "Enabling this option will show a small preview of the desktop layout " "indicating the selected desktop." msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, desktopLayoutIndicatorCheckBox) -#: main.ui:255 +#: main.ui:237 msgid "Show desktop layout indicators" msgstr "" #. i18n: ectx: property (title), widget (QGroupBox, shortcutsGroupBox) -#: main.ui:265 +#: main.ui:247 msgid "Shortcuts" msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, allShortcutsCheckBox) -#: main.ui:284 +#: main.ui:266 msgid "Show shortcuts for all possible desktops" msgstr "" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmkwinrules.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmkwinrules.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmkwinrules.po 2014-03-19 06:15:59.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmkwinrules.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcmkwinrules\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-19 04:21+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2007-10-22 15:31+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -24,67 +24,67 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" #. i18n: ectx: property (text), item, widget (QListWidget, types) -#. i18n: ectx: property (text), item, widget (QComboBox, type) -#: detectwidget.cpp:100 ruleswidgetbase.ui:428 ruleswidgetbase.ui:2229 +#. i18n: ectx: property (text), item, widget (KComboBox, type) +#: detectwidget.cpp:95 ruleswidgetbase.ui:428 ruleswidgetbase.ui:2222 msgid "Normal Window" msgstr "सामान्य विंडो" #. i18n: ectx: property (text), item, widget (QListWidget, types) -#. i18n: ectx: property (text), item, widget (QComboBox, type) -#: detectwidget.cpp:101 ruleswidgetbase.ui:463 ruleswidgetbase.ui:2264 +#. i18n: ectx: property (text), item, widget (KComboBox, type) +#: detectwidget.cpp:96 ruleswidgetbase.ui:463 ruleswidgetbase.ui:2257 msgid "Desktop" msgstr "डेस्कटॉप" #. i18n: ectx: property (text), item, widget (QListWidget, types) -#. i18n: ectx: property (text), item, widget (QComboBox, type) -#: detectwidget.cpp:102 ruleswidgetbase.ui:443 ruleswidgetbase.ui:2244 +#. i18n: ectx: property (text), item, widget (KComboBox, type) +#: detectwidget.cpp:97 ruleswidgetbase.ui:443 ruleswidgetbase.ui:2237 msgid "Dock (panel)" msgstr "डाक करें (फलक)" #. i18n: ectx: property (text), item, widget (QListWidget, types) -#. i18n: ectx: property (text), item, widget (QComboBox, type) -#: detectwidget.cpp:103 ruleswidgetbase.ui:448 ruleswidgetbase.ui:2249 +#. i18n: ectx: property (text), item, widget (KComboBox, type) +#: detectwidget.cpp:98 ruleswidgetbase.ui:448 ruleswidgetbase.ui:2242 msgid "Toolbar" msgstr "औज़ार पट्टी" #. i18n: ectx: property (text), item, widget (QListWidget, types) -#. i18n: ectx: property (text), item, widget (QComboBox, type) -#: detectwidget.cpp:104 ruleswidgetbase.ui:453 ruleswidgetbase.ui:2254 +#. i18n: ectx: property (text), item, widget (KComboBox, type) +#: detectwidget.cpp:99 ruleswidgetbase.ui:453 ruleswidgetbase.ui:2247 msgid "Torn-Off Menu" msgstr "टॉर्न-ऑफ मेन्यू" #. i18n: ectx: property (text), item, widget (QListWidget, types) -#. i18n: ectx: property (text), item, widget (QComboBox, type) -#: detectwidget.cpp:105 ruleswidgetbase.ui:433 ruleswidgetbase.ui:2234 +#. i18n: ectx: property (text), item, widget (KComboBox, type) +#: detectwidget.cpp:100 ruleswidgetbase.ui:433 ruleswidgetbase.ui:2227 msgid "Dialog Window" msgstr "संवाद विंडो" -#: detectwidget.cpp:106 +#: detectwidget.cpp:101 msgid "Override Type" msgstr "ओवरराइड टाइप" #. i18n: ectx: property (text), item, widget (QListWidget, types) -#. i18n: ectx: property (text), item, widget (QComboBox, type) -#: detectwidget.cpp:107 ruleswidgetbase.ui:473 ruleswidgetbase.ui:2269 +#. i18n: ectx: property (text), item, widget (KComboBox, type) +#: detectwidget.cpp:102 ruleswidgetbase.ui:473 ruleswidgetbase.ui:2262 msgid "Standalone Menubar" msgstr "अलग-थलग मेनू-पट्टी" #. i18n: ectx: property (text), item, widget (QListWidget, types) -#. i18n: ectx: property (text), item, widget (QComboBox, type) -#: detectwidget.cpp:108 ruleswidgetbase.ui:438 ruleswidgetbase.ui:2239 +#. i18n: ectx: property (text), item, widget (KComboBox, type) +#: detectwidget.cpp:103 ruleswidgetbase.ui:438 ruleswidgetbase.ui:2232 msgid "Utility Window" msgstr "यूटिलिटी विंडो" #. i18n: ectx: property (text), item, widget (QListWidget, types) -#. i18n: ectx: property (text), item, widget (QComboBox, type) -#: detectwidget.cpp:109 ruleswidgetbase.ui:458 ruleswidgetbase.ui:2259 +#. i18n: ectx: property (text), item, widget (KComboBox, type) +#: detectwidget.cpp:104 ruleswidgetbase.ui:458 ruleswidgetbase.ui:2252 msgid "Splash Screen" msgstr "स्प्लैश स्क्रीन" -#: detectwidget.cpp:115 +#: detectwidget.cpp:110 msgid "Unknown - will be treated as Normal Window" msgstr "अज्ञात - सामान्य विंडो के रूप में माना जाएगा" @@ -94,52 +94,52 @@ msgstr "चयनित विंडो के बारे में जानकारी" #. i18n: ectx: property (text), widget (QLabel, textLabel1) -#: detectwidget.ui:29 +#: detectwidget.ui:26 msgid "Class:" msgstr "वर्गः" #. i18n: ectx: property (text), widget (QLabel, textLabel3) -#: detectwidget.ui:57 +#: detectwidget.ui:54 msgid "Role:" msgstr "भूमिकाः" #. i18n: ectx: property (text), widget (QLabel, textLabel4) -#: detectwidget.ui:85 +#: detectwidget.ui:82 msgid "Type:" msgstr "क़िस्मः" #. i18n: ectx: property (text), widget (QLabel, textLabel8) -#: detectwidget.ui:113 +#: detectwidget.ui:110 msgid "Title:" msgstr "शीर्षक:" #. i18n: ectx: property (text), widget (QLabel, textLabel13) -#: detectwidget.ui:141 +#: detectwidget.ui:138 msgid "Machine:" msgstr "मशीनः" #. i18n: ectx: property (title), widget (QGroupBox, groupBox) -#: detectwidget.ui:172 +#: detectwidget.ui:169 msgid "Match by primary class name and" msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, match_whole_class) -#: detectwidget.ui:181 +#: detectwidget.ui:178 msgid "Secondary class name (resulting in term in brackets)" msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, match_role) -#: detectwidget.ui:188 +#: detectwidget.ui:185 msgid "Window role (can be used to select windows by function)" msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, match_type) -#: detectwidget.ui:195 +#: detectwidget.ui:192 msgid "Window type (eg. all dialogs, but not the main windows)" msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, match_title) -#: detectwidget.ui:202 +#: detectwidget.ui:199 msgid "" "Window title (very specific, can fail due to content changes or translation)" msgstr "" @@ -167,23 +167,23 @@ msgid "C&lear" msgstr "साफ करें (&l)" -#: kcm.cpp:49 +#: kcm.cpp:52 msgid "kcmkwinrules" msgstr "केसीएम-केविन-रूल्स" -#: kcm.cpp:50 +#: kcm.cpp:53 msgid "Window-Specific Settings Configuration Module" msgstr "विंडो-विशिष्ट विन्यास कॉन्फ़िगरेशन मॉड्यूल" -#: kcm.cpp:51 +#: kcm.cpp:54 msgid "(c) 2004 KWin and KControl Authors" msgstr "(c) 2004 के-विन तथा के-कन्ट्रोल लेखक" -#: kcm.cpp:52 +#: kcm.cpp:55 msgid "Lubos Lunak" msgstr "लुबॉस लुनाक" -#: kcm.cpp:83 +#: kcm.cpp:86 msgid "" "<p><h1>Window-specific Settings</h1> Here you can customize window settings " "specifically only for some windows.</p> <p>Please note that this " @@ -192,15 +192,15 @@ "documentation for how to customize window behavior.</p>" msgstr "" -#: kcm.cpp:99 +#: kcm.cpp:102 msgid "Remember settings separately for every window" msgstr "प्रत्येक विंडो के लिए विन्यासों को अलग-अलग याद रखें" -#: kcm.cpp:100 +#: kcm.cpp:103 msgid "Show internal settings for remembering" msgstr "याद रखने के लिए आंतरिक विन्यासों को दिखाएँ" -#: kcm.cpp:101 +#: kcm.cpp:104 msgid "Internal setting for remembering" msgstr "याद रखने के लिए आंतरिक विन्यास" @@ -221,80 +221,76 @@ msgid "Edit Application-Specific Settings" msgstr "विंडो-विशिष्ट विन्यास संपादित करें" -#: main.cpp:245 +#: main.cpp:244 msgid "KWin" msgstr "के-विन" -#: main.cpp:253 +#: main.cpp:245 msgid "KWin helper utility" msgstr "के-विन मदद यूटिलिटी" -#: main.cpp:254 +#: main.cpp:248 msgid "WId of the window for special window settings." msgstr "विशिष्ट विंडो सेटिंग के लिए विंडो का डबल्यूआईडी " -#: main.cpp:255 +#: main.cpp:249 msgid "Whether the settings should affect all windows of the application." msgstr "सेटिंग क्या अनुप्रयोग के सभी विंडो पर प्रभाव डालेगा" -#: main.cpp:263 +#: main.cpp:258 msgid "This helper utility is not supposed to be called directly." msgstr "यह मदद यूटिलिटी सीधे ही बुलाया नहीं जा सकता." -#: ruleslist.cpp:153 +#: ruleslist.cpp:155 msgid "Export Rule" msgstr "" -#: ruleslist.cpp:154 ruleslist.cpp:166 -msgid "KWin Rule (*.kwinrule)" -msgstr "" - -#: ruleslist.cpp:165 +#: ruleslist.cpp:166 msgid "Import Rules" msgstr "" -#. i18n: ectx: property (text), widget (QPushButton, new_button) -#: ruleslist.ui:32 +#. i18n: ectx: property (text), widget (KPushButton, new_button) +#: ruleslist.ui:23 msgid "&New..." msgstr "नया... (&N)" -#. i18n: ectx: property (text), widget (QPushButton, modify_button) -#: ruleslist.ui:39 +#. i18n: ectx: property (text), widget (KPushButton, modify_button) +#: ruleslist.ui:30 msgid "&Modify..." msgstr "सुधारें... (&M)" -#. i18n: ectx: property (text), widget (QPushButton, delete_button) -#: ruleslist.ui:46 +#. i18n: ectx: property (text), widget (KPushButton, delete_button) +#: ruleslist.ui:37 msgid "Delete" msgstr "मिटाएँ" -#. i18n: ectx: property (text), widget (QPushButton, moveup_button) -#: ruleslist.ui:56 +#. i18n: ectx: property (text), widget (KPushButton, moveup_button) +#: ruleslist.ui:47 msgid "Move &Up" msgstr "ऊपर जाएं (&U)" -#. i18n: ectx: property (text), widget (QPushButton, movedown_button) -#: ruleslist.ui:63 +#. i18n: ectx: property (text), widget (KPushButton, movedown_button) +#: ruleslist.ui:54 msgid "Move &Down" msgstr "नीचे जाएं (&D)" #. i18n: ectx: property (text), widget (QPushButton, import_button) -#: ruleslist.ui:100 +#: ruleslist.ui:91 msgid "&Import" msgstr "" #. i18n: ectx: property (text), widget (QPushButton, export_button) -#: ruleslist.ui:107 +#: ruleslist.ui:98 msgid "&Export" msgstr "" -#: ruleswidget.cpp:66 +#: ruleswidget.cpp:61 msgid "" "Enable this checkbox to alter this window property for the specified window" "(s)." msgstr "उल्लेखित विंडो के विंडो-गुणों को बदलने के लिए इस चेक-बक्से को सक्षम करें." -#: ruleswidget.cpp:68 +#: ruleswidget.cpp:63 msgid "" "Specify how the window property should be affected:<ul><li><em>Do Not Affect:" "</em> The window property will not be affected and therefore the default " @@ -312,7 +308,7 @@ "is hidden).</li></ul>" msgstr "" -#: ruleswidget.cpp:83 +#: ruleswidget.cpp:78 msgid "" "Specify how the window property should be affected:<ul><li><em>Do Not Affect:" "</em> The window property will not be affected and therefore the default " @@ -323,24 +319,24 @@ "(this action will be deleted after the window is hidden).</li></ul>" msgstr "" -#: ruleswidget.cpp:149 +#: ruleswidget.cpp:143 msgid "All Desktops" msgstr "सभी डेस्कटॉप" -#: ruleswidget.cpp:159 +#: ruleswidget.cpp:152 msgid "All Activities" msgstr "" -#: ruleswidget.cpp:739 +#: ruleswidget.cpp:709 #, kde-format msgid "Settings for %1" msgstr "%1 हेतु विन्यास" -#: ruleswidget.cpp:741 +#: ruleswidget.cpp:711 msgid "Unnamed entry" msgstr "अनाम प्रविष्टि" -#: ruleswidget.cpp:751 +#: ruleswidget.cpp:721 msgid "" "You have specified the window class as unimportant.\n" "This means the settings will possibly apply to windows from all " @@ -349,11 +345,11 @@ "types." msgstr "" -#: ruleswidget.cpp:781 +#: ruleswidget.cpp:751 msgid "Edit Window-Specific Settings" msgstr "विंडो-विशिष्ट विन्यास संपादित करें" -#: ruleswidget.cpp:811 +#: ruleswidget.cpp:776 msgid "" "This configuration dialog allows altering settings only for the selected " "window or application. Find the setting you want to affect, enable the " @@ -361,11 +357,11 @@ "affected and to which value." msgstr "" -#: ruleswidget.cpp:815 +#: ruleswidget.cpp:780 msgid "Consult the documentation for more details." msgstr "अतिरिक्त विवरणों के लिए दस्तावेजों को देखें" -#: ruleswidget.cpp:854 +#: ruleswidget.cpp:818 msgid "Edit Shortcut" msgstr "शॉर्टकट संपादित करें" @@ -378,9 +374,7 @@ #. i18n: ectx: property (text), widget (QLabel, textLabel1) #: ruleswidgetbase.ui:27 -#, fuzzy -#| msgid "De&scription:" -msgid "&Description:" +msgid "De&scription:" msgstr "वर्णन (&s):" #. i18n: ectx: property (text), widget (QLabel, textLabel2) @@ -390,46 +384,46 @@ msgid "Window &class (application):" msgstr "विंडो वर्ग (&c) (अनुप्रयोग प्रकार):" -#. i18n: ectx: property (text), item, widget (QComboBox, wmclass_match) +#. i18n: ectx: property (text), item, widget (KComboBox, wmclass_match) #. i18n: ectx: property (text), item, widget (KComboBox, role_match) -#. i18n: ectx: property (text), item, widget (QComboBox, title_match) +#. i18n: ectx: property (text), item, widget (KComboBox, title_match) #. i18n: ectx: property (text), item, widget (KComboBox, machine_match) #: ruleswidgetbase.ui:63 ruleswidgetbase.ui:126 ruleswidgetbase.ui:195 #: ruleswidgetbase.ui:248 msgid "Unimportant" msgstr "महत्वहीन" -#. i18n: ectx: property (text), item, widget (QComboBox, wmclass_match) +#. i18n: ectx: property (text), item, widget (KComboBox, wmclass_match) #. i18n: ectx: property (text), item, widget (KComboBox, role_match) -#. i18n: ectx: property (text), item, widget (QComboBox, title_match) +#. i18n: ectx: property (text), item, widget (KComboBox, title_match) #. i18n: ectx: property (text), item, widget (KComboBox, machine_match) #: ruleswidgetbase.ui:68 ruleswidgetbase.ui:131 ruleswidgetbase.ui:200 #: ruleswidgetbase.ui:253 msgid "Exact Match" msgstr "सटीक जोड़ीदार" -#. i18n: ectx: property (text), item, widget (QComboBox, wmclass_match) +#. i18n: ectx: property (text), item, widget (KComboBox, wmclass_match) #. i18n: ectx: property (text), item, widget (KComboBox, role_match) -#. i18n: ectx: property (text), item, widget (QComboBox, title_match) +#. i18n: ectx: property (text), item, widget (KComboBox, title_match) #. i18n: ectx: property (text), item, widget (KComboBox, machine_match) #: ruleswidgetbase.ui:73 ruleswidgetbase.ui:136 ruleswidgetbase.ui:205 #: ruleswidgetbase.ui:258 msgid "Substring Match" msgstr "सबस्ट्रिंग जोड़ीदार" -#. i18n: ectx: property (text), item, widget (QComboBox, wmclass_match) +#. i18n: ectx: property (text), item, widget (KComboBox, wmclass_match) #. i18n: ectx: property (text), item, widget (KComboBox, role_match) -#. i18n: ectx: property (text), item, widget (QComboBox, title_match) +#. i18n: ectx: property (text), item, widget (KComboBox, title_match) #. i18n: ectx: property (text), item, widget (KComboBox, machine_match) #: ruleswidgetbase.ui:78 ruleswidgetbase.ui:141 ruleswidgetbase.ui:210 #: ruleswidgetbase.ui:263 msgid "Regular Expression" msgstr "नियमित (रेगुलर) एक्सप्रेशन." -#. i18n: ectx: property (text), widget (QPushButton, edit_reg_wmclass) -#. i18n: ectx: property (text), widget (QPushButton, edit_reg_role) -#. i18n: ectx: property (text), widget (QPushButton, edit_reg_title) -#. i18n: ectx: property (text), widget (QPushButton, edit_reg_machine) +#. i18n: ectx: property (text), widget (KPushButton, edit_reg_wmclass) +#. i18n: ectx: property (text), widget (KPushButton, edit_reg_role) +#. i18n: ectx: property (text), widget (KPushButton, edit_reg_title) +#. i18n: ectx: property (text), widget (KPushButton, edit_reg_machine) #: ruleswidgetbase.ui:92 ruleswidgetbase.ui:155 ruleswidgetbase.ui:221 #: ruleswidgetbase.ui:274 msgid "Edit" @@ -442,9 +436,7 @@ #. i18n: ectx: property (text), widget (QLabel, textLabel3) #: ruleswidgetbase.ui:109 -#, fuzzy -#| msgid "Window &role:" -msgid "Window ro&le:" +msgid "Window &role:" msgstr "विंडो भूमिका (&r):" #. i18n: ectx: property (text), widget (QLabel, textLabel4) @@ -462,7 +454,7 @@ msgid "&Machine (hostname):" msgstr "मशीन (होस्ट-नाम): (&M)" -#. i18n: ectx: property (text), widget (QPushButton, detect) +#. i18n: ectx: property (text), widget (KPushButton, detect) #: ruleswidgetbase.ui:318 #, fuzzy #| msgid "Detect Window Properties" @@ -493,40 +485,39 @@ msgid "&Position" msgstr "स्थिति (&P)" -#. i18n: ectx: property (text), item, widget (QComboBox, rule_position) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_size) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_maximizehoriz) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_maximizevert) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_desktop) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_activity) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_fullscreen) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_minimize) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_shade) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_placement) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_ignoregeometry) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_minsize) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_maxsize) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_strictgeometry) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_screen) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_below) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_shortcut) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_autogroup) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_skippager) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_skipswitcher) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_skiptaskbar) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_autogroupfg) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_autogroupid) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_above) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_opacityactive) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_noborder) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_opacityinactive) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_acceptfocus) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_disableglobalshortcuts) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_type) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_closeable) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_blockcompositing) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_fsplevel) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_decocolor) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_position) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_size) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_maximizehoriz) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_maximizevert) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_desktop) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_activity) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_fullscreen) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_minimize) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_shade) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_placement) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_ignoregeometry) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_minsize) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_maxsize) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_strictgeometry) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_screen) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_below) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_shortcut) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_autogroup) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_skippager) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_skipswitcher) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_skiptaskbar) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_autogroupfg) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_autogroupid) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_above) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_noborder) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_opacityactive) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_opacityinactive) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_acceptfocus) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_disableglobalshortcuts) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_type) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_closeable) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_blockcompositing) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_fsplevel) #: ruleswidgetbase.ui:506 ruleswidgetbase.ui:563 ruleswidgetbase.ui:627 #: ruleswidgetbase.ui:678 ruleswidgetbase.ui:749 ruleswidgetbase.ui:813 #: ruleswidgetbase.ui:881 ruleswidgetbase.ui:932 ruleswidgetbase.ui:983 @@ -535,101 +526,99 @@ #: ruleswidgetbase.ui:1387 ruleswidgetbase.ui:1434 ruleswidgetbase.ui:1535 #: ruleswidgetbase.ui:1557 ruleswidgetbase.ui:1641 ruleswidgetbase.ui:1678 #: ruleswidgetbase.ui:1756 ruleswidgetbase.ui:1812 ruleswidgetbase.ui:1861 -#: ruleswidgetbase.ui:1919 ruleswidgetbase.ui:1955 ruleswidgetbase.ui:2042 -#: ruleswidgetbase.ui:2108 ruleswidgetbase.ui:2157 ruleswidgetbase.ui:2207 -#: ruleswidgetbase.ui:2351 ruleswidgetbase.ui:2405 ruleswidgetbase.ui:2427 -#: ruleswidgetbase.ui:2477 +#: ruleswidgetbase.ui:1926 ruleswidgetbase.ui:1990 ruleswidgetbase.ui:2035 +#: ruleswidgetbase.ui:2101 ruleswidgetbase.ui:2150 ruleswidgetbase.ui:2200 +#: ruleswidgetbase.ui:2351 ruleswidgetbase.ui:2373 ruleswidgetbase.ui:2395 msgid "Do Not Affect" msgstr "प्रभावित नहीं करें" -#. i18n: ectx: property (text), item, widget (QComboBox, rule_position) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_size) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_maximizehoriz) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_maximizevert) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_desktop) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_activity) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_fullscreen) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_minimize) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_shade) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_ignoregeometry) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_screen) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_below) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_shortcut) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_skippager) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_skipswitcher) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_skiptaskbar) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_above) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_noborder) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_position) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_size) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_maximizehoriz) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_maximizevert) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_desktop) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_activity) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_fullscreen) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_minimize) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_shade) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_ignoregeometry) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_screen) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_below) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_shortcut) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_skippager) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_skipswitcher) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_skiptaskbar) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_above) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_noborder) #: ruleswidgetbase.ui:511 ruleswidgetbase.ui:568 ruleswidgetbase.ui:632 #: ruleswidgetbase.ui:683 ruleswidgetbase.ui:754 ruleswidgetbase.ui:818 #: ruleswidgetbase.ui:886 ruleswidgetbase.ui:937 ruleswidgetbase.ui:988 #: ruleswidgetbase.ui:1141 ruleswidgetbase.ui:1341 ruleswidgetbase.ui:1392 #: ruleswidgetbase.ui:1439 ruleswidgetbase.ui:1562 ruleswidgetbase.ui:1646 -#: ruleswidgetbase.ui:1683 ruleswidgetbase.ui:1866 ruleswidgetbase.ui:1960 +#: ruleswidgetbase.ui:1683 ruleswidgetbase.ui:1866 ruleswidgetbase.ui:1931 msgid "Apply Initially" msgstr "आरंभ में लागू करें" -#. i18n: ectx: property (text), item, widget (QComboBox, rule_position) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_size) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_maximizehoriz) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_maximizevert) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_desktop) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_activity) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_fullscreen) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_minimize) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_shade) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_ignoregeometry) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_screen) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_below) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_shortcut) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_skippager) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_skipswitcher) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_skiptaskbar) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_above) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_noborder) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_position) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_size) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_maximizehoriz) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_maximizevert) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_desktop) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_activity) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_fullscreen) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_minimize) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_shade) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_ignoregeometry) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_screen) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_below) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_shortcut) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_skippager) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_skipswitcher) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_skiptaskbar) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_above) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_noborder) #: ruleswidgetbase.ui:516 ruleswidgetbase.ui:573 ruleswidgetbase.ui:637 #: ruleswidgetbase.ui:688 ruleswidgetbase.ui:759 ruleswidgetbase.ui:823 #: ruleswidgetbase.ui:891 ruleswidgetbase.ui:942 ruleswidgetbase.ui:993 #: ruleswidgetbase.ui:1146 ruleswidgetbase.ui:1346 ruleswidgetbase.ui:1397 #: ruleswidgetbase.ui:1444 ruleswidgetbase.ui:1567 ruleswidgetbase.ui:1651 -#: ruleswidgetbase.ui:1688 ruleswidgetbase.ui:1871 ruleswidgetbase.ui:1965 +#: ruleswidgetbase.ui:1688 ruleswidgetbase.ui:1871 ruleswidgetbase.ui:1936 msgid "Remember" msgstr "याद रखें" -#. i18n: ectx: property (text), item, widget (QComboBox, rule_position) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_size) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_maximizehoriz) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_maximizevert) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_desktop) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_activity) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_fullscreen) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_minimize) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_shade) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_placement) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_ignoregeometry) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_minsize) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_maxsize) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_strictgeometry) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_screen) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_below) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_shortcut) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_autogroup) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_skippager) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_skipswitcher) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_skiptaskbar) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_autogroupfg) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_autogroupid) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_above) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_opacityactive) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_noborder) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_opacityinactive) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_acceptfocus) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_disableglobalshortcuts) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_type) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_closeable) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_blockcompositing) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_fsplevel) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_decocolor) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_position) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_size) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_maximizehoriz) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_maximizevert) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_desktop) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_activity) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_fullscreen) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_minimize) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_shade) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_placement) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_ignoregeometry) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_minsize) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_maxsize) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_strictgeometry) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_screen) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_below) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_shortcut) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_autogroup) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_skippager) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_skipswitcher) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_skiptaskbar) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_autogroupfg) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_autogroupid) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_above) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_noborder) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_opacityactive) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_opacityinactive) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_acceptfocus) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_disableglobalshortcuts) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_type) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_closeable) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_blockcompositing) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_fsplevel) #: ruleswidgetbase.ui:521 ruleswidgetbase.ui:578 ruleswidgetbase.ui:642 #: ruleswidgetbase.ui:693 ruleswidgetbase.ui:764 ruleswidgetbase.ui:828 #: ruleswidgetbase.ui:896 ruleswidgetbase.ui:947 ruleswidgetbase.ui:998 @@ -638,74 +627,72 @@ #: ruleswidgetbase.ui:1402 ruleswidgetbase.ui:1449 ruleswidgetbase.ui:1540 #: ruleswidgetbase.ui:1572 ruleswidgetbase.ui:1656 ruleswidgetbase.ui:1693 #: ruleswidgetbase.ui:1761 ruleswidgetbase.ui:1817 ruleswidgetbase.ui:1876 -#: ruleswidgetbase.ui:1924 ruleswidgetbase.ui:1970 ruleswidgetbase.ui:2047 -#: ruleswidgetbase.ui:2113 ruleswidgetbase.ui:2162 ruleswidgetbase.ui:2212 -#: ruleswidgetbase.ui:2356 ruleswidgetbase.ui:2410 ruleswidgetbase.ui:2432 -#: ruleswidgetbase.ui:2482 +#: ruleswidgetbase.ui:1941 ruleswidgetbase.ui:1995 ruleswidgetbase.ui:2040 +#: ruleswidgetbase.ui:2106 ruleswidgetbase.ui:2155 ruleswidgetbase.ui:2205 +#: ruleswidgetbase.ui:2356 ruleswidgetbase.ui:2378 ruleswidgetbase.ui:2400 msgid "Force" msgstr "बाध्य करें" -#. i18n: ectx: property (text), item, widget (QComboBox, rule_position) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_size) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_maximizehoriz) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_maximizevert) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_desktop) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_activity) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_fullscreen) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_minimize) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_shade) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_ignoregeometry) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_screen) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_below) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_shortcut) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_skippager) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_skipswitcher) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_skiptaskbar) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_above) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_noborder) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_position) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_size) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_maximizehoriz) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_maximizevert) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_desktop) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_activity) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_fullscreen) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_minimize) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_shade) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_ignoregeometry) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_screen) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_below) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_shortcut) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_skippager) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_skipswitcher) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_skiptaskbar) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_above) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_noborder) #: ruleswidgetbase.ui:526 ruleswidgetbase.ui:583 ruleswidgetbase.ui:647 #: ruleswidgetbase.ui:698 ruleswidgetbase.ui:769 ruleswidgetbase.ui:833 #: ruleswidgetbase.ui:901 ruleswidgetbase.ui:952 ruleswidgetbase.ui:1003 #: ruleswidgetbase.ui:1156 ruleswidgetbase.ui:1356 ruleswidgetbase.ui:1407 #: ruleswidgetbase.ui:1454 ruleswidgetbase.ui:1577 ruleswidgetbase.ui:1661 -#: ruleswidgetbase.ui:1698 ruleswidgetbase.ui:1881 ruleswidgetbase.ui:1975 +#: ruleswidgetbase.ui:1698 ruleswidgetbase.ui:1881 ruleswidgetbase.ui:1946 msgid "Apply Now" msgstr "अभी लागू करें" -#. i18n: ectx: property (text), item, widget (QComboBox, rule_position) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_size) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_maximizehoriz) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_maximizevert) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_desktop) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_activity) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_fullscreen) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_minimize) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_shade) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_placement) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_ignoregeometry) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_minsize) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_maxsize) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_strictgeometry) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_screen) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_below) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_shortcut) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_autogroup) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_skippager) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_skipswitcher) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_skiptaskbar) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_autogroupfg) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_autogroupid) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_above) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_opacityactive) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_noborder) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_opacityinactive) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_acceptfocus) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_disableglobalshortcuts) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_type) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_closeable) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_blockcompositing) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_fsplevel) -#. i18n: ectx: property (text), item, widget (QComboBox, rule_decocolor) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_position) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_size) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_maximizehoriz) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_maximizevert) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_desktop) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_activity) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_fullscreen) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_minimize) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_shade) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_placement) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_ignoregeometry) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_minsize) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_maxsize) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_strictgeometry) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_screen) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_below) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_shortcut) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_autogroup) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_skippager) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_skipswitcher) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_skiptaskbar) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_autogroupfg) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_autogroupid) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_above) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_noborder) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_opacityactive) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_opacityinactive) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_acceptfocus) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_disableglobalshortcuts) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_type) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_closeable) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_blockcompositing) +#. i18n: ectx: property (text), item, widget (KComboBox, rule_fsplevel) #: ruleswidgetbase.ui:531 ruleswidgetbase.ui:588 ruleswidgetbase.ui:652 #: ruleswidgetbase.ui:703 ruleswidgetbase.ui:774 ruleswidgetbase.ui:838 #: ruleswidgetbase.ui:906 ruleswidgetbase.ui:957 ruleswidgetbase.ui:1008 @@ -714,22 +701,21 @@ #: ruleswidgetbase.ui:1412 ruleswidgetbase.ui:1459 ruleswidgetbase.ui:1545 #: ruleswidgetbase.ui:1582 ruleswidgetbase.ui:1666 ruleswidgetbase.ui:1703 #: ruleswidgetbase.ui:1766 ruleswidgetbase.ui:1822 ruleswidgetbase.ui:1886 -#: ruleswidgetbase.ui:1929 ruleswidgetbase.ui:1980 ruleswidgetbase.ui:2052 -#: ruleswidgetbase.ui:2118 ruleswidgetbase.ui:2167 ruleswidgetbase.ui:2217 -#: ruleswidgetbase.ui:2361 ruleswidgetbase.ui:2415 ruleswidgetbase.ui:2437 -#: ruleswidgetbase.ui:2487 +#: ruleswidgetbase.ui:1951 ruleswidgetbase.ui:2000 ruleswidgetbase.ui:2045 +#: ruleswidgetbase.ui:2111 ruleswidgetbase.ui:2160 ruleswidgetbase.ui:2210 +#: ruleswidgetbase.ui:2361 ruleswidgetbase.ui:2383 ruleswidgetbase.ui:2405 msgid "Force Temporarily" msgstr "अस्थायी रूप से बाध्य करें" -#. i18n: ectx: property (placeholderText), widget (QLineEdit, position) +#. i18n: ectx: property (placeholderText), widget (KRestrictedLine, position) #: ruleswidgetbase.ui:542 msgid "x,y" msgstr "" -#. i18n: ectx: property (validChars), widget (QLineEdit, position) -#. i18n: ectx: property (validChars), widget (QLineEdit, size) -#. i18n: ectx: property (validChars), widget (QLineEdit, minsize) -#. i18n: ectx: property (validChars), widget (QLineEdit, maxsize) +#. i18n: ectx: property (validChars), widget (KRestrictedLine, position) +#. i18n: ectx: property (validChars), widget (KRestrictedLine, size) +#. i18n: ectx: property (validChars), widget (KRestrictedLine, minsize) +#. i18n: ectx: property (validChars), widget (KRestrictedLine, maxsize) #: ruleswidgetbase.ui:545 ruleswidgetbase.ui:602 ruleswidgetbase.ui:1218 #: ruleswidgetbase.ui:1260 msgid "0123456789-+,xX:" @@ -740,9 +726,9 @@ msgid "&Size" msgstr "आकार (&S)" -#. i18n: ectx: property (placeholderText), widget (QLineEdit, size) -#. i18n: ectx: property (placeholderText), widget (QLineEdit, minsize) -#. i18n: ectx: property (placeholderText), widget (QLineEdit, maxsize) +#. i18n: ectx: property (placeholderText), widget (KRestrictedLine, size) +#. i18n: ectx: property (placeholderText), widget (KRestrictedLine, minsize) +#. i18n: ectx: property (placeholderText), widget (KRestrictedLine, maxsize) #: ruleswidgetbase.ui:599 ruleswidgetbase.ui:1215 ruleswidgetbase.ui:1257 msgid "width,height" msgstr "" @@ -784,52 +770,52 @@ msgid "Sh&aded" msgstr "छाया (&a)" -#. i18n: ectx: property (text), item, widget (QComboBox, placement) +#. i18n: ectx: property (text), item, widget (KComboBox, placement) #: ruleswidgetbase.ui:1056 msgid "Default" msgstr "डिफ़ॉल्ट" -#. i18n: ectx: property (text), item, widget (QComboBox, placement) +#. i18n: ectx: property (text), item, widget (KComboBox, placement) #: ruleswidgetbase.ui:1061 msgid "No Placement" msgstr "कोई स्थल नहीं" -#. i18n: ectx: property (text), item, widget (QComboBox, placement) +#. i18n: ectx: property (text), item, widget (KComboBox, placement) #: ruleswidgetbase.ui:1066 msgid "Smart" msgstr "स्मार्ट" -#. i18n: ectx: property (text), item, widget (QComboBox, placement) +#. i18n: ectx: property (text), item, widget (KComboBox, placement) #: ruleswidgetbase.ui:1071 msgid "Maximizing" msgstr "अधिकतम किया जा रहा है" -#. i18n: ectx: property (text), item, widget (QComboBox, placement) +#. i18n: ectx: property (text), item, widget (KComboBox, placement) #: ruleswidgetbase.ui:1076 msgid "Cascade" msgstr "एक के बाद एक" -#. i18n: ectx: property (text), item, widget (QComboBox, placement) +#. i18n: ectx: property (text), item, widget (KComboBox, placement) #: ruleswidgetbase.ui:1081 msgid "Centered" msgstr "केंद्रित" -#. i18n: ectx: property (text), item, widget (QComboBox, placement) +#. i18n: ectx: property (text), item, widget (KComboBox, placement) #: ruleswidgetbase.ui:1086 msgid "Random" msgstr "बेतरतीब" -#. i18n: ectx: property (text), item, widget (QComboBox, placement) +#. i18n: ectx: property (text), item, widget (KComboBox, placement) #: ruleswidgetbase.ui:1091 msgid "Top-Left Corner" msgstr "ऊपरी बायाँ कोना" -#. i18n: ectx: property (text), item, widget (QComboBox, placement) +#. i18n: ectx: property (text), item, widget (KComboBox, placement) #: ruleswidgetbase.ui:1096 msgid "Under Mouse" msgstr "माउस के नीचे" -#. i18n: ectx: property (text), item, widget (QComboBox, placement) +#. i18n: ectx: property (text), item, widget (KComboBox, placement) #: ruleswidgetbase.ui:1101 msgid "On Main Window" msgstr "मुख्य विंडो पर" @@ -965,17 +951,17 @@ msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, enable_blockcompositing) -#: ruleswidgetbase.ui:1937 +#: ruleswidgetbase.ui:1908 msgid "Block compositing" msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, enable_noborder) -#: ruleswidgetbase.ui:1944 +#: ruleswidgetbase.ui:1915 msgid "&No titlebar and frame" msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, enable_opacityactive) -#: ruleswidgetbase.ui:1995 +#: ruleswidgetbase.ui:1966 #, fuzzy #| msgid "A&ctive opacity in %" msgid "A&ctive opacity" @@ -983,20 +969,20 @@ #. i18n: ectx: property (suffix), widget (QSpinBox, opacityactive) #. i18n: ectx: property (suffix), widget (QSpinBox, opacityinactive) -#: ruleswidgetbase.ui:2018 ruleswidgetbase.ui:2063 +#: ruleswidgetbase.ui:2011 ruleswidgetbase.ui:2056 #, no-c-format msgid "%" msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, enable_opacityinactive) -#: ruleswidgetbase.ui:2031 +#: ruleswidgetbase.ui:2024 #, fuzzy #| msgid "I&nactive opacity in %" msgid "I&nactive opacity" msgstr "इसमें अक्रिय अपारदर्शिता (&n)_ %" #. i18n: ectx: property (toolTip), widget (QCheckBox, enable_acceptfocus) -#: ruleswidgetbase.ui:2094 +#: ruleswidgetbase.ui:2087 msgid "" "Windows may prevent to get the focus (activate) when being clicked.\n" "On the other hand you might wish to prevent a window\n" @@ -1004,12 +990,12 @@ msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, enable_acceptfocus) -#: ruleswidgetbase.ui:2097 +#: ruleswidgetbase.ui:2090 msgid "Accept &focus" msgstr "फ़ोकस स्वीकारें (&f)" #. i18n: ectx: property (toolTip), widget (QCheckBox, enable_disableglobalshortcuts) -#: ruleswidgetbase.ui:2140 +#: ruleswidgetbase.ui:2133 msgid "" "When used, a window will receive\n" "all keyboard inputs while it is active, including Alt+Tab etc.\n" @@ -1022,24 +1008,24 @@ msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, enable_disableglobalshortcuts) -#: ruleswidgetbase.ui:2143 +#: ruleswidgetbase.ui:2136 #, fuzzy #| msgid "Block global shortcuts" msgid "Ignore global shortcuts" msgstr "वैश्विक शॉर्टकट्स पर रोक लगाएँ" #. i18n: ectx: property (text), widget (QCheckBox, enable_closeable) -#: ruleswidgetbase.ui:2175 +#: ruleswidgetbase.ui:2182 msgid "&Closeable" msgstr "बन्द करने योग्य (&C)" #. i18n: ectx: property (text), widget (QCheckBox, enable_type) -#: ruleswidgetbase.ui:2182 +#: ruleswidgetbase.ui:2189 msgid "Window &type" msgstr "विंडो प्रकार (&t)" #. i18n: ectx: property (text), item, widget (KComboBox, fsplevel) -#: ruleswidgetbase.ui:2373 +#: ruleswidgetbase.ui:2417 #, fuzzy #| msgid "None" msgctxt "no focus stealing prevention" @@ -1047,22 +1033,22 @@ msgstr "कुछ नहीं" #. i18n: ectx: property (text), item, widget (KComboBox, fsplevel) -#: ruleswidgetbase.ui:2378 +#: ruleswidgetbase.ui:2422 msgid "Low" msgstr "निम्न" #. i18n: ectx: property (text), item, widget (KComboBox, fsplevel) -#: ruleswidgetbase.ui:2383 +#: ruleswidgetbase.ui:2427 msgid "Normal" msgstr "सामान्य" #. i18n: ectx: property (text), item, widget (KComboBox, fsplevel) -#: ruleswidgetbase.ui:2388 +#: ruleswidgetbase.ui:2432 msgid "High" msgstr "उच्च" #. i18n: ectx: property (text), item, widget (KComboBox, fsplevel) -#: ruleswidgetbase.ui:2393 +#: ruleswidgetbase.ui:2437 msgid "Extreme" msgstr "चरम" @@ -1081,11 +1067,6 @@ msgid "&Focus stealing prevention" msgstr "फोकस स्टीलिंग प्रिवेंशन (&F)" -#. i18n: ectx: property (text), widget (QCheckBox, enable_decocolor) -#: ruleswidgetbase.ui:2459 -msgid "Titlebar color &scheme" -msgstr "" - #~ msgid "Opaque" #~ msgstr "अपारदर्शी" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmkwinscreenedges.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmkwinscreenedges.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmkwinscreenedges.po 2014-03-19 06:15:59.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmkwinscreenedges.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcmkwinscreenedges\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-19 04:21+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-12-09 01:18+0530\n" "Last-Translator: G Karunakar\n" "Language-Team: Hindi <en@li.org>\n" @@ -18,14 +18,6 @@ "X-Generator: KBabel 1.11.4\n" "Plural-Forms: nplurals=2; plural=(n!=1);\n" -msgctxt "NAME OF TRANSLATORS" -msgid "Your names" -msgstr "" - -msgctxt "EMAIL OF TRANSLATORS" -msgid "Your emails" -msgstr "" - #: main.cpp:186 msgid "No Action" msgstr "कोई क्रिया नहीं" @@ -127,58 +119,58 @@ msgstr "अन्य सेटिंग" #. i18n: ectx: property (toolTip), widget (QLabel, desktopSwitchLabel) -#: main.ui:162 +#: main.ui:159 msgid "" "Change desktop when the mouse cursor is pushed against the edge of the screen" msgstr "" #. i18n: ectx: property (text), widget (QLabel, desktopSwitchLabel) -#: main.ui:165 +#: main.ui:162 msgid "&Switch desktop on edge:" msgstr "" #. i18n: ectx: property (text), item, widget (KComboBox, desktopSwitchCombo) -#: main.ui:176 +#: main.ui:173 msgctxt "Switch desktop on edge" msgid "Disabled" msgstr "अक्षम" #. i18n: ectx: property (text), item, widget (KComboBox, desktopSwitchCombo) -#: main.ui:181 +#: main.ui:178 msgid "Only When Moving Windows" msgstr "सिर्फ विंडो खिसकाते हुए" #. i18n: ectx: property (text), item, widget (KComboBox, desktopSwitchCombo) -#: main.ui:186 +#: main.ui:183 msgid "Always Enabled" msgstr "हमेशा सक्षम" #. i18n: ectx: property (toolTip), widget (QLabel, label) -#: main.ui:194 +#: main.ui:191 msgid "" "Amount of time required for the mouse cursor to be pushed against the edge " "of the screen before the action is triggered" msgstr "" #. i18n: ectx: property (text), widget (QLabel, label) -#: main.ui:197 +#: main.ui:194 msgid "Activation &delay:" msgstr "" -#. i18n: ectx: property (suffix), widget (QSpinBox, activationDelaySpin) -#. i18n: ectx: property (suffix), widget (QSpinBox, triggerCooldownSpin) -#: main.ui:207 main.ui:242 +#. i18n: ectx: property (suffix), widget (KIntSpinBox, activationDelaySpin) +#. i18n: ectx: property (suffix), widget (KIntSpinBox, triggerCooldownSpin) +#: main.ui:204 main.ui:239 msgid " ms" msgstr " मि से." #. i18n: ectx: property (toolTip), widget (QLabel, label_2) -#: main.ui:226 +#: main.ui:223 msgid "" "Amount of time required after triggering an action until the next trigger " "can occur" msgstr "" #. i18n: ectx: property (text), widget (QLabel, label_2) -#: main.ui:229 +#: main.ui:226 msgid "&Reactivation delay:" msgstr "" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcm_kwintabbox.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcm_kwintabbox.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcm_kwintabbox.po 2014-03-19 06:15:59.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcm_kwintabbox.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcm_kwintabbox\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-19 04:21+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-01-31 20:41+0530\n" "Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" "Language-Team: Hindi <indlinux>\n" @@ -19,26 +19,30 @@ "Plural-Forms: nplurals=2; plural=(n!=1);\n" "\n" -#: layoutpreview.cpp:158 +#: layoutpreview.cpp:154 #, fuzzy #| msgid "All Desktops" msgctxt "An example Desktop Name" msgid "Desktop 1" msgstr "सभी डेस्कटॉप" -#: main.cpp:67 +#: main.cpp:69 msgid "Main" msgstr "मुख्य" -#: main.cpp:68 +#: main.cpp:70 msgid "Alternative" msgstr "वैकल्पिक" -#: main.cpp:71 +#: main.cpp:73 msgid "" "Focus policy settings limit the functionality of navigating through windows." msgstr "" +#: main.cpp:496 +msgid "Tabbox layout preview" +msgstr "" + #. i18n: ectx: property (title), widget (QGroupBox, groupBox_3) #: main.ui:32 msgid "Content" @@ -84,125 +88,125 @@ msgstr "सभी डेस्कटॉप" #. i18n: ectx: property (text), widget (QRadioButton, currentDesktop) -#: main.ui:157 +#: main.ui:148 #, fuzzy #| msgid "Current Desktop" msgid "Current desktop" msgstr "वर्तमान डेस्कटॉप" #. i18n: ectx: property (text), widget (QRadioButton, otherDesktops) -#: main.ui:164 +#: main.ui:155 #, fuzzy #| msgid "All Desktops" msgid "All other desktops" msgstr "सभी डेस्कटॉप" #. i18n: ectx: property (text), widget (QCheckBox, filterActivities) -#: main.ui:174 +#: main.ui:165 msgid "Activities" msgstr "" #. i18n: ectx: property (text), widget (QRadioButton, currentActivity) -#: main.ui:218 +#: main.ui:200 msgid "Current activity" msgstr "" #. i18n: ectx: property (text), widget (QRadioButton, otherActivities) -#: main.ui:225 +#: main.ui:207 msgid "All other activities" msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, filterScreens) -#: main.ui:235 +#: main.ui:217 msgid "Screens" msgstr "" #. i18n: ectx: property (text), widget (QRadioButton, currentScreen) -#: main.ui:279 +#: main.ui:252 #, fuzzy #| msgid "Current Desktop" msgid "Current screen" msgstr "वर्तमान डेस्कटॉप" #. i18n: ectx: property (text), widget (QRadioButton, otherScreens) -#: main.ui:286 +#: main.ui:259 msgid "All other screens" msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, filterMinimization) -#: main.ui:296 +#: main.ui:269 #, fuzzy #| msgid "Minimum Size" msgid "Minimization" msgstr "न्यूनतम आकार" #. i18n: ectx: property (text), widget (QRadioButton, visibleWindows) -#: main.ui:340 +#: main.ui:304 msgid "Visible windows" msgstr "" #. i18n: ectx: property (text), widget (QRadioButton, hiddenWindows) -#: main.ui:347 +#: main.ui:311 msgid "Hidden windows" msgstr "" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_4) -#: main.ui:386 +#: main.ui:350 msgid "Shortcuts" msgstr "" #. i18n: ectx: property (text), widget (QLabel, label_3) #. i18n: ectx: property (text), widget (QLabel, label_5) -#: main.ui:395 main.ui:438 +#: main.ui:359 main.ui:402 msgid "Forward" msgstr "" #. i18n: ectx: property (text), widget (QLabel, label) -#: main.ui:418 +#: main.ui:382 msgid "All windows" msgstr "" #. i18n: ectx: property (text), widget (QLabel, label_4) #. i18n: ectx: property (text), widget (QLabel, label_6) -#: main.ui:428 main.ui:448 +#: main.ui:392 main.ui:412 msgid "Reverse" msgstr "" #. i18n: ectx: property (text), widget (QLabel, label_2) -#: main.ui:470 +#: main.ui:442 #, fuzzy #| msgid "Current Desktop Grouped by Applications" msgid "Current application" msgstr "वर्तमान डेस्कटॉप अनुप्रयोग द्वारा समूहीकृत" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_2) -#: main.ui:489 +#: main.ui:469 #, fuzzy #| msgid "Navigation" msgid "Visualization" msgstr "नेविगेशन" -#. i18n: ectx: property (toolTip), widget (QComboBox, effectCombo) -#: main.ui:519 +#. i18n: ectx: property (toolTip), widget (KComboBox, effectCombo) +#: main.ui:490 msgid "The effect to replace the list window when desktop effects are active." msgstr "" #. i18n: ectx: property (toolTip), widget (QCheckBox, highlightWindowCheck) -#: main.ui:549 +#: main.ui:520 msgid "" "The currently selected window will be highlighted by fading out all other " "windows. This option requires desktop effects to be active." msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, highlightWindowCheck) -#: main.ui:552 +#: main.ui:523 #, fuzzy #| msgid "Show Selected Item" msgid "Show selected window" msgstr "चयनित मद दिखाएँ" -#. i18n: ectx: property (toolTip), widget (QPushButton, ghns) -#: main.ui:572 +#. i18n: ectx: property (toolTip), widget (KPushButton, ghns) +#: main.ui:543 msgid "Get New Window Switcher Layout" msgstr "" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmkwm.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmkwm.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmkwm.po 2014-02-16 06:05:54.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmkwm.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcmkwm\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-02-16 03:48+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2007-10-23 11:02+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -24,7 +24,7 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" #. i18n: ectx: property (text), widget (QLabel, label_9) #: actions.ui:32 @@ -423,7 +423,7 @@ msgid " + " msgstr "" -#. i18n: ectx: property (title), widget (QGroupBox, wtBox) +#. i18n: ectx: property (title), widget (KButtonGroup, wtBox) #: advanced.ui:43 #, fuzzy #| msgid "Window Actio&ns" @@ -525,7 +525,7 @@ msgid "Under Mouse" msgstr "फ़ोकस माउस के पीछे" -#. i18n: ectx: property (title), widget (QGroupBox, shBox) +#. i18n: ectx: property (title), widget (KButtonGroup, shBox) #: advanced.ui:167 msgid "Shading" msgstr "शेडिंग" @@ -554,16 +554,16 @@ msgid "&Enable hover" msgstr "हॉवर सक्षम करें (&E)" -#. i18n: ectx: property (whatsThis), widget (QSpinBox, shadeHover) +#. i18n: ectx: property (whatsThis), widget (KIntNumInput, shadeHover) #: advanced.ui:215 msgid "" "Sets the time in milliseconds before the window unshades when the mouse " "pointer goes over the shaded window." msgstr "" -#. i18n: ectx: property (suffix), widget (QSpinBox, delayFocus) -#. i18n: ectx: property (suffix), widget (QSpinBox, autoRaise) -#. i18n: ectx: property (suffix), widget (QSpinBox, shadeHover) +#. i18n: ectx: property (suffix), widget (KIntNumInput, delayFocus) +#. i18n: ectx: property (suffix), widget (KIntNumInput, autoRaise) +#. i18n: ectx: property (suffix), widget (KIntNumInput, shadeHover) #: advanced.ui:230 focus.ui:262 focus.ui:487 #, fuzzy #| msgid " msec" @@ -674,7 +674,7 @@ msgid "&Delay focus by" msgstr "फ़ोकस देरी" -#. i18n: ectx: property (whatsThis), widget (QSpinBox, delayFocus) +#. i18n: ectx: property (whatsThis), widget (KIntNumInput, delayFocus) #: focus.ui:247 msgid "" "This is the delay after which the window the mouse pointer is over will " @@ -795,7 +795,7 @@ msgid "&Raise on hover, delayed by" msgstr "" -#. i18n: ectx: property (whatsThis), widget (QSpinBox, autoRaise) +#. i18n: ectx: property (whatsThis), widget (KIntNumInput, autoRaise) #: focus.ui:472 msgid "" "This is the delay after which the window that the mouse pointer is over will " @@ -853,75 +853,75 @@ msgid "Active screen follows &mouse" msgstr "" -#: main.cpp:78 +#: main.cpp:81 msgid "&Focus" msgstr "फ़ोकस (&F)" -#: main.cpp:83 main.cpp:191 +#: main.cpp:86 main.cpp:194 msgid "&Titlebar Actions" msgstr "शीर्षकपट्टी क्रियाएँ (&T)" -#: main.cpp:88 main.cpp:196 +#: main.cpp:91 main.cpp:199 msgid "Window Actio&ns" msgstr "विंडो क्रियाएँ (&n)" -#: main.cpp:93 +#: main.cpp:96 msgid "&Moving" msgstr "खिसकाते हुए (&M)" -#: main.cpp:98 +#: main.cpp:101 msgid "Ad&vanced" msgstr "विस्तृत (&v)" -#: main.cpp:102 +#: main.cpp:105 msgid "kcmkwinoptions" msgstr "केसीएम-के-विन-ऑप्शन्स" -#: main.cpp:102 +#: main.cpp:105 msgid "Window Behavior Configuration Module" msgstr "विंडो बर्ताव कॉन्फ़िगरेशन मॉड्यूल" -#: main.cpp:104 +#: main.cpp:107 msgid "(c) 1997 - 2002 KWin and KControl Authors" msgstr "(c) 1997 - 2002 के-विन तथा के-कन्ट्रोल लेखक" -#: main.cpp:106 +#: main.cpp:109 msgid "Matthias Ettrich" msgstr "मेथियास एट्रिच" -#: main.cpp:107 +#: main.cpp:110 msgid "Waldo Bastian" msgstr "वाल्दो बास्तियान" -#: main.cpp:108 +#: main.cpp:111 msgid "Cristian Tibirna" msgstr "क्रिश्चियन टिबरिना" -#: main.cpp:109 +#: main.cpp:112 msgid "Matthias Kalle Dalheimer" msgstr "मेथियास काल दाल्हेमेर" -#: main.cpp:110 +#: main.cpp:113 msgid "Daniel Molkentin" msgstr "डेनियल मॉल्केनटिन" -#: main.cpp:111 +#: main.cpp:114 msgid "Wynn Wilkes" msgstr "वाएन विल्किस" -#: main.cpp:112 +#: main.cpp:115 msgid "Pat Dowler" msgstr "पैट डावलर" -#: main.cpp:113 +#: main.cpp:116 msgid "Bernd Wuebben" msgstr "बर्नद वुएबेन" -#: main.cpp:114 +#: main.cpp:117 msgid "Matthias Hoelzer-Kluepfel" msgstr "मैथियास होल्ज़र-क्लूपफेल" -#: main.cpp:166 +#: main.cpp:169 msgid "" "<p><h1>Window Behavior</h1> Here you can customize the way windows behave " "when being moved, resized or clicked on. You can also specify a focus policy " @@ -933,7 +933,7 @@ #. i18n: @item:inlistbox behavior on double click #. i18n: ectx: property (text), item, widget (KComboBox, coTiDbl) -#: mouse.cpp:195 mouse.ui:55 +#: mouse.cpp:197 mouse.ui:55 #, fuzzy #| msgid "Maximize" msgid "Maximize" @@ -941,13 +941,13 @@ #. i18n: @item:inlistbox behavior on double click #. i18n: ectx: property (text), item, widget (KComboBox, coTiDbl) -#: mouse.cpp:196 mouse.ui:60 +#: mouse.cpp:198 mouse.ui:60 msgid "Maximize (vertical only)" msgstr "अधिकतम (केवल खड़ा)" #. i18n: @item:inlistbox behavior on double click #. i18n: ectx: property (text), item, widget (KComboBox, coTiDbl) -#: mouse.cpp:197 mouse.ui:65 +#: mouse.cpp:199 mouse.ui:65 msgid "Maximize (horizontal only)" msgstr "अधिकतम (केवल आड़ा)" @@ -1174,7 +1174,7 @@ msgid "Snap windows onl&y when overlapping" msgstr "जब ओवरलेपिंग हो तभी विंडो स्नेप करें (&y)" -#. i18n: ectx: property (whatsThis), widget (QSpinBox, centerSnap) +#. i18n: ectx: property (whatsThis), widget (KIntNumInput, centerSnap) #: moving.ui:55 msgid "" "Here you can set the snap zone for the screen center, i.e. the 'strength' of " @@ -1182,9 +1182,9 @@ "when moved near it." msgstr "" -#. i18n: ectx: property (suffix), widget (QSpinBox, centerSnap) -#. i18n: ectx: property (suffix), widget (QSpinBox, windowSnap) -#. i18n: ectx: property (suffix), widget (QSpinBox, borderSnap) +#. i18n: ectx: property (suffix), widget (KIntNumInput, centerSnap) +#. i18n: ectx: property (suffix), widget (KIntNumInput, windowSnap) +#. i18n: ectx: property (suffix), widget (KIntNumInput, borderSnap) #: moving.ui:67 moving.ui:134 moving.ui:162 #, fuzzy #| msgid " pixel" @@ -1192,7 +1192,7 @@ msgid " pixel" msgstr "पिक्सेल" -#. i18n: ectx: property (specialValueText), widget (QSpinBox, centerSnap) +#. i18n: ectx: property (specialValueText), widget (KIntNumInput, centerSnap) #: moving.ui:70 #, fuzzy #| msgid "&Border snap zone:" @@ -1211,7 +1211,7 @@ msgid "&Center snap zone:" msgstr "बार्डर स्नैप ज़ोनः (&B)" -#. i18n: ectx: property (whatsThis), widget (QSpinBox, windowSnap) +#. i18n: ectx: property (whatsThis), widget (KIntNumInput, windowSnap) #: moving.ui:122 msgid "" "Here you can set the snap zone for windows, i.e. the 'strength' of the " @@ -1219,14 +1219,14 @@ "moved near another window." msgstr "" -#. i18n: ectx: property (specialValueText), widget (QSpinBox, windowSnap) +#. i18n: ectx: property (specialValueText), widget (KIntNumInput, windowSnap) #: moving.ui:137 #, fuzzy #| msgid "&Window snap zone:" msgid "no window snap zone" msgstr "विंडो स्नैप ज़ोनः (&W)" -#. i18n: ectx: property (whatsThis), widget (QSpinBox, borderSnap) +#. i18n: ectx: property (whatsThis), widget (KIntNumInput, borderSnap) #: moving.ui:150 msgid "" "Here you can set the snap zone for screen borders, i.e. the 'strength' of " @@ -1234,7 +1234,7 @@ "near it." msgstr "" -#. i18n: ectx: property (specialValueText), widget (QSpinBox, borderSnap) +#. i18n: ectx: property (specialValueText), widget (KIntNumInput, borderSnap) #: moving.ui:165 #, fuzzy #| msgid "&Border snap zone:" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmlaunch.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmlaunch.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmlaunch.po 2014-01-21 03:25:21.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmlaunch.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcmlaunch\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-01-21 01:39+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2007-10-23 11:04+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -18,17 +18,17 @@ "X-Generator: KBabel 1.11.4\n" "Plural-Forms: nplurals=2; plural=(n!=1);\n" -#: kcmlaunch.cpp:53 +#: kcmlaunch.cpp:51 msgid "" "<h1>Launch Feedback</h1> You can configure the application-launch feedback " "here." msgstr "<h1>लांच फ़ीडबैक</h1> यहाँ आप एप्लीकेशन-लांच फ़ीडबैक कॉन्फ़िगरेशन कर सकते हैं." -#: kcmlaunch.cpp:56 +#: kcmlaunch.cpp:54 msgid "Bus&y Cursor" msgstr "व्यस्त संकेतक" -#: kcmlaunch.cpp:58 +#: kcmlaunch.cpp:56 msgid "" "<h1>Busy Cursor</h1>\n" "KDE offers a busy cursor for application startup notification.\n" @@ -47,35 +47,35 @@ ". ऐसी परिस्थिति में, कर्सर टिमटिमाना बन्द कर देता है\n" " 'स्टार्टअप इंडीकेशन टाइमआउट' में दिए गए समय के उपरांत." -#: kcmlaunch.cpp:74 +#: kcmlaunch.cpp:72 msgid "No Busy Cursor" msgstr "अव्यस्त संकेतक" -#: kcmlaunch.cpp:75 +#: kcmlaunch.cpp:73 msgid "Passive Busy Cursor" msgstr "अक्रिय व्यस्त संकेतक " -#: kcmlaunch.cpp:76 +#: kcmlaunch.cpp:74 msgid "Blinking Cursor" msgstr "टिमटिमाता संकेतक" -#: kcmlaunch.cpp:77 +#: kcmlaunch.cpp:75 msgid "Bouncing Cursor" msgstr "उछलता संकेतक" -#: kcmlaunch.cpp:85 +#: kcmlaunch.cpp:83 msgid "&Startup indication timeout:" msgstr "स्टार्टअप इंडीकेशन टाइमआउटः" -#: kcmlaunch.cpp:89 kcmlaunch.cpp:123 +#: kcmlaunch.cpp:87 kcmlaunch.cpp:121 msgid " sec" msgstr "सेक." -#: kcmlaunch.cpp:95 +#: kcmlaunch.cpp:93 msgid "Taskbar &Notification" msgstr "कार्यपट्टी अधिसूचना" -#: kcmlaunch.cpp:96 +#: kcmlaunch.cpp:94 msgid "" "<H1>Taskbar Notification</H1>\n" "You can enable a second method of startup notification which is\n" @@ -86,10 +86,10 @@ "given in the section 'Startup indication timeout'" msgstr "" -#: kcmlaunch.cpp:111 +#: kcmlaunch.cpp:109 msgid "Enable &taskbar notification" msgstr "कार्य पट्टी सक्षम करें" -#: kcmlaunch.cpp:119 +#: kcmlaunch.cpp:117 msgid "Start&up indication timeout:" msgstr "स्टार्टअप इंडीकेशन टाइमआउटः" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcm_memory.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcm_memory.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcm_memory.po 2014-01-29 03:28:23.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcm_memory.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcm_memory\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-01-29 01:38+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2008-07-08 12:30+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" "Language-Team: Hindi <Indlinux-hindi@lists.sourceforge.net>\n" @@ -24,9 +24,9 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" -#: chartWidget.cpp:56 memory.cpp:277 +#: chartWidget.cpp:56 memory.cpp:280 msgid "Not available." msgstr "उपलब्ध नहीं" @@ -35,89 +35,89 @@ msgid "%1 free" msgstr "%1 मुक्त" -#: memory.cpp:71 +#: memory.cpp:74 msgid "kcm_memory" msgstr "केसीएम_मेमोरी" -#: memory.cpp:72 +#: memory.cpp:75 msgid "KDE Panel Memory Information Control Module" msgstr "केडीई फलक मेमोरी जानकारी नियंत्रण मॉड्यूल" -#: memory.cpp:74 +#: memory.cpp:77 msgid "(c) 1998 - 2002 Helge Deller" msgstr "(c) 1998 - 2002 हेल्ग डेलर" -#: memory.cpp:76 +#: memory.cpp:79 msgid "Helge Deller" msgstr "हेल्ग डेलर" -#: memory.cpp:108 +#: memory.cpp:111 msgid "" "This display shows you the current memory usage of your system. The values " "are updated on a regular basis and give you an overview of the physical and " "virtual memory being used." msgstr "" -#: memory.cpp:114 +#: memory.cpp:117 msgid "Memory" msgstr "मेमोरी" -#: memory.cpp:132 +#: memory.cpp:135 msgid "Total physical memory:" msgstr "कुल फिज़ीकल मेमोरीः" -#: memory.cpp:135 +#: memory.cpp:138 msgid "Free physical memory:" msgstr "मुक्त फिज़ीकल मेमोरीः" -#: memory.cpp:140 +#: memory.cpp:143 msgid "Shared memory:" msgstr "साझेदारी मेमोरीः" -#: memory.cpp:143 +#: memory.cpp:146 msgid "Disk buffers:" msgstr "डिस्क बफर्सः" -#: memory.cpp:147 +#: memory.cpp:150 msgid "Active memory:" msgstr "सक्रिय मेमोरीः" -#: memory.cpp:150 +#: memory.cpp:153 msgid "Inactive memory:" msgstr "अक्रिय मेमोरीः" -#: memory.cpp:155 +#: memory.cpp:158 msgid "Disk cache:" msgstr "डिस्क कैशः" -#: memory.cpp:159 +#: memory.cpp:162 msgid "Total swap memory:" msgstr "कुल स्वेप मेमोरीः" -#: memory.cpp:162 +#: memory.cpp:165 msgid "Free swap memory:" msgstr "मुक्त स्वेप मेमोरीः" -#: memory.cpp:203 +#: memory.cpp:206 msgid "Charts" msgstr "चार्ट्स" -#: memory.cpp:213 +#: memory.cpp:216 msgid "Total Memory" msgstr "कुल मेमोरी" -#: memory.cpp:214 +#: memory.cpp:217 msgid "" "This graph gives you an overview of the <b>total sum of physical and virtual " "memory</b> in your system." msgstr "" "यह ग्राफ आपको आपके तंत्र के <b>भौतिक तथा आभासी मेमोरी के कुल योग</b> का खाका बताता है." -#: memory.cpp:223 +#: memory.cpp:226 msgid "Physical Memory" msgstr "भौतिक मेमोरी" -#: memory.cpp:224 +#: memory.cpp:227 msgid "" "This graph gives you an overview of the <b>usage of physical memory</b> in " "your system.<p>Most operating systems (including Linux) will use as much of " @@ -127,11 +127,11 @@ "your system is well configured.</p>" msgstr "" -#: memory.cpp:239 +#: memory.cpp:242 msgid "Swap Space" msgstr "स्वेप जगह" -#: memory.cpp:240 +#: memory.cpp:243 msgid "" "<p>The swap space is the <b>virtual memory</b> available to the system.</p> " "<p>It will be used on demand and is provided through one or more swap " @@ -141,7 +141,7 @@ "मुताबिक प्रयोग में आता है और इसे एक या अधिक स्वेप पार्टीशन या स्वेप फ़ाइलों के जरिए प्रयोग " "में लिया जाता है.</p>" -#: memory.cpp:271 +#: memory.cpp:274 #, fuzzy, kde-format #| msgid "%1 bytes =" msgid "1 byte =" @@ -149,35 +149,35 @@ msgstr[0] "%1 बाइट्स =" msgstr[1] "%1 बाइट्स =" -#: physicalMemoryChart.cpp:50 +#: physicalMemoryChart.cpp:51 msgid "Free Physical Memory" msgstr "मुक्त भौतिक मेमोरी" -#: physicalMemoryChart.cpp:52 +#: physicalMemoryChart.cpp:53 msgid "Disk Cache" msgstr "डिस्क कैश" -#: physicalMemoryChart.cpp:54 +#: physicalMemoryChart.cpp:55 msgid "Disk Buffers" msgstr "डिस्क बफर्स" -#: physicalMemoryChart.cpp:56 +#: physicalMemoryChart.cpp:57 msgid "Application Data" msgstr "अनुप्रयोग डाटा" -#: swapMemoryChart.cpp:47 +#: swapMemoryChart.cpp:48 msgid "Free Swap" msgstr "मुक्त स्वेप" -#: swapMemoryChart.cpp:49 totalMemoryChart.cpp:43 +#: swapMemoryChart.cpp:50 totalMemoryChart.cpp:45 msgid "Used Swap" msgstr "उपयोग में स्वेप" -#: totalMemoryChart.cpp:41 +#: totalMemoryChart.cpp:43 msgid "Total Free Memory" msgstr "कुल मुक्त मेमोरी" -#: totalMemoryChart.cpp:45 +#: totalMemoryChart.cpp:47 msgid "Used Physical Memory" msgstr "उपयोग में भौतिक मेमोरी" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmnic.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmnic.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmnic.po 2013-10-16 03:07:22.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmnic.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcmnic\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-10-16 01:35+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-12-09 01:20+0530\n" "Last-Translator: G Karunakar\n" "Language-Team: Hindi <en@li.org>\n" @@ -26,107 +26,107 @@ msgid "Your emails" msgstr "karunakar@indlinux.org" -#: nic.cpp:100 +#: nic.cpp:99 msgid "Name" msgstr "नाम" -#: nic.cpp:100 +#: nic.cpp:99 msgid "IP Address" msgstr "आईपी पता" -#: nic.cpp:100 +#: nic.cpp:99 msgid "Network Mask" msgstr "नेटवर्क मास्क" -#: nic.cpp:100 +#: nic.cpp:99 msgid "Type" msgstr "क़िस्म" -#: nic.cpp:100 +#: nic.cpp:99 msgid "State" msgstr "स्थिति" -#: nic.cpp:100 +#: nic.cpp:99 msgid "HWAddr" msgstr "HWAddr" -#: nic.cpp:104 +#: nic.cpp:103 msgid "&Update" msgstr "अद्यतन (&U)" -#: nic.cpp:112 +#: nic.cpp:111 msgid "kcminfo" msgstr "kcminfo" -#: nic.cpp:113 +#: nic.cpp:112 msgid "System Information Control Module" msgstr "तंत्र जानकारी नियंत्रण इकाई" -#: nic.cpp:115 +#: nic.cpp:114 msgid "(c) 2001 - 2002 Alexander Neundorf" msgstr "(c) 2001 - 2002 अलेक्ज़ेंडर न्यून्दॉर्फ" -#: nic.cpp:117 +#: nic.cpp:116 msgid "Alexander Neundorf" msgstr "अलेक्ज़ेंडर न्यून्दॉर्फ" -#: nic.cpp:153 +#: nic.cpp:152 msgctxt "State of network card is connected" msgid "Up" msgstr "ऊपर" -#: nic.cpp:154 +#: nic.cpp:153 msgctxt "State of network card is disconnected" msgid "Down" msgstr "नीचे" -#: nic.cpp:197 +#: nic.cpp:196 msgctxt "@item:intext Mode of network card" msgid "Broadcast" msgstr "ब्रॉडकास्ट" -#: nic.cpp:199 +#: nic.cpp:198 msgctxt "@item:intext Mode of network card" msgid "Point to Point" msgstr "बिन्दु से बिन्दु" -#: nic.cpp:202 +#: nic.cpp:201 msgctxt "@item:intext Mode of network card" msgid "Multicast" msgstr "मल्टीकास्ट" -#: nic.cpp:205 +#: nic.cpp:204 msgctxt "@item:intext Mode of network card" msgid "Loopback" msgstr "लूपबैक" -#: nic.cpp:207 +#: nic.cpp:206 msgctxt "@item:intext Mode of network card" msgid "Unknown" msgstr "अज्ञात" -#: nic.cpp:217 +#: nic.cpp:216 msgctxt "Unknown network mask" msgid "Unknown" msgstr "अज्ञात" -#: nic.cpp:236 +#: nic.cpp:235 msgctxt "Unknown HWaddr" msgid "Unknown" msgstr "अज्ञात" -#: nic.cpp:293 +#: nic.cpp:292 msgid "Point to Point" msgstr "बिन्दु से बिन्दु" -#: nic.cpp:300 +#: nic.cpp:299 msgid "Broadcast" msgstr "ब्रॉडकास्ट" -#: nic.cpp:307 +#: nic.cpp:306 msgid "Multicast" msgstr "मल्टीकास्ट" -#: nic.cpp:314 +#: nic.cpp:313 msgid "Loopback" msgstr "लूपबैक" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmopengl.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmopengl.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmopengl.po 2014-03-11 04:22:41.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmopengl.po 2013-11-15 06:48:35.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcmopengl\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-11 01:51+0000\n" +"POT-Creation-Date: 2013-11-15 05:51+0000\n" "PO-Revision-Date: 2008-07-08 12:43+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" "Language-Team: Hindi <Indlinux-hindi@lists.sourceforge.net>\n" @@ -24,17 +24,17 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" -#: opengl.cpp:87 +#: opengl.cpp:81 msgid "kcmopengl" msgstr "केसीएमओपनजीएल" -#: opengl.cpp:88 +#: opengl.cpp:82 msgid "KCM OpenGL Information" msgstr "केसीएम ओपन-जीएल जानकारी" -#: opengl.cpp:90 +#: opengl.cpp:84 msgid "" "(c) 2008 Ivo Anjo\n" "(c) 2004 Ilya Korniyko\n" @@ -44,318 +44,282 @@ "(c) 2004 इल्या कोर्नियको\n" "(c) 1999-2002 ब्रायन पॉल" -#: opengl.cpp:92 +#: opengl.cpp:86 msgid "Ivo Anjo" msgstr "इवा एन्जो" -#: opengl.cpp:93 +#: opengl.cpp:87 msgid "Ilya Korniyko" msgstr "इल्या कोर्नियको" -#: opengl.cpp:94 +#: opengl.cpp:88 msgid "Helge Deller" msgstr "हेल्ग डेलर" -#: opengl.cpp:94 +#: opengl.cpp:88 msgid "Original Maintainer" msgstr "मूल मेंटेनर" -#: opengl.cpp:95 +#: opengl.cpp:89 msgid "Brian Paul" msgstr "ब्रायन पॉल" -#: opengl.cpp:95 +#: opengl.cpp:89 msgid "Author of glxinfo Mesa demos (http://www.mesa3d.org)" msgstr "glxinfo Mesa demos (http://www.mesa3d.org) के लेखक" -#: opengl.cpp:354 +#: opengl.cpp:349 msgid "Max. number of light sources" msgstr "अधिकतम प्रकाशस्त्रोतों की संख्या" -#: opengl.cpp:355 +#: opengl.cpp:350 msgid "Max. number of clipping planes" msgstr "क्लिपिंग प्लेन्स की अधिकतम संख्या" -#: opengl.cpp:356 +#: opengl.cpp:351 msgid "Max. pixel map table size" msgstr "अधिकतम पिक्सेल मैप टेबल आकार" -#: opengl.cpp:357 +#: opengl.cpp:352 msgid "Max. display list nesting level" msgstr "अधिकतम लिस्ट नेस्टिंग स्तर" -#: opengl.cpp:358 +#: opengl.cpp:353 msgid "Max. evaluator order" msgstr "अधिकतम इवेल्यूएटर ऑर्डर" -#: opengl.cpp:359 +#: opengl.cpp:354 msgid "Max. recommended vertex count" msgstr "अधिकतम अनुशंसित वर्टेक्स काउन्ट" -#: opengl.cpp:360 +#: opengl.cpp:355 msgid "Max. recommended index count" msgstr "अधिकतम अनुशंसित इंडेक्स काउन्ट" -#: opengl.cpp:362 +#: opengl.cpp:357 msgid "Occlusion query counter bits" msgstr "ऑकल्सन क्वैरी काउन्टर बिट्स" -#: opengl.cpp:365 +#: opengl.cpp:360 msgid "Max. vertex blend matrices" msgstr "अधिकतम वर्टेक्स ब्लैण्ड माट्रिक्स" -#: opengl.cpp:368 +#: opengl.cpp:363 msgid "Max. vertex blend matrix palette size" msgstr "अधिकतम वर्टेक्स ब्लैण्ड माट्रिक्स पैलेट आकार" -#: opengl.cpp:374 +#: opengl.cpp:369 msgid "Max. texture size" msgstr "अधिकतम टेक्सचर आकार" -#: opengl.cpp:375 +#: opengl.cpp:370 msgid "No. of texture units" msgstr "टैक्सचर यूनिटों की संख्या" -#: opengl.cpp:376 +#: opengl.cpp:371 msgid "Max. 3D texture size" msgstr "अधिकतम 3डी टेक्सचर आकार" -#: opengl.cpp:377 +#: opengl.cpp:372 msgid "Max. cube map texture size" msgstr "अधिकतम क्यूब मैप टेक्सचर आकार" -#: opengl.cpp:379 +#: opengl.cpp:374 msgid "Max. rectangular texture size" msgstr "अधिकतम आयताकार टेक्सचर आकार" -#: opengl.cpp:381 +#: opengl.cpp:376 msgid "Max. texture LOD bias" msgstr "अधिकतम टेक्सचर एलओडी बायस" -#: opengl.cpp:382 +#: opengl.cpp:377 msgid "Max. anisotropy filtering level" msgstr "अधिकतम एनिसोट्रॉफ़ी फ़िल्टरिंग स्तर" -#: opengl.cpp:383 +#: opengl.cpp:378 msgid "No. of compressed texture formats" msgstr "संपीडित टेक्सचर फॉर्मेट्स की संख्या" -#: opengl.cpp:481 +#: opengl.cpp:476 msgid "Max. viewport dimensions" msgstr "अधिकतम व्यूपोर्ट आयाम" -#: opengl.cpp:482 +#: opengl.cpp:477 msgid "Subpixel bits" msgstr "सबपिक्सेल बिट्स" -#: opengl.cpp:483 +#: opengl.cpp:478 msgid "Aux. buffers" msgstr "ऑक्ज़ीलरी बफ़र्स" -#: opengl.cpp:489 +#: opengl.cpp:484 msgid "Frame buffer properties" msgstr "फ्रेम बफर गुण" -#: opengl.cpp:490 +#: opengl.cpp:485 msgid "Texturing" msgstr "टेक्सचरिंग" -#: opengl.cpp:491 +#: opengl.cpp:486 msgid "Various limits" msgstr "बहुत से लिमिट्स" -#: opengl.cpp:492 +#: opengl.cpp:487 msgid "Points and lines" msgstr "बिंदु तथा लकीरें" -#: opengl.cpp:493 +#: opengl.cpp:488 msgid "Stack depth limits" msgstr "स्टेक डेफ्थ लिमिट" -#: opengl.cpp:567 opengl.cpp:574 +#: opengl.cpp:555 opengl.cpp:557 +msgid "Direct Rendering" +msgstr "प्रत्यक्ष रेंडरिंग" + +#: opengl.cpp:555 opengl.cpp:557 +msgid "Indirect Rendering" +msgstr "अप्रत्यक्ष रेंडरिंग" + +#: opengl.cpp:562 opengl.cpp:569 msgid "3D Accelerator" msgstr "3डी त्वरक" -#: opengl.cpp:569 opengl.cpp:586 +#: opengl.cpp:564 opengl.cpp:581 msgid "Vendor" msgstr "विक्रेता" -#: opengl.cpp:570 +#: opengl.cpp:565 msgid "Device" msgstr "उपकरण" -#: opengl.cpp:571 +#: opengl.cpp:566 msgid "Subvendor" msgstr "उप-विक्रेता" -#: opengl.cpp:572 +#: opengl.cpp:567 msgid "Revision" msgstr "संशोधन" -#: opengl.cpp:574 opengl.cpp:595 +#: opengl.cpp:569 opengl.cpp:586 msgid "unknown" msgstr "अज्ञात" -#: opengl.cpp:579 opengl.cpp:581 +#: opengl.cpp:574 opengl.cpp:576 msgid "Driver" msgstr "ड्राइवर" -#: opengl.cpp:587 +#: opengl.cpp:582 msgid "Renderer" msgstr "रेंडरर" -#: opengl.cpp:589 -#, fuzzy -#| msgid "OpenGL version" -msgid "OpenGL ES version" -msgstr "ओपन-जीएल संस्करण" - -#: opengl.cpp:591 +#: opengl.cpp:583 #, fuzzy #| msgid "OpenGL version" -msgid "OpenGL version" +msgid "OpenGL/ES version" msgstr "ओपन-जीएल संस्करण" -#: opengl.cpp:596 +#: opengl.cpp:587 msgid "Kernel module" msgstr "कर्नेल मॉड्यूल" -#: opengl.cpp:600 -#, fuzzy -#| msgid "OpenGL extensions" -msgid "OpenGL ES extensions" -msgstr "ओपन-जीएल एक्सटेंशन्स" - -#: opengl.cpp:602 +#: opengl.cpp:590 #, fuzzy #| msgid "OpenGL extensions" -msgid "OpenGL extensions" +msgid "OpenGL/ES extensions" msgstr "ओपन-जीएल एक्सटेंशन्स" -#: opengl.cpp:608 +#: opengl.cpp:594 msgid "Implementation specific" msgstr "इम्प्लीमेंटेशन स्पेसिफिक" -#: opengl.cpp:621 +#: opengl.cpp:606 msgid "GLX" msgstr "जीएलएक्स" -#: opengl.cpp:622 +#: opengl.cpp:607 msgid "server GLX vendor" msgstr "सर्वर जीएलएक्स वेंडर" -#: opengl.cpp:623 +#: opengl.cpp:608 msgid "server GLX version" msgstr "सर्वर जीएलएक्स संस्करण" -#: opengl.cpp:624 +#: opengl.cpp:609 msgid "server GLX extensions" msgstr "सर्वर जीएलएक्स एक्सटेंशन्स" -#: opengl.cpp:627 +#: opengl.cpp:612 msgid "client GLX vendor" msgstr "क्लाएंट जीएलएक्स वेंडर" -#: opengl.cpp:628 +#: opengl.cpp:613 msgid "client GLX version" msgstr "क्लाएंट जीएलएक्स संस्करण" -#: opengl.cpp:629 +#: opengl.cpp:614 msgid "client GLX extensions" msgstr "क्लाएंट जीएलएक्स एक्सटेंशन्स" -#: opengl.cpp:631 +#: opengl.cpp:616 msgid "GLX extensions" msgstr "जीएलएक्स एक्सटेंशन्स" -#: opengl.cpp:634 +#: opengl.cpp:619 msgid "GLU" msgstr "जीएलयू" -#: opengl.cpp:635 +#: opengl.cpp:620 msgid "GLU version" msgstr "जीएलयू संस्करण" -#: opengl.cpp:636 +#: opengl.cpp:621 msgid "GLU extensions" msgstr "जीएलयू एक्सटेंशन्स" -#: opengl.cpp:647 +#: opengl.cpp:630 #, fuzzy #| msgid "GLX" msgid "EGL" msgstr "जीएलएक्स" -#: opengl.cpp:648 +#: opengl.cpp:631 #, fuzzy #| msgid "Vendor" msgid "EGL Vendor" msgstr "विक्रेता" -#: opengl.cpp:649 +#: opengl.cpp:632 #, fuzzy #| msgid "GLU version" msgid "EGL Version" msgstr "जीएलयू संस्करण" -#: opengl.cpp:650 +#: opengl.cpp:633 #, fuzzy #| msgid "GLX extensions" msgid "EGL Extensions" msgstr "जीएलएक्स एक्सटेंशन्स" -#: opengl.cpp:726 -#, fuzzy -#| msgid "Direct Rendering" -msgid "Direct Rendering (GLX)" -msgstr "प्रत्यक्ष रेंडरिंग" - -#: opengl.cpp:726 -#, fuzzy -#| msgid "Indirect Rendering" -msgid "Indirect Rendering (GLX)" -msgstr "अप्रत्यक्ष रेंडरिंग" - -#: opengl.cpp:838 -#, fuzzy -#| msgid "Direct Rendering" -msgid "Direct Rendering (EGL)" -msgstr "प्रत्यक्ष रेंडरिंग" - -#: opengl.cpp:901 +#: opengl.cpp:826 msgid "Information" msgstr "जानकारी" -#: opengl.cpp:902 +#: opengl.cpp:827 msgid "Value" msgstr "मान" -#: opengl.cpp:919 opengl.cpp:958 +#: opengl.cpp:833 msgid "Name of the Display" msgstr "प्रदर्शक का नाम" -#: opengl.cpp:952 -#, fuzzy -#| msgid "Could not initialize OpenGL" -msgid "Could not initialize OpenGL/GLX" +#: opengl.cpp:863 +msgid "Could not initialize OpenGL" msgstr "ओपन-जीएल प्रारंभ नही कर पाया" -#: opengl.cpp:963 -msgid "OpenGL" -msgstr "" - -#: opengl.cpp:966 -msgid "Core Profile" -msgstr "" - -#: opengl.cpp:969 -msgid "Compatibility Profile" -msgstr "" - -#: opengl.cpp:979 +#: opengl.cpp:868 #, fuzzy #| msgid "Could not initialize OpenGL" -msgid "Could not initialize OpenGL (ES)/EGL " +msgid "Could not initialize OpenGL ES2.0" msgstr "ओपन-जीएल प्रारंभ नही कर पाया" #. i18n: ectx: property (text), widget (QTreeWidget, glinfoTreeWidget) diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcm_pci.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcm_pci.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcm_pci.po 2013-10-16 03:07:22.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcm_pci.po 2013-11-05 12:40:10.000000000 +0000 @@ -9,7 +9,7 @@ msgstr "" "Project-Id-Version: kcm_pci\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-10-16 01:35+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-12-09 01:23+0530\n" "Last-Translator: G Karunakar\n" "Language-Team: Hindi <en@li.org>\n" @@ -27,25 +27,25 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" -#: kcm_pci.cpp:51 +#: kcm_pci.cpp:50 msgid "kcm_pci" msgstr "kcm_pci" -#: kcm_pci.cpp:52 +#: kcm_pci.cpp:51 msgid "KDE PCI Information Control Module" msgstr "केडीई पीसीआई जानकारी नियंत्रण मॉड्यूल" -#: kcm_pci.cpp:54 +#: kcm_pci.cpp:53 msgid "(c) 2008 Nicolas Ternisien(c) 1998 - 2002 Helge Deller" msgstr "(c) 2008 निकोलस टेरनिसिन(c) 1998 - 2002 हेल्ग डेलर" -#: kcm_pci.cpp:57 +#: kcm_pci.cpp:56 msgid "Nicolas Ternisien" msgstr "निकोलस टेरनिसिन" -#: kcm_pci.cpp:58 +#: kcm_pci.cpp:57 msgid "Helge Deller" msgstr "हेल्ग डेलर" @@ -508,19 +508,19 @@ msgid "Power management events" msgstr "पॉवर प्रबंधन घटनाएं" -#: kpci.cpp:531 kpci_private.h:763 +#: kpci.cpp:531 kpci_private.h:762 msgid "D0" msgstr "डी०" -#: kpci.cpp:532 kpci_private.h:764 +#: kpci.cpp:532 kpci_private.h:763 msgid "D1" msgstr "डी१" -#: kpci.cpp:533 kpci_private.h:765 +#: kpci.cpp:533 kpci_private.h:764 msgid "D2" msgstr "डी२" -#: kpci.cpp:534 kpci_private.h:766 +#: kpci.cpp:534 kpci_private.h:765 msgid "D3 hot" msgstr "डी३ गर्म" @@ -532,7 +532,7 @@ msgid "Power state" msgstr "पॉवर की स्थिति" -#: kpci.cpp:539 kpci_private.h:680 +#: kpci.cpp:539 kpci_private.h:679 msgid "Power management" msgstr "पॉवर प्रबंधन" @@ -629,7 +629,7 @@ msgid "Configuration" msgstr "कॉन्फ़िगरेशन" -#: kpci.cpp:591 kpci_private.h:681 +#: kpci.cpp:591 kpci_private.h:680 msgid "AGP" msgstr "एजीपी" @@ -645,7 +645,7 @@ msgid "Message control" msgstr "संदेश नियंत्रण" -#: kpci.cpp:625 kpci_private.h:684 +#: kpci.cpp:625 kpci_private.h:683 msgid "Message signaled interrupts" msgstr "संदेश सिगनल इंटरप्ट" @@ -706,921 +706,921 @@ msgid "Cache line size" msgstr "कैश लाइन आकार" -#: kpci_private.h:27 +#: kpci_private.h:26 msgctxt "state of PCI item" msgid "Enabled" msgstr "सक्षम" -#: kpci_private.h:28 +#: kpci_private.h:27 msgctxt "state of PCI item" msgid "Disabled" msgstr "अक्षम" -#: kpci_private.h:29 +#: kpci_private.h:28 msgctxt "state of PCI item" msgid "Yes" msgstr "हाँ" -#: kpci_private.h:30 +#: kpci_private.h:29 msgctxt "state of PCI item" msgid "No" msgstr "नहीं" -#: kpci_private.h:31 +#: kpci_private.h:30 msgctxt "state of PCI item" msgid "Unknown" msgstr "अज्ञात" -#: kpci_private.h:439 +#: kpci_private.h:438 msgid "Unclassified device" msgstr "अवर्गीकृत युक्तियां" -#: kpci_private.h:440 kpci_private.h:474 +#: kpci_private.h:439 kpci_private.h:473 msgid "Mass storage controller" msgstr "जनभन्डारण नियंत्रक" -#: kpci_private.h:441 kpci_private.h:484 +#: kpci_private.h:440 kpci_private.h:483 msgid "Network controller" msgstr "नेटवर्क नियंत्रक" -#: kpci_private.h:442 kpci_private.h:490 +#: kpci_private.h:441 kpci_private.h:489 msgid "Display controller" msgstr "दर्शन श नियंतकरण" -#: kpci_private.h:443 kpci_private.h:496 +#: kpci_private.h:442 kpci_private.h:495 msgid "Multimedia controller" msgstr "मलटिमीडीया नियंत्रक" -#: kpci_private.h:444 kpci_private.h:501 +#: kpci_private.h:443 kpci_private.h:500 msgid "Memory controller" msgstr "संदेश नियंत्रक" -#: kpci_private.h:445 kpci_private.h:515 kpci_private.h:718 +#: kpci_private.h:444 kpci_private.h:514 kpci_private.h:717 msgid "Bridge" msgstr "ब्रिज" -#: kpci_private.h:446 kpci_private.h:524 +#: kpci_private.h:445 kpci_private.h:523 msgid "Communication controller" msgstr "संचार नियंत्रक" -#: kpci_private.h:447 +#: kpci_private.h:446 msgid "Generic system peripheral" msgstr "सामान्य तंत्र घटक" -#: kpci_private.h:448 kpci_private.h:540 +#: kpci_private.h:447 kpci_private.h:539 msgid "Input device controller" msgstr "इनपुट उपकरण नियंत्रक" -#: kpci_private.h:449 kpci_private.h:544 +#: kpci_private.h:448 kpci_private.h:543 msgid "Docking station" msgstr "डॉकिंग स्टेशन" -#: kpci_private.h:450 +#: kpci_private.h:449 msgid "Processor" msgstr "प्रोसेसर" -#: kpci_private.h:451 +#: kpci_private.h:450 msgid "Serial bus controller" msgstr "क्रमिक बस नियंत्रण" -#: kpci_private.h:452 kpci_private.h:575 +#: kpci_private.h:451 kpci_private.h:574 msgid "Wireless controller" msgstr "बेतार नियंत्रण" -#: kpci_private.h:453 +#: kpci_private.h:452 msgid "Intelligent controller" msgstr "बुद्दिमान नियंत्रक" -#: kpci_private.h:454 +#: kpci_private.h:453 msgid "Satellite communications controller" msgstr "सैटेलाइट संचार नियंत्रण" -#: kpci_private.h:455 kpci_private.h:589 +#: kpci_private.h:454 kpci_private.h:588 msgid "Encryption controller" msgstr "एनक्रिप्शन नियंत्रण" -#: kpci_private.h:456 kpci_private.h:596 +#: kpci_private.h:455 kpci_private.h:595 msgid "Signal processing controller" msgstr "सिग्नल प्रोसेस नियंत्रण" -#: kpci_private.h:457 +#: kpci_private.h:456 msgid "Unknown device class" msgstr "अज्ञात उपकरण उपश्रेणी" -#: kpci_private.h:463 +#: kpci_private.h:462 msgid "Non-VGA unclassified device" msgstr "" -#: kpci_private.h:464 +#: kpci_private.h:463 msgid "VGA unclassified device" msgstr "" -#: kpci_private.h:465 +#: kpci_private.h:464 msgid "Unknown unclassified device" msgstr "अज्ञात अवर्गीकृत युक्तियां" -#: kpci_private.h:467 +#: kpci_private.h:466 msgid "SCSI storage controller" msgstr "SCSI भंडार नियंत्रण" -#: kpci_private.h:468 +#: kpci_private.h:467 msgid "IDE controller" msgstr "आईडीई नियंत्रक" -#: kpci_private.h:469 +#: kpci_private.h:468 msgid "Floppy disk controller" msgstr "फ़्लॉपी डिस्क नियंत्रण" -#: kpci_private.h:470 +#: kpci_private.h:469 msgid "IPI bus controller" msgstr "IPI बस नियंत्रक" -#: kpci_private.h:471 +#: kpci_private.h:470 msgid "RAID bus controller" msgstr "RAID बस नियंत्रक" -#: kpci_private.h:472 +#: kpci_private.h:471 msgid "ATA controller" msgstr "ATA नियंत्रक" -#: kpci_private.h:473 +#: kpci_private.h:472 msgid "Serial ATA direct port access" msgstr "सीरियल एटीए पोर्ट अभिगम" -#: kpci_private.h:475 +#: kpci_private.h:474 msgid "Unknown storage controller" msgstr "अज्ञात स्टोरेज नियंत्रक" -#: kpci_private.h:477 +#: kpci_private.h:476 msgid "Ethernet controller" msgstr "इथरनेट नियंत्रक" -#: kpci_private.h:478 +#: kpci_private.h:477 msgid "Token ring network controller" msgstr "टोकन रिंग संजाल नियंत्रक" -#: kpci_private.h:479 +#: kpci_private.h:478 msgid "FDDI network controller" msgstr "FDDI संजाल नियंत्रक" -#: kpci_private.h:480 +#: kpci_private.h:479 msgid "ATM network controller" msgstr "ATM संजाल नियंत्रक" -#: kpci_private.h:481 +#: kpci_private.h:480 msgid "ISDN controller" msgstr "ISDN नियंत्रक" -#: kpci_private.h:482 +#: kpci_private.h:481 msgid "WorldFip controller" msgstr "WorldFip नियंत्रक" -#: kpci_private.h:483 +#: kpci_private.h:482 msgid "PICMG 2.14 multi computing" msgstr "" -#: kpci_private.h:485 +#: kpci_private.h:484 msgid "Unknown network controller" msgstr "अज्ञात संजाल नियंत्रक" -#: kpci_private.h:487 +#: kpci_private.h:486 msgid "VGA compatible controller" msgstr "VGA संगत नियंत्रक" -#: kpci_private.h:488 +#: kpci_private.h:487 msgid "XGA compatible controller" msgstr "XGA संगत नियंत्रक" -#: kpci_private.h:489 +#: kpci_private.h:488 msgid "3D controller" msgstr "3D नियंत्रक" -#: kpci_private.h:491 +#: kpci_private.h:490 msgid "Unknown display controller" msgstr "अज्ञात दर्शन नियंत्रक" -#: kpci_private.h:493 +#: kpci_private.h:492 msgid "Multimedia video controller" msgstr "मल्टीमीडिया विडियो नियंत्रक" -#: kpci_private.h:494 +#: kpci_private.h:493 msgid "Multimedia audio controller" msgstr "मल्टीमीडिया श्रव्य नियंत्रक" -#: kpci_private.h:495 +#: kpci_private.h:494 msgid "Computer telephony device" msgstr "कम्प्यूटर युक्तियां टेलिफोनी" -#: kpci_private.h:497 +#: kpci_private.h:496 msgid "Unknown multimedia controller" msgstr "अज्ञात मलटिमीडिया नियंत्रक" -#: kpci_private.h:499 +#: kpci_private.h:498 msgid "RAM memory" msgstr "रैम मेमोरी" -#: kpci_private.h:500 +#: kpci_private.h:499 msgid "FLASH memory" msgstr "फ्लेश मेमोरी" -#: kpci_private.h:502 +#: kpci_private.h:501 msgid "Unknown memory controller" msgstr "अज्ञात मेमोरी नियंत्रक" -#: kpci_private.h:504 +#: kpci_private.h:503 msgid "Host bridge" msgstr "होस्ट ब्रिज" -#: kpci_private.h:505 +#: kpci_private.h:504 msgid "ISA bridge" msgstr "ISA ब्रिज" -#: kpci_private.h:506 +#: kpci_private.h:505 msgid "EISA bridge" msgstr "EISA ब्रिज" -#: kpci_private.h:507 +#: kpci_private.h:506 msgid "MicroChannel bridge" msgstr "" -#: kpci_private.h:508 +#: kpci_private.h:507 msgid "PCI bridge" msgstr "पीसीआई ब्रिज" -#: kpci_private.h:509 +#: kpci_private.h:508 msgid "PCMCIA bridge" msgstr "PCMCIA ब्रिज" -#: kpci_private.h:510 +#: kpci_private.h:509 msgid "NuBus bridge" msgstr "नुबस ब्रिज" -#: kpci_private.h:511 +#: kpci_private.h:510 msgid "CardBus bridge" msgstr "कार्डबस ब्रिज" -#: kpci_private.h:512 +#: kpci_private.h:511 msgid "RACEway bridge" msgstr "RACEway ब्रिज" -#: kpci_private.h:513 +#: kpci_private.h:512 msgid "Semi-transparent PCI-to-PCI bridge" msgstr "" -#: kpci_private.h:514 +#: kpci_private.h:513 msgid "InfiniBand to PCI host bridge" msgstr "" -#: kpci_private.h:516 +#: kpci_private.h:515 msgid "Unknown bridge" msgstr "अज्ञात ब्रिज" -#: kpci_private.h:518 +#: kpci_private.h:517 msgid "Serial controller" msgstr "सीरियल नियंत्रक" -#: kpci_private.h:519 +#: kpci_private.h:518 msgid "Parallel controller" msgstr "पैरेलेल नियंत्रक" -#: kpci_private.h:520 +#: kpci_private.h:519 msgid "Multiport serial controller" msgstr "बहुपोर्ट सीरियल नियंत्रक" -#: kpci_private.h:521 +#: kpci_private.h:520 msgid "Modem" msgstr "मॉडेम" -#: kpci_private.h:522 +#: kpci_private.h:521 msgid "GPIB (IEEE 488.1/2) controller" msgstr "GPIB (IEEE 488.1/2) नियंत्रक" -#: kpci_private.h:523 +#: kpci_private.h:522 msgid "Smart card" msgstr "स्मार्ट कार्ड" -#: kpci_private.h:525 +#: kpci_private.h:524 msgid "Unknown communication controller" msgstr "अज्ञात संचार नियंत्रक" -#: kpci_private.h:527 +#: kpci_private.h:526 msgid "PIC" msgstr "PIC" -#: kpci_private.h:528 +#: kpci_private.h:527 msgid "DMA controller" msgstr "DMA नियंत्रक" -#: kpci_private.h:529 +#: kpci_private.h:528 msgid "Timer" msgstr "टाइमर" -#: kpci_private.h:530 +#: kpci_private.h:529 msgid "RTC" msgstr "RTC" -#: kpci_private.h:531 +#: kpci_private.h:530 msgid "PCI Hot-plug controller" msgstr "पीसीआई धृतप्लग नियंत्रक" -#: kpci_private.h:532 +#: kpci_private.h:531 msgid "System peripheral" msgstr "तंत्र घटक" -#: kpci_private.h:533 +#: kpci_private.h:532 msgid "Unknown system peripheral" msgstr "अज्ञात तंत्र घटक" -#: kpci_private.h:535 +#: kpci_private.h:534 msgid "Keyboard controller" msgstr "कुंजीपट नियंत्रक" -#: kpci_private.h:536 +#: kpci_private.h:535 msgid "Digitizer Pen" msgstr "डिजिटाज़र कलम" -#: kpci_private.h:537 +#: kpci_private.h:536 msgid "Mouse controller" msgstr "माउस नियंत्रक" -#: kpci_private.h:538 +#: kpci_private.h:537 msgid "Scanner controller" msgstr "स्केनर नियंत्रक" -#: kpci_private.h:539 +#: kpci_private.h:538 msgid "Gameport controller" msgstr "गेमपोर्ट नियंत्रक" -#: kpci_private.h:541 +#: kpci_private.h:540 msgid "Unknown input device controller" msgstr "अज्ञात इंपुट युक्ति नियंत्रक" -#: kpci_private.h:543 +#: kpci_private.h:542 msgid "Generic docking station" msgstr "जेनेरिक डॉकिंग स्टेशन" -#: kpci_private.h:545 +#: kpci_private.h:544 msgid "Unknown docking station" msgstr "अज्ञात डॉकिंग स्टेशन" -#: kpci_private.h:547 +#: kpci_private.h:546 msgid "386" msgstr "386" -#: kpci_private.h:548 +#: kpci_private.h:547 msgid "486" msgstr "486" -#: kpci_private.h:549 +#: kpci_private.h:548 msgid "Pentium" msgstr "Pentium" -#: kpci_private.h:550 +#: kpci_private.h:549 msgid "Alpha" msgstr "अल्फा" -#: kpci_private.h:551 +#: kpci_private.h:550 msgid "Power PC" msgstr "Power PC" -#: kpci_private.h:552 +#: kpci_private.h:551 msgid "MIPS" msgstr "MIPS" -#: kpci_private.h:553 +#: kpci_private.h:552 msgid "Co-processor" msgstr "उप-प्रोसेसर" -#: kpci_private.h:554 +#: kpci_private.h:553 msgid "Unknown processor" msgstr "अज्ञात प्रोसेसर" -#: kpci_private.h:556 +#: kpci_private.h:555 msgid "FireWire (IEEE 1394)" msgstr "FireWire (IEEE 1394)" -#: kpci_private.h:557 +#: kpci_private.h:556 msgid "ACCESS bus" msgstr "ACCESS बस" -#: kpci_private.h:558 +#: kpci_private.h:557 msgid "SSA" msgstr "SSA" -#: kpci_private.h:559 +#: kpci_private.h:558 msgid "USB controller" msgstr "यूएसबी नियंत्रक" -#: kpci_private.h:560 +#: kpci_private.h:559 msgid "Fibre channel" msgstr "फाइबर चैनेल" -#: kpci_private.h:561 +#: kpci_private.h:560 msgid "SMBus" msgstr "SMBus" -#: kpci_private.h:562 +#: kpci_private.h:561 msgid "InfiniBand" msgstr "InfiniBand" -#: kpci_private.h:563 +#: kpci_private.h:562 msgid "IPMI interface" msgstr "IPMI अतरफलक" -#: kpci_private.h:564 +#: kpci_private.h:563 msgid "SERCOS interface" msgstr "SERCOS अतरफलक" -#: kpci_private.h:565 +#: kpci_private.h:564 msgid "CANbus" msgstr "CANbus" -#: kpci_private.h:566 +#: kpci_private.h:565 msgid "Unknown serial bus controller" msgstr "अज्ञात सीरियल बस नियंत्रक" -#: kpci_private.h:568 +#: kpci_private.h:567 msgid "IRDA controller" msgstr "IRDA नियंत्रक" -#: kpci_private.h:569 +#: kpci_private.h:568 msgid "Consumer IR controller" msgstr "ग्राहक IR नियंत्रक" -#: kpci_private.h:570 +#: kpci_private.h:569 msgid "RF controller" msgstr "RF नियंत्रक" -#: kpci_private.h:571 +#: kpci_private.h:570 msgid "Bluetooth" msgstr "ब्लूटूथ" -#: kpci_private.h:572 +#: kpci_private.h:571 msgid "Broadband" msgstr "ब्रॉडबैंड" -#: kpci_private.h:573 +#: kpci_private.h:572 msgid "Ethernet (802.11a - 5 GHz)" msgstr "Ethernet (802.11a - 5 GHz)" -#: kpci_private.h:574 +#: kpci_private.h:573 msgid "Ethernet (802.11b - 2.4 GHz)" msgstr "ईथरनेट (802.11b - 2.4 GHz)" -#: kpci_private.h:576 +#: kpci_private.h:575 msgid "Unknown wireless controller" msgstr "अज्ञात बेतार नियंत्रक" -#: kpci_private.h:578 +#: kpci_private.h:577 msgid "I2O" msgstr "I2O" -#: kpci_private.h:579 +#: kpci_private.h:578 msgid "Unknown intelligent controller" msgstr "अज्ञात बुद्धिमान नियंत्रक" -#: kpci_private.h:581 +#: kpci_private.h:580 msgid "Satellite TV controller" msgstr "सैटेलाइट टीवी नियंत्रक" -#: kpci_private.h:582 +#: kpci_private.h:581 msgid "Satellite audio communication controller" msgstr "उपग्रह श्रव्य संचार नियंत्रक" -#: kpci_private.h:583 +#: kpci_private.h:582 msgid "Satellite voice communication controller" msgstr "उपग्रह ध्वनि संचार नियंत्रक" -#: kpci_private.h:584 +#: kpci_private.h:583 msgid "Satellite data communication controller" msgstr "सैटेलाइट आँकड़ा संचार नियंत्रक" -#: kpci_private.h:585 +#: kpci_private.h:584 msgid "Unknown satellite communications controller" msgstr "अज्ञात उपग्रह संचार नियंत्रक" -#: kpci_private.h:587 +#: kpci_private.h:586 #, fuzzy msgid "Network and computing encryption device" msgstr "नेटवर्क और युक्तियां" -#: kpci_private.h:588 +#: kpci_private.h:587 #, fuzzy msgid "Entertainment encryption device" msgstr "मनोरंजन युक्तियां" -#: kpci_private.h:590 +#: kpci_private.h:589 msgid "Unknown encryption controller" msgstr "" -#: kpci_private.h:592 +#: kpci_private.h:591 msgid "DPIO module" msgstr "DPIO मॉड्यूल" -#: kpci_private.h:593 +#: kpci_private.h:592 msgid "Performance counters" msgstr "प्रदर्शन कॉउंटर" -#: kpci_private.h:594 +#: kpci_private.h:593 msgid "Communication synchronizer" msgstr "संचार तुल्यकालिक" -#: kpci_private.h:595 +#: kpci_private.h:594 msgid "Management card" msgstr "प्रबंधन कार्ड" -#: kpci_private.h:597 +#: kpci_private.h:596 msgid "Unknown signal processing controller" msgstr "अज्ञात संकेत प्रोसेसिंग नियंत्रक" -#: kpci_private.h:599 +#: kpci_private.h:598 msgid "Unknown subdevice class" msgstr "अज्ञात वर्ग उपश्रेणी" -#: kpci_private.h:606 +#: kpci_private.h:605 msgid "single DMA" msgstr "एकल DMA" -#: kpci_private.h:607 +#: kpci_private.h:606 msgid "chained DMA" msgstr "शृंखलाबद्ध DMA" -#: kpci_private.h:609 +#: kpci_private.h:608 msgid "VGA compatible" msgstr "VGA संगत" -#: kpci_private.h:610 +#: kpci_private.h:609 msgid "8514 compatible" msgstr "8514 संगत" -#: kpci_private.h:612 +#: kpci_private.h:611 msgid "Normal decode" msgstr "सामान्य डीकोड" -#: kpci_private.h:613 +#: kpci_private.h:612 msgid "Subtractive decode" msgstr "" -#: kpci_private.h:615 +#: kpci_private.h:614 msgid "Transparent mode" msgstr "पारदर्शी मोड" -#: kpci_private.h:616 +#: kpci_private.h:615 msgid "Endpoint mode" msgstr "अंतबिंदु मोड" -#: kpci_private.h:618 +#: kpci_private.h:617 msgid "Primary bus towards host CPU" msgstr "प्राथमिक बस मेजबान CPU तरफा" -#: kpci_private.h:619 +#: kpci_private.h:618 msgid "Secondary bus towards host CPU" msgstr "द्वितीयक बस CPU तरफा" -#: kpci_private.h:621 +#: kpci_private.h:620 msgid "8250" msgstr "8250" -#: kpci_private.h:622 +#: kpci_private.h:621 msgid "16450" msgstr "16450" -#: kpci_private.h:623 +#: kpci_private.h:622 msgid "16550" msgstr "16550" -#: kpci_private.h:624 +#: kpci_private.h:623 msgid "16650" msgstr "16650" -#: kpci_private.h:625 +#: kpci_private.h:624 msgid "16750" msgstr "16750" -#: kpci_private.h:626 +#: kpci_private.h:625 msgid "16850" msgstr "16850" -#: kpci_private.h:627 +#: kpci_private.h:626 msgid "16950" msgstr "16950" -#: kpci_private.h:629 +#: kpci_private.h:628 msgid "SPP" msgstr "एसपीपी" -#: kpci_private.h:630 +#: kpci_private.h:629 msgid "BiDir" msgstr "द्विदिशा" -#: kpci_private.h:631 +#: kpci_private.h:630 msgid "ECP" msgstr "ईसीपी" -#: kpci_private.h:632 +#: kpci_private.h:631 msgid "IEEE1284" msgstr "IEEE1284" -#: kpci_private.h:633 +#: kpci_private.h:632 msgid "IEEE1284 Target" msgstr "IEEE1284 लक्षय" -#: kpci_private.h:635 kpci_private.h:655 kpci_private.h:658 kpci_private.h:661 +#: kpci_private.h:634 kpci_private.h:654 kpci_private.h:657 kpci_private.h:660 msgid "Generic" msgstr "जेनेरिक" -#: kpci_private.h:636 +#: kpci_private.h:635 msgid "Hayes/16450" msgstr "हैयस/16450" -#: kpci_private.h:637 +#: kpci_private.h:636 msgid "Hayes/16550" msgstr "हैयस/16550" -#: kpci_private.h:638 +#: kpci_private.h:637 msgid "Hayes/16650" msgstr "Hayes/16650" -#: kpci_private.h:639 +#: kpci_private.h:638 msgid "Hayes/16750" msgstr "Hayes/16750" -#: kpci_private.h:641 +#: kpci_private.h:640 msgid "8259" msgstr "8259" -#: kpci_private.h:642 +#: kpci_private.h:641 msgid "ISA PIC" msgstr "ISA PIC" -#: kpci_private.h:643 +#: kpci_private.h:642 msgid "EISA PIC" msgstr "EISA PIC" -#: kpci_private.h:644 +#: kpci_private.h:643 msgid "IO-APIC" msgstr "IO-APIC" -#: kpci_private.h:645 +#: kpci_private.h:644 msgid "IO(X)-APIC" msgstr "IO(X)-APIC" -#: kpci_private.h:647 +#: kpci_private.h:646 msgid "8237" msgstr "8237" -#: kpci_private.h:648 +#: kpci_private.h:647 msgid "ISA DMA" msgstr "ISA DMA" -#: kpci_private.h:649 +#: kpci_private.h:648 msgid "EISA DMA" msgstr "EISA DMA" -#: kpci_private.h:651 +#: kpci_private.h:650 msgid "8254" msgstr "8254" -#: kpci_private.h:652 +#: kpci_private.h:651 msgid "ISA timer" msgstr "ISA समयक" -#: kpci_private.h:653 +#: kpci_private.h:652 msgid "EISA timers" msgstr "EISA समयक" -#: kpci_private.h:656 +#: kpci_private.h:655 msgid "ISA RTC" msgstr "ISA RTC" -#: kpci_private.h:659 +#: kpci_private.h:658 msgid "Extended" msgstr "विस्तारित" -#: kpci_private.h:662 kpci_private.h:665 +#: kpci_private.h:661 kpci_private.h:664 msgid "OHCI" msgstr "OHCI" -#: kpci_private.h:664 +#: kpci_private.h:663 msgid "UHCI" msgstr "UHCI" -#: kpci_private.h:666 +#: kpci_private.h:665 msgid "EHCI" msgstr "EHCI" -#: kpci_private.h:667 +#: kpci_private.h:666 msgid "Unspecified" msgstr "अविशिष्ट" -#: kpci_private.h:668 +#: kpci_private.h:667 msgid "USB Device" msgstr "यूएसबी उपकरण" -#: kpci_private.h:670 +#: kpci_private.h:669 msgid "SMIC" msgstr "SMIC" -#: kpci_private.h:671 +#: kpci_private.h:670 msgid "Keyboard controller style" msgstr "कुंजीपटल नियंत्रक शैली" -#: kpci_private.h:672 +#: kpci_private.h:671 msgid "Block transfer" msgstr "ब्लॉक हस्तांतरण" -#: kpci_private.h:682 +#: kpci_private.h:681 msgid "Vital product data" msgstr "बहुकीमती आँकड़ा" -#: kpci_private.h:683 +#: kpci_private.h:682 msgid "Slot identification" msgstr "स्लॉट पहचान" -#: kpci_private.h:685 +#: kpci_private.h:684 msgid "CompactPCI hot swap" msgstr "CompactPCI hot swap" -#: kpci_private.h:686 +#: kpci_private.h:685 msgid "PCI-X" msgstr "PCI-X" -#: kpci_private.h:687 +#: kpci_private.h:686 msgid "HyperTransport" msgstr "HyperTransport" -#: kpci_private.h:688 +#: kpci_private.h:687 msgid "Vendor specific" msgstr "विक्रेता विशिष्ट" -#: kpci_private.h:689 +#: kpci_private.h:688 msgid "Debug port" msgstr "डीबग पोर्ट" -#: kpci_private.h:690 +#: kpci_private.h:689 msgid "CompactPCI central resource control" msgstr "CompactPCI केन्द्रीय संंसाध नियंत्रक" -#: kpci_private.h:691 +#: kpci_private.h:690 msgid "PCI hot-plug" msgstr "PCI hot-plug" -#: kpci_private.h:692 +#: kpci_private.h:691 msgid "AGP x8" msgstr "AGP x8" -#: kpci_private.h:693 +#: kpci_private.h:692 msgid "Secure device" msgstr "सुरक्षित युक्ति" -#: kpci_private.h:694 +#: kpci_private.h:693 msgid "PCI express" msgstr "PCI express" -#: kpci_private.h:695 +#: kpci_private.h:694 msgid "MSI-X" msgstr "MSI-X" -#: kpci_private.h:701 +#: kpci_private.h:700 msgid "Fast" msgstr "तेज" -#: kpci_private.h:702 +#: kpci_private.h:701 msgid "Medium" msgstr "मध्यम" -#: kpci_private.h:703 +#: kpci_private.h:702 msgid "Slow" msgstr "धीमा" -#: kpci_private.h:709 +#: kpci_private.h:708 msgid "32 bit" msgstr "32- बिट" -#: kpci_private.h:710 +#: kpci_private.h:709 msgid "Below 1M" msgstr "नीचे 1M" -#: kpci_private.h:711 +#: kpci_private.h:710 msgid "64 bit" msgstr "64-बिट" -#: kpci_private.h:717 +#: kpci_private.h:716 msgid "Standard" msgstr "मानक" -#: kpci_private.h:719 +#: kpci_private.h:718 msgid "CardBus" msgstr "कार्डबस" -#: kpci_private.h:725 +#: kpci_private.h:724 msgid "1X" msgstr "1X" -#: kpci_private.h:726 +#: kpci_private.h:725 msgid "2X" msgstr "2X" -#: kpci_private.h:727 +#: kpci_private.h:726 msgid "1X & 2X" msgstr "1X & 2X" -#: kpci_private.h:728 kpci_private.h:732 +#: kpci_private.h:727 kpci_private.h:731 msgid "4X" msgstr "4X" -#: kpci_private.h:729 +#: kpci_private.h:728 msgid "1X & 4X" msgstr "1X & 4X" -#: kpci_private.h:730 +#: kpci_private.h:729 msgid "2X & 4X" msgstr "2X & 4X" -#: kpci_private.h:731 +#: kpci_private.h:730 msgid "1X & 2X & 4X" msgstr "1X & 2X & 4X" -#: kpci_private.h:733 +#: kpci_private.h:732 msgid "8X" msgstr "8X" -#: kpci_private.h:734 +#: kpci_private.h:733 msgid "4X & 8X" msgstr "4X & 8X" -#: kpci_private.h:740 +#: kpci_private.h:739 msgid "4 ms" msgstr "4 मि.से." -#: kpci_private.h:741 +#: kpci_private.h:740 msgid "16 ms" msgstr "16 मि.से." -#: kpci_private.h:742 +#: kpci_private.h:741 msgid "64 ms" msgstr "64 मि.से." -#: kpci_private.h:743 +#: kpci_private.h:742 msgid "256 ms" msgstr "256 मि.से." -#: kpci_private.h:744 +#: kpci_private.h:743 msgid "Not needed" msgstr "जरूरत नहीं" -#: kpci_private.h:750 +#: kpci_private.h:749 msgid "0 (self powered)" msgstr "0 (स्वयं चलित)" -#: kpci_private.h:751 +#: kpci_private.h:750 msgid "55 mA" msgstr "55 mA" -#: kpci_private.h:752 +#: kpci_private.h:751 msgid "100 mA" msgstr "100 mA" -#: kpci_private.h:753 +#: kpci_private.h:752 msgid "160 mA" msgstr "160 mA" -#: kpci_private.h:754 +#: kpci_private.h:753 msgid "220 mA" msgstr "220 mA" -#: kpci_private.h:755 +#: kpci_private.h:754 msgid "270 mA" msgstr "270 mA" -#: kpci_private.h:756 +#: kpci_private.h:755 msgid "320 mA" msgstr "320 mA" -#: kpci_private.h:757 +#: kpci_private.h:756 msgid "375 mA" msgstr "375 mA" -#: kpci_private.h:772 +#: kpci_private.h:771 msgid "1 vector" msgstr "1 सदिश" -#: kpci_private.h:773 +#: kpci_private.h:772 msgid "2 vectors" msgstr "2 सदिश" -#: kpci_private.h:774 +#: kpci_private.h:773 msgid "4 vectors" msgstr "4 सदिश" -#: kpci_private.h:775 +#: kpci_private.h:774 msgid "8 vectors" msgstr "8 सदिश" -#: kpci_private.h:776 +#: kpci_private.h:775 msgid "16 vectors" msgstr "16 सदिश" -#: kpci_private.h:777 +#: kpci_private.h:776 msgid "32 vectors" msgstr "32 सदिश" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmsamba.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmsamba.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmsamba.po 2014-03-19 06:15:59.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmsamba.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcmsamba\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-19 04:21+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2007-10-23 11:59+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -24,7 +24,7 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" #: kcmsambaimports.cpp:43 ksmbstatus.cpp:52 msgid "Type" @@ -48,31 +48,31 @@ "resource is mounted." msgstr "" -#: kcmsambalog.cpp:39 +#: kcmsambalog.cpp:38 msgid "Samba log file: " msgstr "साम्बा लॉग फ़ाइलः" -#: kcmsambalog.cpp:39 +#: kcmsambalog.cpp:38 msgid "Show opened connections" msgstr "खुले कनेक्शन दिखाएँ" -#: kcmsambalog.cpp:39 +#: kcmsambalog.cpp:38 msgid "Show closed connections" msgstr "बन्द कनेक्शन दिखाएँ" -#: kcmsambalog.cpp:40 +#: kcmsambalog.cpp:39 msgid "Show opened files" msgstr "खुली फ़ाइलें दिखाएँ" -#: kcmsambalog.cpp:40 +#: kcmsambalog.cpp:39 msgid "Show closed files" msgstr "बन्द फ़ाइलें दिखाएँ" -#: kcmsambalog.cpp:40 +#: kcmsambalog.cpp:39 msgid "&Update" msgstr "अद्यतन (&U)" -#: kcmsambalog.cpp:59 +#: kcmsambalog.cpp:58 msgid "" "This page presents the contents of your samba log file in a friendly layout. " "Check that the correct log file for your computer is listed here. If you " @@ -80,21 +80,21 @@ "\"Update\" button." msgstr "" -#: kcmsambalog.cpp:64 +#: kcmsambalog.cpp:63 msgid "" "Check this option if you want to view the details for connections opened to " "your computer." msgstr "" "इस विकल्प को चेक करें यदि आप आपके कम्प्यूटर के लिए खुले कनेक्शन का विवरण देखना चाहते हैं" -#: kcmsambalog.cpp:67 +#: kcmsambalog.cpp:66 msgid "" "Check this option if you want to view the events when connections to your " "computer were closed." msgstr "" "इस विकल्प को चेक करें यदि आप आपके कम्प्यूटर के कनेक्शन बन्द हो तो घटना्स देखना चाहते हैं" -#: kcmsambalog.cpp:70 +#: kcmsambalog.cpp:69 msgid "" "Check this option if you want to see the files which were opened on your " "computer by remote users. Note that file open/close events are not logged " @@ -102,7 +102,7 @@ "level using this module)." msgstr "" -#: kcmsambalog.cpp:76 +#: kcmsambalog.cpp:75 msgid "" "Check this option if you want to see the events when files opened by remote " "users were closed. Note that file open/close events are not logged unless " @@ -110,7 +110,7 @@ "this module)." msgstr "" -#: kcmsambalog.cpp:82 +#: kcmsambalog.cpp:81 msgid "" "Click here to refresh the information on this page. The log file (shown " "above) will be read to obtain the events logged by samba." @@ -118,23 +118,23 @@ "इस पृष्ठ की जानकारी को रिफ्रेश करने के लिए यहाँ क्लिक करें. साम्बा द्वारा लॉग किए घटना " "प्राप्त करने के लिए लॉग फ़ाइल (ऊपर दिखाया गया) पढ़ा जाएगा." -#: kcmsambalog.cpp:90 kcmsambalog.cpp:91 +#: kcmsambalog.cpp:89 kcmsambalog.cpp:90 msgid "Date & Time" msgstr "तारीख़ व समय" -#: kcmsambalog.cpp:90 kcmsambalog.cpp:91 kcmsambastatistics.cpp:69 +#: kcmsambalog.cpp:89 kcmsambalog.cpp:90 kcmsambastatistics.cpp:69 msgid "Event" msgstr "घटना" -#: kcmsambalog.cpp:90 kcmsambalog.cpp:92 kcmsambastatistics.cpp:69 +#: kcmsambalog.cpp:89 kcmsambalog.cpp:91 kcmsambastatistics.cpp:69 msgid "Service/File" msgstr "सेवा/फ़ाइल" -#: kcmsambalog.cpp:91 kcmsambalog.cpp:92 kcmsambastatistics.cpp:69 +#: kcmsambalog.cpp:90 kcmsambalog.cpp:91 kcmsambastatistics.cpp:69 msgid "Host/User" msgstr "होस्ट/उपयोक्ता" -#: kcmsambalog.cpp:95 +#: kcmsambalog.cpp:94 msgid "" "<p>This list shows details of the events logged by samba. Note that events " "at the file level are not logged unless you have configured the log level " @@ -145,23 +145,23 @@ "be read and the list refreshed.</p>" msgstr "" -#: kcmsambalog.cpp:206 kcmsambastatistics.cpp:152 kcmsambastatistics.cpp:217 +#: kcmsambalog.cpp:205 kcmsambastatistics.cpp:152 kcmsambastatistics.cpp:217 msgid "CONNECTION OPENED" msgstr "कनेक्शन खुला" -#: kcmsambalog.cpp:210 +#: kcmsambalog.cpp:209 msgid "CONNECTION CLOSED" msgstr "कनेक्शन बन्द" -#: kcmsambalog.cpp:215 +#: kcmsambalog.cpp:214 msgid " FILE OPENED" msgstr " फ़ाइल खुला." -#: kcmsambalog.cpp:221 +#: kcmsambalog.cpp:220 msgid " FILE CLOSED" msgstr " फ़ाइल बन्द हुआ." -#: kcmsambalog.cpp:229 +#: kcmsambalog.cpp:228 #, kde-format msgid "Could not open file %1" msgstr "फ़ाइल %1 खोल नहीं सका" @@ -264,23 +264,23 @@ msgid "Error: Unable to open configuration file \"smb.conf\"" msgstr "त्रुटि: कॉन्फ़िगरेशन फ़ाइल \"smb.conf\" खोलने में अक्षम" -#: main.cpp:61 +#: main.cpp:60 msgid "&Exports" msgstr "निर्यात (&E)" -#: main.cpp:62 +#: main.cpp:61 msgid "&Imports" msgstr "आयात (&I)" -#: main.cpp:63 +#: main.cpp:62 msgid "&Log" msgstr "लॉग (&L)" -#: main.cpp:64 +#: main.cpp:63 msgid "&Statistics" msgstr "आंकड़े (&S)" -#: main.cpp:68 +#: main.cpp:67 msgid "" "<p>The Samba and NFS Status Monitor is a front end to the programs " "<em>smbstatus</em> and <em>showmount</em>. Smbstatus reports on current " @@ -291,40 +291,40 @@ "flavors of Microsoft Windows.</p>" msgstr "" -#: main.cpp:76 +#: main.cpp:75 msgid "kcmsamba" msgstr "केसीएमसाम्बा" -#: main.cpp:77 +#: main.cpp:76 #, fuzzy #| msgid "KDE Panel System Information Control Module" msgid "System Information Control Module" msgstr "केडीई फलक तंत्र जानकारी नियंत्रण मॉड्यूल" -#: main.cpp:79 +#: main.cpp:78 msgid "(c) 2002 KDE Information Control Module Samba Team" msgstr "(c) 2002 केडीई जानकारी नियंत्रण मॉड्यूल साम्बा टीम" -#: main.cpp:80 +#: main.cpp:79 msgid "Michael Glauche" msgstr "माइकल ग्लाउच" -#: main.cpp:81 +#: main.cpp:80 msgid "Matthias Hoelzer" msgstr "मैथियास होल्ज़र" -#: main.cpp:82 +#: main.cpp:81 msgid "David Faure" msgstr "डेविड फ़ॉउर" -#: main.cpp:83 +#: main.cpp:82 msgid "Harald Koschinski" msgstr "हेराल्ड कोस्चिंस्की" -#: main.cpp:84 +#: main.cpp:83 msgid "Wilco Greven" msgstr "विल्को ग्रेवन" -#: main.cpp:85 +#: main.cpp:84 msgid "Alexander Neundorf" msgstr "अलेक्ज़ेंडर न्यून्दॉर्फ" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmscreensaver.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmscreensaver.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmscreensaver.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmscreensaver.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,224 @@ +# translation of kcmscreensaver.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007. +msgid "" +msgstr "" +"Project-Id-Version: kcmscreensaver\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2010-12-09 01:30+0530\n" +"Last-Translator: G Karunakar\n" +"Language-Team: Hindi <en@li.org>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" + +msgctxt "NAME OF TRANSLATORS" +msgid "Your names" +msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर" + +msgctxt "EMAIL OF TRANSLATORS" +msgid "Your emails" +msgstr "raviratlami@aol.in" + +#: category_list.cpp:7 +msgctxt "Screen saver category" +msgid "Banners & Pictures" +msgstr "बैनर व छवियाँ" + +#: category_list.cpp:8 +msgctxt "Screen saver category" +msgid "Desktop Distortions" +msgstr "डेस्कटॉप विकृतियाँ" + +#: category_list.cpp:9 +msgctxt "Screen saver category" +msgid "Flying Things" +msgstr "उड़ती वस्तुएँ" + +#: category_list.cpp:10 +msgctxt "Screen saver category" +msgid "Fractals" +msgstr "फ्ऱैक्टल्स" + +#: category_list.cpp:11 +msgctxt "Screen saver category" +msgid "Gadgets & Simulations" +msgstr "गॅजेट्स व सिमुलेशन्स" + +#: category_list.cpp:12 +msgctxt "Screen saver category" +msgid "Illusions of Depth" +msgstr "गहराई का भ्रम" + +#: category_list.cpp:13 +msgctxt "Screen saver category" +msgid "Miscellaneous" +msgstr "विविध" + +#: category_list.cpp:14 +msgctxt "Screen saver category" +msgid "OpenGL Screen Savers" +msgstr "ओपन जीएल स्क्रीन सेवर्स" + +#: category_list.cpp:15 +msgctxt "Screen saver category" +msgid "Rapid Motion" +msgstr "त्वरित गति" + +#: category_list.cpp:16 +msgctxt "Screen saver category" +msgid "Visit to Flatland" +msgstr "फ्लेटलैंड की सैर" + +#. i18n: ectx: property (whatsThis), widget (QCheckBox, mEnabledCheckBox) +#: screensaver.ui:29 +msgid "Automatically start the screen saver after a period of inactivity." +msgstr "स्क्रीन सेवर को कुछ समय की निष्क्रियता के पश्चात् स्वचालित प्रारंभ करें." + +#. i18n: ectx: property (text), widget (QCheckBox, mEnabledCheckBox) +#: screensaver.ui:32 +msgid "Start a&utomatically after:" +msgstr "स्वचालित प्रारंभ करें बाद मे : (&u)" + +#. i18n: ectx: property (whatsThis), widget (QCheckBox, mLockCheckBox) +#: screensaver.ui:55 +msgid "" +"Prevent potential unauthorized use by requiring a password to stop the " +"screen saver." +msgstr "" +"स्क्रीन सेवर को रोकने के लिए पासवर्ड आवश्यक करें जिससे संभावित अवैधानिक उपयोग को रोका जा " +"सके." + +#. i18n: ectx: property (text), widget (QCheckBox, mLockCheckBox) +#: screensaver.ui:58 +msgid "&Require password after:" +msgstr "बाद मे पासवर्ड की आवश्यकता होगी : (&R)" + +#. i18n: ectx: property (whatsThis), widget (KIntSpinBox, mWaitLockEdit) +#: screensaver.ui:65 +msgid "" +"The amount of time, after the screen saver has started, to ask for the " +"unlock password." +msgstr "स्क्रीन सेवर के प्रारंभ हो जाने के उपरांत का समय जिसके बाद पासवर्ड के लिए पूछा जाए." + +#. i18n: ectx: property (text), widget (QLabel, label_3) +#: screensaver.ui:87 +msgid "&Screen locker type:" +msgstr "" + +#. i18n: ectx: property (text), widget (QRadioButton, mSimpleLockerRadio) +#: screensaver.ui:97 +msgid "S&imple locker" +msgstr "" + +#. i18n: ectx: property (text), widget (QRadioButton, mPlasmaWidgetsRadio) +#: screensaver.ui:109 +#, fuzzy +#| msgctxt "Screen saver category" +#| msgid "Desktop Distortions" +msgid "&Desktop Widgets" +msgstr "डेस्कटॉप विकृतियाँ" + +#. i18n: ectx: property (text), widget (KPushButton, mPlasmaSetup) +#: screensaver.ui:119 +msgid "Configure..." +msgstr "" + +#. i18n: ectx: property (text), widget (QRadioButton, mScreenSaverRadio) +#: screensaver.ui:128 +#, fuzzy +#| msgid "Screen Saver" +msgid "S&creen saver" +msgstr "स्क्रीन सेवर" + +#. i18n: ectx: property (whatsThis), widget (QTreeWidget, mSaverListView) +#: screensaver.ui:163 +msgid "Select the screen saver to use." +msgstr "इस्तेमाल हेतु स्क्रीन सेवर चुनें" + +#. i18n: ectx: property (whatsThis), widget (KPushButton, mTestBt) +#: screensaver.ui:233 +msgid "Show a full screen preview of the screen saver." +msgstr "स्क्रीन सेवर का सम्पूर्ण स्क्रीन पूर्वावलोकन दिखाएँ." + +#. i18n: ectx: property (text), widget (KPushButton, mTestBt) +#: screensaver.ui:236 +msgid "&Test" +msgstr "जांच (&T)" + +#. i18n: ectx: property (whatsThis), widget (KPushButton, mSetupBt) +#: screensaver.ui:246 +msgid "Configure the screen saver's options, if any." +msgstr "यदि हों तो स्क्रीन सेवर के विकल्पों को कॉन्फ़िगर करें." + +#. i18n: ectx: property (text), widget (KPushButton, mSetupBt) +#: screensaver.ui:249 +msgid "&Setup..." +msgstr "सेटअप... (&S)" + +#: scrnsave.cpp:115 +msgid "" +"<h1>Screen Saver</h1> <p>This module allows you to enable and configure a " +"screen saver. Note that you can enable a screen saver even if you have power " +"saving features enabled for your display.</p> <p>Besides providing an " +"endless variety of entertainment and preventing monitor burn-in, a screen " +"saver also gives you a simple way to lock your display if you are going to " +"leave it unattended for a while. If you want the screen saver to lock the " +"session, make sure you enable the \"Require password\" feature of the screen " +"saver; if you do not, you can still explicitly lock the session using the " +"desktop's \"Lock Session\" action.</p>" +msgstr "" + +#: scrnsave.cpp:152 +msgctxt "unit of time. minutes until the screensaver is triggered" +msgid " minute" +msgid_plural " minutes" +msgstr[0] "मिनिट" +msgstr[1] "मिनटें" + +#: scrnsave.cpp:164 +msgid " second" +msgid_plural " seconds" +msgstr[0] "क्षण" +msgstr[1] "क्षण" + +#: scrnsave.cpp:181 +msgid "A preview of the selected screen saver." +msgstr "चुने गए स्क्रीन सेवर का एक पूर्वावलोकन." + +#: scrnsave.cpp:200 +msgid "kcmscreensaver" +msgstr "केसीएम-स्क्रीन-सेवर" + +#: scrnsave.cpp:200 +msgid "KDE Screen Saver Control Module" +msgstr "केडीई स्क्रीन सेवर नियंत्रण मॉड्यूल" + +#: scrnsave.cpp:202 +msgid "" +"(c) 1997-2002 Martin R. Jones\n" +"(c) 2003-2004 Chris Howells" +msgstr "" +"(c) 1997-2002 मार्टिन आर. जोन्स\n" +"(c) 2003-2004 क्रिस हॉवेल्स" + +#: scrnsave.cpp:204 +msgid "Chris Howells" +msgstr "क्रिस हॉवेल्स" + +#: scrnsave.cpp:205 +msgid "Martin R. Jones" +msgstr "मार्टिन आर. जोन्स" + +#: scrnsave.cpp:394 +msgid "Loading..." +msgstr "लोड किया जा रहा है..." + +#~ msgid "Settings" +#~ msgstr "विन्यास" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmsmartcard.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmsmartcard.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmsmartcard.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmsmartcard.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,187 @@ +# translation of kcmsmartcard.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007. +msgid "" +msgstr "" +"Project-Id-Version: kcmsmartcard\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2007-10-23 12:02+0530\n" +"Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" + +msgctxt "NAME OF TRANSLATORS" +msgid "Your names" +msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर" + +msgctxt "EMAIL OF TRANSLATORS" +msgid "Your emails" +msgstr "raviratlami@aol.in" + +#. i18n: ectx: property (text), widget (QLabel) +#: nosmartcardbase.ui:24 +msgid "<b>Unable to contact the KDE smartcard service.</b>" +msgstr "<b>केडीई स्मार्ट कार्ड सेवा से सम्पर्क में अक्षम.</b>" + +#. i18n: ectx: property (title), widget (QGroupBox) +#: nosmartcardbase.ui:35 +msgid "Possible Reasons" +msgstr "संभावित कारण" + +#. i18n: ectx: property (text), widget (QLabel) +#: nosmartcardbase.ui:49 +msgid "" +"\n" +"1) The KDE daemon, 'kded' is not running. You can restart it by running the " +"command 'kdeinit' and then try reloading the KDE System Settings to see if " +"this message goes away.\n" +"\n" +"2) You do not appear to have smartcard support in the KDE libraries. You " +"will need to recompile the kdelibs package with libpcsclite installed." +msgstr "" + +#: smartcard.cpp:65 +msgid "kcmsmartcard" +msgstr "केसीएमस्मार्टकार्ड" + +#: smartcard.cpp:65 +msgid "KDE Smartcard Control Module" +msgstr "केसीएम स्मार्टकार्ड नियंत्रण मॉड्यूल" + +#: smartcard.cpp:67 +msgid "(c) 2001 George Staikos" +msgstr "(c) 2001 जॉर्ज स्टायकॉस" + +#: smartcard.cpp:69 +msgid "George Staikos" +msgstr "जॉर्ज स्टायकॉस" + +#: smartcard.cpp:79 +msgid "Change Module..." +msgstr "मॉड्यूल बदलें..." + +#: smartcard.cpp:134 +msgid "Unable to launch KCardChooser" +msgstr "के-कार्ड-चूसर चलाने में अक्षम" + +#: smartcard.cpp:183 +msgid "No card inserted" +msgstr "कोई कार्ड प्रविष्ट नहीं" + +#: smartcard.cpp:224 +msgid "Smart card support disabled" +msgstr "स्मार्ट कार्ड समर्थन असमर्थित" + +#: smartcard.cpp:235 +msgid "No readers found. Check 'pcscd' is running" +msgstr "कोई रीडर्स नहीं मिले. देखें कि 'pcscd' चल रहा है" + +#: smartcard.cpp:260 smartcard.cpp:280 +msgid "NO ATR or no card inserted" +msgstr "कोई एटीआर या कोई कार्ड प्रविष्ट नहीं किया गया" + +#: smartcard.cpp:292 +msgid "Managed by: " +msgstr "द्वारा प्रबंधितः" + +#: smartcard.cpp:302 +msgid "No module managing this card" +msgstr "इस कार्ड को कोई मॉड्यूल प्रबंधित नहीं कर रहा" + +#: smartcard.cpp:395 +msgid "" +"<h1>smartcard</h1> This module allows you to configure KDE support for " +"smartcards. These can be used for various tasks such as storing SSL " +"certificates and logging in to the system." +msgstr "" + +#. i18n: ectx: attribute (title), widget (QWidget) +#: smartcardbase.ui:31 +msgid "Smartcard Support" +msgstr "स्मार्ट-कार्ड समर्थन" + +#. i18n: ectx: property (text), widget (QCheckBox) +#: smartcardbase.ui:42 +msgid "&Enable smartcard support" +msgstr "स्मार्ट-कार्ड समर्थन सक्षम करें (&E)" + +#. i18n: ectx: property (text), widget (QCheckBox) +#: smartcardbase.ui:61 +msgid "Enable &polling to autodetect card events" +msgstr "कार्ड घटनाओं को स्वचलित पता लगाने के लिए पोलिंग सक्षम करें. (&p)" + +#. i18n: ectx: property (whatsThis), widget (QCheckBox) +#: smartcardbase.ui:64 +msgid "" +"In most cases you should have this enabled. It allows KDE to automatically " +"detect card insertion and reader hotplug events." +msgstr "" +"प्रायः सभी दशा में आपको इसे सक्षम कर रखना होगा. यह केडीई को कार्ड इंसर्शन तथा रीडर " +"हाटप्लग घटना्स स्वचलित पता लगाने देता है." + +#. i18n: ectx: property (text), widget (QCheckBox) +#: smartcardbase.ui:92 +msgid "Automatically &launch card manager if inserted card is unclaimed" +msgstr "" +"यदि प्रविष्ट किया गया कार्ड दावा रहित रहता है तो कार्ड प्रबंधक स्वचलित प्रारंभ करें (&l)" + +#. i18n: ectx: property (whatsThis), widget (QCheckBox) +#: smartcardbase.ui:95 +msgid "" +"When you insert a smartcard, KDE can automatically launch a management tool " +"if no other application attempts to use the card." +msgstr "" +"जब आप एक स्मार्टकार्ड प्रविष्ट करते हैं, केडीई स्वचलित रूप से एक प्रबंधन औज़ार प्रारंभ करता है " +"यदि कोई अन्य अनुप्रयोग कार्ड को उपयोग करने के लिए प्रयास नहीं करता है." + +#. i18n: ectx: property (text), widget (QCheckBox) +#: smartcardbase.ui:106 +msgid "&Beep on card insert and removal" +msgstr "कार्ड प्रविष्ट पर तथा निकाले जाने पर बीप करें (&B)" + +#. i18n: ectx: attribute (title), widget (QWidget) +#: smartcardbase.ui:135 +msgid "Readers" +msgstr "रीडर्स" + +#. i18n: ectx: property (text), widget (K3ListView) +#: smartcardbase.ui:152 +msgid "Reader" +msgstr "रीडर" + +#. i18n: ectx: property (text), widget (K3ListView) +#: smartcardbase.ui:163 +msgid "Type" +msgstr "क़िस्म" + +#. i18n: ectx: property (text), widget (K3ListView) +#: smartcardbase.ui:174 +msgid "Subtype" +msgstr "उपक़िस्म" + +#. i18n: ectx: property (text), widget (K3ListView) +#: smartcardbase.ui:185 +msgid "SubSubtype" +msgstr "उप-उपप्रकार" + +#. i18n: ectx: property (title), widget (QGroupBox) +#: smartcardbase.ui:228 +msgid "PCSCLite Configuration" +msgstr "PCSCLite कॉन्फ़िगरेशन" + +#. i18n: ectx: property (text), widget (QLabel) +#: smartcardbase.ui:251 +msgid "" +"To add new readers you have to modify /etc/readers.conf file and re-start " +"pcscd" +msgstr "" +"नए रीडर्स जोड़ने के लिए आपको /etc/readers.conf फ़ाइल को परिवर्धित करना होगा तथा " +"pcscd को फिर से प्रारंभ करना होगा" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmsmserver.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmsmserver.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmsmserver.po 2013-11-28 03:26:50.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmsmserver.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcmsmserver\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-11-28 01:40+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2007-10-23 12:03+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -18,7 +18,7 @@ "X-Generator: KBabel 1.11.4\n" "Plural-Forms: nplurals=2; plural=(n!=1);\n" -#: kcmsmserver.cpp:53 +#: kcmsmserver.cpp:52 msgid "" "<h1>Session Manager</h1> You can configure the session manager here. This " "includes options such as whether or not the session exit (logout) should be " diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcm_solid_actions.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcm_solid_actions.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcm_solid_actions.po 2013-02-11 21:49:05.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcm_solid_actions.po 2013-11-05 12:40:10.000000000 +0000 @@ -8,7 +8,7 @@ msgstr "" "Project-Id-Version: kcm_solid_actions\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2012-08-20 05:37+0200\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-01-31 20:50+0530\n" "Last-Translator: G Karunakar <karunakar@indlinux.org>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmstyle.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmstyle.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmstyle.po 2014-01-02 03:12:55.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmstyle.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcmstyle\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-01-02 01:34+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2007-10-23 13:35+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -24,7 +24,7 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" #. i18n: ectx: property (text), widget (QLabel, label_4) #: finetuning.ui:17 @@ -122,7 +122,7 @@ msgid "Only export" msgstr "" -#: kcmstyle.cpp:181 +#: kcmstyle.cpp:170 msgid "" "<h1>Style</h1>This module allows you to modify the visual appearance of user " "interface elements, such as the widget style and effects." @@ -130,120 +130,120 @@ "<h1>शैली</h1>यह मॉड्यूल आपको उपयोक्ता इंटरफेस तत्वों के प्रद्रशित शक्ल-सूरत जैसे कि विजेट " "शैली तथा प्रभाव को परिवर्धित करने देता है." -#: kcmstyle.cpp:193 +#: kcmstyle.cpp:182 msgid "kcmstyle" msgstr "केसीएमस्टाइल" -#: kcmstyle.cpp:194 +#: kcmstyle.cpp:183 msgid "KDE Style Module" msgstr "केडीई शैली मॉड्यूल" -#: kcmstyle.cpp:196 +#: kcmstyle.cpp:185 msgid "(c) 2002 Karol Szwed, Daniel Molkentin" msgstr "(c) 2002 केरॉल स्वेद, डेनियल मॉलकेंटाइन" -#: kcmstyle.cpp:198 +#: kcmstyle.cpp:187 msgid "Karol Szwed" msgstr "केरोल स्ज़वेड" -#: kcmstyle.cpp:199 +#: kcmstyle.cpp:188 msgid "Daniel Molkentin" msgstr "डेनियल मॉल्केनटिन" -#: kcmstyle.cpp:200 +#: kcmstyle.cpp:189 msgid "Ralf Nolden" msgstr "राल्फ नॉल्देन" -#: kcmstyle.cpp:225 +#: kcmstyle.cpp:214 #, fuzzy #| msgid "Widget Style" msgid "Widget style:" msgstr "विजेट शैली" -#: kcmstyle.cpp:235 +#: kcmstyle.cpp:224 msgid "Con&figure..." msgstr "कॉन्फ़िगर... (&f)" -#: kcmstyle.cpp:244 +#: kcmstyle.cpp:233 msgid "Preview" msgstr "पूर्वावलोकन" -#: kcmstyle.cpp:265 +#: kcmstyle.cpp:254 msgid "Low display resolution and Low CPU" msgstr "" -#: kcmstyle.cpp:266 +#: kcmstyle.cpp:255 msgid "High display resolution and Low CPU" msgstr "" -#: kcmstyle.cpp:267 +#: kcmstyle.cpp:256 msgid "Low display resolution and High CPU" msgstr "" -#: kcmstyle.cpp:268 +#: kcmstyle.cpp:257 msgid "High display resolution and High CPU" msgstr "" -#: kcmstyle.cpp:269 +#: kcmstyle.cpp:258 msgid "Low display resolution and Very High CPU" msgstr "" -#: kcmstyle.cpp:270 +#: kcmstyle.cpp:259 msgid "High display resolution and Very High CPU" msgstr "" -#: kcmstyle.cpp:287 +#: kcmstyle.cpp:276 #, fuzzy #| msgid "Application Level" msgctxt "@title:tab" msgid "&Applications" msgstr "अनुप्रयोग स्तर" -#: kcmstyle.cpp:288 +#: kcmstyle.cpp:277 msgctxt "@title:tab" msgid "&Fine Tuning" msgstr "" -#: kcmstyle.cpp:318 kcmstyle.cpp:329 +#: kcmstyle.cpp:307 kcmstyle.cpp:318 msgid "There was an error loading the configuration dialog for this style." msgstr "इस शैली के लिए कॉन्फ़िगरेशन संवाद लोड करने में त्रुटि हुई." -#: kcmstyle.cpp:320 kcmstyle.cpp:331 +#: kcmstyle.cpp:309 kcmstyle.cpp:320 msgid "Unable to Load Dialog" msgstr "संवाद लोड करने में अक्षम." -#: kcmstyle.cpp:403 +#: kcmstyle.cpp:392 msgid "" "<p>Changes to the visibility of menu icons will only affect newly started " "applications.</p>" msgstr "" -#: kcmstyle.cpp:404 +#: kcmstyle.cpp:393 msgctxt "@title:window" msgid "Menu Icons Changed" msgstr "" -#: kcmstyle.cpp:447 +#: kcmstyle.cpp:437 msgid "Settings changes will take effect only on application restart" msgstr "" -#: kcmstyle.cpp:629 kcmstyle.cpp:740 +#: kcmstyle.cpp:618 kcmstyle.cpp:729 msgid "No description available." msgstr "कोई वर्णन उपलब्ध नहीं" -#: kcmstyle.cpp:740 +#: kcmstyle.cpp:729 #, kde-format msgid "Description: %1" msgstr "वर्णनः %1" -#: kcmstyle.cpp:854 +#: kcmstyle.cpp:843 msgid "" "Here you can choose from a list of predefined widget styles (e.g. the way " "buttons are drawn) which may or may not be combined with a theme (additional " "information like a marble texture or a gradient)." msgstr "" -#: kcmstyle.cpp:858 +#: kcmstyle.cpp:847 msgid "" "This area shows a preview of the currently selected style without having to " "apply it to the whole desktop." @@ -251,11 +251,11 @@ "यह क्षेत्र मौज़ूदा चुने गए शैलियों का पूर्वावलोकन प्रदर्शित करता है, इसे पूरे डेस्कटॉप में लागू " "किए बगैर." -#: kcmstyle.cpp:861 +#: kcmstyle.cpp:850 msgid "This page allows you to choose details about the widget style options" msgstr "" -#: kcmstyle.cpp:862 +#: kcmstyle.cpp:851 msgid "" "<p><b>No Text:</b> Shows only icons on toolbar buttons. Best option for low " "resolutions.</p><p><b>Text Only: </b>Shows only text on toolbar buttons.</" @@ -264,7 +264,7 @@ "and text on toolbar buttons. Text is aligned below the icon." msgstr "" -#: kcmstyle.cpp:869 +#: kcmstyle.cpp:858 msgid "" "If you enable this option, KDE Applications will show small icons alongside " "some important buttons." @@ -272,7 +272,7 @@ "यदि यह विकल्प चुना जाता है, तो केडीई अनुप्रयोग कुछ महत्वपूर्ण बटनों के बाज़ू में छोटे प्रतीक " "दिखाएगा." -#: kcmstyle.cpp:871 +#: kcmstyle.cpp:860 #, fuzzy #| msgid "" #| "If you enable this option, KDE Applications will show small icons " @@ -284,7 +284,7 @@ "यदि यह विकल्प चुना जाता है, तो केडीई अनुप्रयोग कुछ महत्वपूर्ण बटनों के बाज़ू में छोटे प्रतीक " "दिखाएगा." -#: kcmstyle.cpp:873 +#: kcmstyle.cpp:862 #, fuzzy #| msgid "" #| "If you enable this option, KDE Applications will show small icons " diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmusb.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmusb.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmusb.po 2013-08-31 17:18:08.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmusb.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcmusb\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2012-08-20 05:30+0200\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2007-10-23 14:33+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -24,7 +24,7 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" #: classes.i18n:1 msgid "AT-commands" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kcmview1394.po kde-l10n-hi-4.13.0/messages/kde-workspace/kcmview1394.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kcmview1394.po 2013-02-11 21:49:05.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kcmview1394.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kcmview1394\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2012-08-20 05:30+0200\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2007-10-23 14:34+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kdmconfig.po kde-l10n-hi-4.13.0/messages/kde-workspace/kdmconfig.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kdmconfig.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kdmconfig.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,981 @@ +# translation of kdmconfig.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007. +msgid "" +msgstr "" +"Project-Id-Version: kdmconfig\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2010-12-09 01:36+0530\n" +"Last-Translator: G Karunakar\n" +"Language-Team: Hindi <en@li.org>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" + +msgctxt "NAME OF TRANSLATORS" +msgid "Your names" +msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर" + +msgctxt "EMAIL OF TRANSLATORS" +msgid "Your emails" +msgstr "raviratlami@aol.in" + +#: background.cpp:39 +msgid "E&nable background" +msgstr "पृष्ठभूमि सक्षम करें (&n)" + +#: background.cpp:41 +msgid "" +"If this is checked, KDM will use the settings below for the background. If " +"it is disabled, you have to look after the background yourself. This is done " +"by running some program (possibly xsetroot) in the script specified in the " +"Setup= option in kdmrc (usually Xsetup)." +msgstr "" +"यदि यह चेक किया जाता है, केडीएम नीचे दिए गए विन्यास को पृष्ठभूमि के लिए उपयोग करेगा. " +"यदि यह अक्षम किया जाता है, आपको स्वयं को पृष्ठभूमि के लिए देखना होगा. यह कुछ प्रोग्राम " +"(संभवतः xsetroot) चलाकर किया जाता है जो स्क्रिप्ट उल्लेखित होता है- सेटअप=विकल्प kdmrc " +"में (प्रायः एक्ससेटअप)." + +#: kdm-conv.cpp:49 +msgid "<big><b><center>Attention<br/>Read help</center></b></big>" +msgstr "<big><b><center>ध्यान दें<br/>मदद पढ़ें</center></b></big>" + +#: kdm-conv.cpp:59 +msgid "Enable Au&to-Login" +msgstr "स्वचालित लॉगइन सक्षम करें (&t)" + +#: kdm-conv.cpp:65 +msgid "" +"Turn on the auto-login feature. This applies only to KDM's graphical login. " +"Think twice before enabling this!" +msgstr "" +"स्वतः लॉगइन विशेषता चालू करें. यह सिर्फ केडीएम के चित्रमय लॉगइन पर ही लागू होता है. इसे " +"सक्षम करने से पहले दोबारा सोच लें!" + +#: kdm-conv.cpp:72 +msgid "Use&r:" +msgstr "उपयोक्ताः (&r)" + +#: kdm-conv.cpp:81 +msgid "Select the user to be logged in automatically." +msgstr "उपयोक्ता चुनें जो स्वचलित लॉगइन होंगे" + +#: kdm-conv.cpp:84 +msgid "Loc&k session" +msgstr "सत्र पर ताला लगाएँ (&k)" + +#: kdm-conv.cpp:88 +msgid "" +"The automatically started session will be locked immediately (provided it is " +"a KDE session). This can be used to obtain a super-fast login restricted to " +"one user." +msgstr "" + +#: kdm-conv.cpp:92 +msgctxt "@title:group" +msgid "Preselect User" +msgstr "उपयोक्ता पहले से चुनें" + +#: kdm-conv.cpp:96 +msgctxt "@option:radio preselected user" +msgid "&None" +msgstr "कुछ नहीं (&N)" + +#: kdm-conv.cpp:97 +msgctxt "@option:radio preselected user" +msgid "Prev&ious" +msgstr "पिछला (&i)" + +#: kdm-conv.cpp:99 +msgid "" +"Preselect the user that logged in previously. Use this if this computer is " +"usually used several consecutive times by one user." +msgstr "पिछली दफा लॉगइन किए उपयोक्ता को पहले ही चुनें" + +#: kdm-conv.cpp:101 +#, fuzzy +#| msgctxt "@option:radio preselected user" +#| msgid "Specif&y" +msgctxt "@option:radio preselected user" +msgid "Specifi&ed:" +msgstr "उल्लेखित करें (&y)" + +#: kdm-conv.cpp:103 +#, fuzzy +#| msgid "" +#| "Preselect the user specified in the combo box below. Use this if this " +#| "computer is predominantly used by a certain user." +msgid "" +"Preselect the user specified in the combo box to the right. Use this if this " +"computer is predominantly used by a certain user." +msgstr "" +"नीचे दिए गए कॉम्बो बक्से मे उल्लेखित किए गए उपयोक्ता को पहले ही चुनें. इसका इस्तेमाल करें " +"यदि कम्प्यूटर किसी विशेष उपयोक्ता द्वारा अधिकतर उपयोग में लिया जाता हो." + +#: kdm-conv.cpp:120 +msgid "" +"Select the user to be preselected for login. This box is editable, so you " +"can specify an arbitrary non-existent user to mislead possible attackers." +msgstr "" +"लॉगइन के लिए एक पूर्व-चयनित उपयोक्ता चुनें. यह बक्सा संपादन योग्य है, जिससे संभावित " +"हमलावरों को बहकाने के लिए आप यहाँ एक मनमाने, अस्तित्वहीन उपयोक्ता को उल्लेखित कर सकते हैं." + +#: kdm-conv.cpp:135 +msgctxt "@option:check action" +msgid "Focus pass&word" +msgstr "पासवर्ड फ़ोकस करें (&w)" + +#: kdm-conv.cpp:138 +msgid "" +"When this option is on, KDM will place the cursor in the password field " +"instead of the user field after preselecting a user. Use this to save one " +"key press per login, if the preselection usually does not need to be changed." +msgstr "" +"यदि यह विकल्प चालू किया जाता है, केडीएम एक पूर्व-चयनित उपयोक्ता को चुन कर संकेतक को " +"पासवर्ड फील्ड में रख देगा बजाए उपयोक्ता फील्ड के. इसका उपयोग प्रति लॉगइन एक अतिरिक्त " +"कुंजी दबाने से बचने के लिए करें यदि पूर्व चयनित उपयोक्ता प्रायः बदलते नहीं हैं." + +#: kdm-conv.cpp:144 +msgid "Enable Password-&Less Logins" +msgstr "पासवर्ड बिना लॉगइन सक्षम करें (&L)" + +#: kdm-conv.cpp:151 +msgid "" +"When this option is checked, the checked users from the list below will be " +"allowed to log in without entering their password. This applies only to " +"KDM's graphical login. Think twice before enabling this!" +msgstr "" +"जब यह विकल्प चुना जाता है, नीचे दी गई सूची में से चुना गया उपयोक्ता बिना पासवर्ड भरे " +"लॉगइन के लिए स्वीकार्य होगा. यह सिर्फ केडीएम के चित्रमय लॉगइन पर लागू होगा. इसे सक्षम " +"करने से पहले दोबारा विचार कर लें!" + +#: kdm-conv.cpp:158 +msgid "No password re&quired for:" +msgstr "के लिए कोई पासवर्ड आवश्यक नहीः (&q)" + +#: kdm-conv.cpp:164 +msgid "" +"Check all users you want to allow a password-less login for. Entries denoted " +"with '@' are user groups. Checking a group is like checking all users in " +"that group." +msgstr "" +"उन सभी उपयोक्ताओं को चुनें जिन्हें आप चाहते हैं कि वे पासवर्ड रहित लॉगइन कर सकें. प्रविष्टियाँ " +"जो कि '@' से चिह्नित हैं, वे उपयोक्ता समूह हैं. किसी समूह को चेक करना वैसे ही है जैसे कि उस " +"समूह के सभी उपयोक्ताओं को चेक करना." + +#: kdm-conv.cpp:168 kdm-shut.cpp:95 +msgctxt "@title:group" +msgid "Miscellaneous" +msgstr "विविध" + +#: kdm-conv.cpp:172 +msgid "Automatically log in again after &X server crash" +msgstr "एक्स सर्वर क्रेश होने के बाद फिर से स्वचलित लॉगइन करें (&X)" + +#: kdm-conv.cpp:174 +msgid "" +"When this option is on, a user will be logged in again automatically when " +"their session is interrupted by an X server crash; note that this can open a " +"security hole: if you use a screen locker than KDE's integrated one, this " +"will make circumventing a password-secured screen lock possible." +msgstr "" +"जब यह विकल्प चालू होगा, उपयोगकर्ता स्वचालित रूप से फिर से लॉगइन हो जाएगा जब सत्र एक्स " +"सर्वर क्रेश से अवरूद्ध होगा. टीप लें कि यह सुरक्षा खामियों को खोल सकता है यदि आप केडीई के " +"इंटीग्रेटेड लाकर से भिन्न स्क्रीन लाकर उपयोग करते हैं, तब यह पासवर्ड सुरक्षित स्क्रीन लाक को " +"बायपास करना संभव बनाता है." + +#: kdm-dlg.cpp:64 +msgid "&Greeting:" +msgstr "अभिवादनः (&G)" + +#: kdm-dlg.cpp:71 +msgid "" +"<p>This is the \"headline\" for KDM's login window. You may want to put some " +"nice greeting or information about the operating system here.</p><p>KDM will " +"substitute the following character pairs with the respective contents:</" +"p><ul><li>%d -> current display</li><li>%h -> host name, possibly with " +"domain name</li><li>%n -> node name, most probably the host name without " +"domain name</li><li>%s -> the operating system</li><li>%r -> the operating " +"system's version</li><li>%m -> the machine (hardware) type</li><li>%% -> a " +"single %</li></ul>" +msgstr "" +"यह केडीएम लॉगइन विंडो का \"हेडलाइन\" है. आप यहाँ कुछ सुंदर अभिवादन या आपरेटिंग सिस्टम के " +"बारे में जानकारी रख सकते हैं.<p>केडीएम निम्न अक्षर युगल को संबंधित विषयवस्तु से प्रतिस्थापित " +"कर देगा:<br><ul><li>%d -> मौज़ूदा शक्ल-सूरत</li><li>%h -> होस्ट नाम, संभवतः डोमेन " +"नाम सहित</li><li>%n -> नोड नाम, बहुत संभव है- बगैर डोमेन नाम के होस्ट नाम </li><li>" +"%s -> आपरेटिंग सिस्टम</li><li>%r -> आपरेटिंग सिस्टम का संस्करण</li><li>%m -> मशीन " +"(हार्डवेयर) क़िस्म </li><li>%% -> एक एकल %</li></ul>" + +#: kdm-dlg.cpp:92 +msgid "Logo area:" +msgstr "लोगो क्षेत्र" + +#: kdm-dlg.cpp:97 +msgctxt "logo area" +msgid "&None" +msgstr "कुछ नहीं (&N)" + +#: kdm-dlg.cpp:98 +msgid "Show cloc&k" +msgstr "घड़ी दिखाएँ (&k)" + +#: kdm-dlg.cpp:99 +msgid "Sho&w logo" +msgstr "लोगो दिखाएँ (&w)" + +#: kdm-dlg.cpp:110 +msgid "" +"You can choose to display a custom logo (see below), a clock or no logo at " +"all." +msgstr "आप चुन सकते हैं मनपसंद लोगो (नीचे देखें), एक घड़ी या कोई लोगो नहीं." + +#: kdm-dlg.cpp:116 +msgid "&Logo:" +msgstr "लोगोः (&L)" + +#: kdm-dlg.cpp:127 +msgid "" +"Click here to choose an image that KDM will display. You can also drag and " +"drop an image onto this button (e.g. from Konqueror)." +msgstr "" +"छवि चुनने के लिए यहाँ क्लिक करें जिसो केडीएम दिखाएगा. आप कोई छवि इस बटन पर खींच और " +"छोड़ सकते हैं (जैसे, कॉन्करर से)." + +#: kdm-dlg.cpp:138 +msgid "Dialog &position:" +msgstr "संवाद स्थान: (&p)" + +#: kdm-dlg.cpp:221 +#, kde-format +msgid "" +"There was an error loading the image:\n" +"%1\n" +"It will not be saved." +msgstr "" +"छवि लोड करते समय त्रुटि हुई:\n" +"%1\n" +"यह सहेजा नहीं जाएगा." + +#: kdm-dlg.cpp:257 kdm-dlg.cpp:285 +#, c-format +msgid "Welcome to %s at %n" +msgstr " %s पर %n में आपका स्वागत है" + +#: kdm-dlg.cpp:295 +msgid "" +"<h1>KDM - Dialog</h1> Here you can configure the basic appearance of the KDM " +"login manager in dialog mode, i.e. a greeting string, an icon etc." +msgstr "" +"<h1>केडीएम - संवाद</h1> यहाँ पर आप केडीएम लॉगइन प्रबंधक के मूल रूप को संवाद मोड में " +"कॉन्फ़िगर कर सकते हैं - जैसे कि अभिवादन वाक्यांश, प्रतीक इत्यादि." + +#: kdm-gen.cpp:47 +msgctxt "@title:group 'man locale' ..." +msgid "Locale" +msgstr "स्थानीय भाषा" + +#: kdm-gen.cpp:56 +msgid "&Language:" +msgstr "भाषा (&L):" + +#: kdm-gen.cpp:58 +msgid "" +"Here you can choose the language used by KDM. This setting does not affect a " +"user's personal settings; that will take effect after login." +msgstr "" +"यहाँ आप केडीएम द्वारा उपयोग की जाने वाली भाषा चुन सकते हैं. यह विन्यास उपयोक्ता के निजी " +"विन्यास को प्रभावित नहीं करेगी जो लॉगइन के बाद प्रभावी होता है." + +#: kdm-gen.cpp:65 +msgctxt "@title:group" +msgid "Appearance" +msgstr "रूप" + +#: kdm-gen.cpp:70 +msgid "" +"&Use themed greeter\n" +"(Warning: poor accessibility)" +msgstr "" + +#: kdm-gen.cpp:73 +msgid "" +"Enable this if you would like to use a themed Login Manager.<br>Note that " +"the themed greeter is challenged accessibility-wise (keyboard usage), and " +"themes may lack support for features like a user list or alternative " +"authentication methods." +msgstr "" + +#: kdm-gen.cpp:80 kdm-gen.cpp:91 kdm-users.cpp:114 +msgid "<placeholder>default</placeholder>" +msgstr "<placeholder>डिफ़ॉल्ट</placeholder>" + +#: kdm-gen.cpp:85 +msgid "GUI s&tyle:" +msgstr "जीयूआई शैलीः (&t)" + +#: kdm-gen.cpp:87 +msgid "You can choose a basic GUI style here that will be used by KDM only." +msgstr "" +"आप यहाँ मूल जीयूआई शैली चुन सकते हैं जो सिर्फ केडीएम द्वारा ही उपयोग में लिया जाएगा." + +#: kdm-gen.cpp:95 +msgid "Color sche&me:" +msgstr "रंग योजनाः (&m)" + +#: kdm-gen.cpp:97 +msgid "You can choose a basic Color Scheme here that will be used by KDM only." +msgstr "आप यहाँ मूल रंग योजना चुन सकते हैं जो सिर्फ केडीएम द्वारा ही उपयोग में लिया जाएगा." + +#: kdm-gen.cpp:100 +msgctxt "@title:group" +msgid "Fonts" +msgstr "फ़ॉन्ट" + +#: kdm-gen.cpp:107 +msgid "" +"This changes the font which is used for all the text in the login manager " +"except for the greeting and failure messages." +msgstr "" +"अभिवादन तथा असफल संदेशों को छोड़कर लॉगइन प्रबंधक के अन्य सभी पाठ में उपयोग में आने वाला " +"फ़ॉन्ट इससे बदल जाएगा." + +#: kdm-gen.cpp:110 +msgctxt "... font" +msgid "&General:" +msgstr "सामान्यः (&G)" + +#: kdm-gen.cpp:114 +msgid "" +"This changes the font which is used for failure messages in the login " +"manager." +msgstr "लॉगइन प्रबंधक के असफल संदेशों में उपयोग में आने वाला फ़ॉन्ट इससे बदल जाएगा" + +#: kdm-gen.cpp:116 +msgctxt "font for ..." +msgid "&Failure:" +msgstr "असफल: (&F)" + +#: kdm-gen.cpp:120 +msgid "This changes the font which is used for the login manager's greeting." +msgstr "लॉगइन प्रबंधक के अभिवादन में उपयोग में आने वाला फ़ॉन्ट इससे बदल जाएगा." + +#: kdm-gen.cpp:122 +msgctxt "font for ..." +msgid "Gree&ting:" +msgstr "अभिवादनः (&t)" + +#: kdm-gen.cpp:124 +msgid "Use anti-aliasing for fonts" +msgstr "फ़ॉन्ट के लिए एंटी-अलियासिंग इस्तेमाल करें" + +#: kdm-gen.cpp:126 +msgid "" +"If you check this box and your X-Server has the Xft extension, fonts will be " +"antialiased (smoothed) in the login dialog." +msgstr "" +"यदि आप इस बक्से को चेक करते हैं और आपके एक्स-सर्वर में Xft एक्सटेंशन है, फ़ॉन्ट लॉगइन संवाद में " +"एंटिएलियास्ड (चिकने) हो जाएंगे. " + +#: kdm-shut.cpp:45 +msgid "Allow Shutdown" +msgstr "कम्पयूटर बन्द करना स्वीकारें" + +#: kdm-shut.cpp:49 +msgctxt "shutdown request origin" +msgid "&Local:" +msgstr "स्थानीयः (&L)" + +#: kdm-shut.cpp:51 kdm-shut.cpp:59 +msgctxt "@item:inlistbox allow shutdown" +msgid "Everybody" +msgstr "सभी" + +#: kdm-shut.cpp:52 kdm-shut.cpp:60 +msgctxt "@item:inlistbox allow shutdown" +msgid "Only Root" +msgstr "सिर्फ रूट" + +#: kdm-shut.cpp:53 kdm-shut.cpp:61 +msgctxt "@item:inlistbox allow shutdown" +msgid "Nobody" +msgstr "किसी को नहीं" + +#: kdm-shut.cpp:57 +msgctxt "shutdown request origin" +msgid "&Remote:" +msgstr "रिमोटः (&R)" + +#: kdm-shut.cpp:64 +msgid "" +"Here you can select who is allowed to shutdown the computer using KDM. You " +"can specify different values for local (console) and remote displays. " +"Possible values are:<ul> <li><em>Everybody:</em> everybody can shutdown the " +"computer using KDM</li> <li><em>Only root:</em> KDM will only allow shutdown " +"after the user has entered the root password</li> <li><em>Nobody:</em> " +"nobody can shutdown the computer using KDM</li></ul>" +msgstr "" +"यहाँ आप चुन सकते हैं कि केडीएम के उपयोग से कम्प्यूटर बन्द करने के लिए कौन अधिकृत होगा. आप " +"स्थानीय (कंसोल) तथा रिमोट प्रदर्शक के लिए भिन्न मान उल्लेखित कर सकते हैं. संभावित मूल्य हैं:" +"<ul> <li><em>हरकोई:</em> केडीएम के उपयोग से हरकोई कम्पयूटर बन्द कर सकेगा</li> " +"<li><em>सिर्फ रूट:</em> केडीएम तभी कम्प्यूटर बन्द करना स्वीकारेगा जब उपयोक्ता रूट " +"पासवर्ड भरेगा</li> <li><em>कोई नहीं:</em> केडीएम की मदद से कोई भी कम्प्यूटर को बन्द " +"नहीं कर सकेगा</li></ul>" + +#: kdm-shut.cpp:74 +msgctxt "@title:group shell commands for shutdown" +msgid "Commands" +msgstr "कमांड्स" + +#: kdm-shut.cpp:77 +msgctxt "command for ..." +msgid "H&alt:" +msgstr "हाल्ट:(&a)" + +#: kdm-shut.cpp:81 +msgid "Command to initiate the system halt. Typical value: /sbin/halt" +msgstr "तंत्र हाल्ट करना प्रारंभ करने के लिए कमांड. विशिष्ट मूल्य: /sbin/halt" + +#: kdm-shut.cpp:86 +msgctxt "command for ..." +msgid "Reb&oot:" +msgstr "रीबूटः (&o)" + +#: kdm-shut.cpp:90 +msgid "Command to initiate the system reboot. Typical value: /sbin/reboot" +msgstr "तंत्र हाल्ट करना प्रारंभ करने के लिए कमांड. विशिष्ट मूल्य: /sbin/reboot" + +#: kdm-shut.cpp:98 +msgctxt "boot manager" +msgid "None" +msgstr "कुछ नहीं" + +#: kdm-shut.cpp:99 +msgid "Grub" +msgstr "ग्रब" + +#: kdm-shut.cpp:100 +#, fuzzy +#| msgid "Grub" +msgid "Grub2" +msgstr "ग्रब" + +#: kdm-shut.cpp:101 +msgid "Burg" +msgstr "" + +#: kdm-shut.cpp:103 +msgid "Lilo" +msgstr "लिलो" + +#: kdm-shut.cpp:105 +msgid "Boot manager:" +msgstr "बूट प्रबंधक" + +#: kdm-shut.cpp:108 +msgid "Enable boot options in the \"Shutdown...\" dialog." +msgstr " \"बंद करें...\" संवाद में बूट विकल्प दिखाएँ." + +#: kdm-theme.cpp:98 +msgctxt "@title:column" +msgid "Theme" +msgstr "प्रसंग" + +#: kdm-theme.cpp:99 +msgctxt "@title:column" +msgid "Author" +msgstr "लेखक" + +#: kdm-theme.cpp:103 +msgid "" +"This is a list of installed themes.\n" +"Click the one to be used." +msgstr "" +"यह संस्थापित थीम की सूची है.\n" +"जिसे प्रयोग करना है उस पर क्लिक करें." + +#: kdm-theme.cpp:111 +msgid "This is a screen shot of what KDM will look like." +msgstr "यह केडीएम का स्क्रीन शॉट है कि वो कैसा दिखाई देगा." + +#: kdm-theme.cpp:119 +msgid "This contains information about the selected theme." +msgstr "इसमें चयनित प्रसंग के बारे में जानकारी है." + +#: kdm-theme.cpp:123 +msgctxt "@action:button" +msgid "Install &new theme" +msgstr "नया प्रसंग संस्थापित करें (&n)" + +#: kdm-theme.cpp:124 +msgid "This will install a theme into the theme directory." +msgstr "प्रसंग डिरेक्ट्री में यह नया प्रसंग संस्थापित करेगा." + +#: kdm-theme.cpp:128 +msgctxt "@action:button" +msgid "&Remove theme" +msgstr "प्रसंग हटाएँ (&R)" + +#: kdm-theme.cpp:129 +msgid "This will remove the selected theme." +msgstr "यह चयनित प्रसंग को मिटाएगा." + +#: kdm-theme.cpp:133 +msgctxt "@action:button" +msgid "&Get New Themes" +msgstr "नए प्रसंग प्राप्त करें (&G)" + +#: kdm-theme.cpp:216 +#, kde-format +msgid "<qt><strong>Copyright:</strong> %1<br/></qt>" +msgstr "<qt><strong>सर्वाधिकार:</strong> %1<br/></qt>" + +#: kdm-theme.cpp:219 +#, kde-format +msgid "<qt><strong>Description:</strong> %1</qt>" +msgstr "<qt><strong>वर्णन:</strong> %1</qt>" + +#: kdm-theme.cpp:236 kdm-users.cpp:339 +#, kde-format +msgid "Unable to create folder %1" +msgstr "फ़ोल्डर %1 बनाने में अक्षम." + +#: kdm-theme.cpp:244 +msgid "Drag or Type Theme URL" +msgstr "प्रसंग यूआरएल खींचलाएँ या टाइप करें" + +#: kdm-theme.cpp:263 +#, kde-format +msgid "Unable to find the KDM theme archive %1." +msgstr "केडीएम प्रसंग अभिलेखागार %1 ढूंढ पाने में असफल." + +#: kdm-theme.cpp:265 +#, kde-format +msgid "" +"Unable to download the KDM theme archive;\n" +"please check that address %1 is correct." +msgstr "" +"केडीएम प्रसंग अभिलेखागार को डाउनलोड करने में अक्षम;\n" +"कृपया जाँचें कि पता %1 सही है." + +#: kdm-theme.cpp:288 +msgid "The file is not a valid KDM theme archive." +msgstr "फ़ाइल वैध केडीएम प्रसंग अभिलेखागार नहीं है." + +#: kdm-theme.cpp:291 +msgctxt "@title:window" +msgid "Installing KDM themes" +msgstr "केडीएम प्रसंग संस्थापित किया जा रहा है" + +#: kdm-theme.cpp:303 +#, fuzzy, kde-format +#| msgctxt "@info:progress" +#| msgid "<qt>Installing <strong>%1</strong> theme</qt>" +msgctxt "@info:progress" +msgid "<qt>Unpacking <strong>%1</strong> theme</qt>" +msgstr "<qt>संस्थापित किया जा रहा है <strong>%1</strong> प्रसंग</qt>" + +#: kdm-theme.cpp:315 +msgctxt "@info:progress" +msgid "<qt>Installing the themes</qt>" +msgstr "<qt>प्रसंग संस्थापित किया जा रहा है </qt>" + +#: kdm-theme.cpp:324 +msgid "There were errors while installing the following themes:\n" +msgstr "" + +#: kdm-theme.cpp:363 +msgid "Are you sure you want to remove the following themes?" +msgstr "क्या आप सुनिश्चित हैं कि आप निम्न प्रसंग को मिटाना चाहते हैं?" + +#: kdm-theme.cpp:364 +msgctxt "@title:window" +msgid "Remove themes?" +msgstr "प्रसंग मिटाएँ?" + +#: kdm-theme.cpp:377 +msgid "There were errors while deleting the following themes:\n" +msgstr "निम्न प्रसंग को मिटाने में त्रुटि हुई:\n" + +#: kdm-users.cpp:111 +msgid "" +"User 'nobody' does not exist. Displaying user images will not work in KDM." +msgstr "" +"उपयोक्ता 'nobody' मौजूद नहीं है. केडीएम में उपयोक्ता छवियों को प्रदर्शित करना काम नहीं " +"करेगा." + +#: kdm-users.cpp:117 +msgctxt "@title:group UIDs belonging to system users like 'cron'" +msgid "System U&IDs" +msgstr "तंत्र यूआईडी (&I)" + +#: kdm-users.cpp:119 +msgid "" +"Users with a UID (numerical user identification) outside this range will not " +"be listed by KDM and this setup dialog. Note that users with the UID 0 " +"(typically root) are not affected by this and must be explicitly excluded in " +"\"Inverse selection\" mode." +msgstr "" +"उपयोक्ता यदि इस रेंज से बाहर यूआईडी (न्यूमेरिकल यूज़र आइडेंटिफिकेशन) युक्त होगा तो केडीएम " +"और इसके सेटअप संवाद में सूचीबद्ध नहीं होगा. टीप लें कि यूआईडी 0 वाले उपयोक्ता (विशिष्टतया " +"रूट) इससे प्रभावित नहीं होते हैं तथा साफ-साफ अलग होने ही चाहिएँ \"उलटे चयन\" मोड में." + +#: kdm-users.cpp:125 +msgctxt "UIDs" +msgid "Below:" +msgstr "नीचेः" + +#: kdm-users.cpp:132 +msgctxt "UIDs" +msgid "Above:" +msgstr "ऊपरः" + +#: kdm-users.cpp:145 +msgctxt "@title:group" +msgid "Users" +msgstr "उपयोक्ता" + +#: kdm-users.cpp:146 +msgctxt "... of users" +msgid "Show list" +msgstr "सूची दिखाएँ" + +#: kdm-users.cpp:148 +msgid "" +"If this option is checked, KDM will show a list of users, so users can click " +"on their name or image rather than typing in their login." +msgstr "" +"यदि यह विकल्प चुना जाता है, केडीएम उपयोक्ता की सूची दिखाएगा, जिससे उपयोक्ता अपने नाम " +"या छवि पर क्लिक कर लॉगइन कर सकते हैं, बजाए अपना लॉगइन टाइप करके." + +#: kdm-users.cpp:150 +msgctxt "user ..." +msgid "Autocompletion" +msgstr "स्वतःपूर्ण करें" + +#: kdm-users.cpp:152 +msgid "" +"If this option is checked, KDM will automatically complete user names while " +"they are typed in the line edit." +msgstr "" +"यदि यह विकल्प चुना जाता है, केडीएम स्वचालित रूप से उपयोक्ता नामों को पूरा करेगा जब वे " +"पंक्ति में टाइप किए जा रहे होंगे." + +#: kdm-users.cpp:155 +msgctxt "@option:check mode of the user selection" +msgid "Inverse selection" +msgstr "चयन पलटें" + +#: kdm-users.cpp:157 +msgid "" +"This option specifies how the users for \"Show list\" and \"Autocompletion\" " +"are selected in the \"Select users and groups\" list: If not checked, select " +"only the checked users. If checked, select all non-system users, except the " +"checked ones." +msgstr "" + +#: kdm-users.cpp:161 +msgid "Sor&t users" +msgstr "उपयोक्ता क्रमबद्ध करें (&t)" + +#: kdm-users.cpp:163 +msgid "" +"If this is checked, KDM will alphabetically sort the user list. Otherwise " +"users are listed in the order they appear in the password file." +msgstr "" +"यदि यह विकल्प चुना जाता है, केडीएम उपयोक्ताओं की सूची को वर्णमाला क्रम में क्रमबद्ध करेगा. " +"अन्यथा उपयोक्ता जैसा कि पासवर्ड फ़ाइल में सूचीबद्ध हैं, उस सूची अनुसार दिखेंगे." + +#: kdm-users.cpp:180 +msgid "S&elect users and groups:" +msgstr "उपयोक्ता समूह चुनें: (&e)" + +#: kdm-users.cpp:184 +msgid "Selected Users" +msgstr "चुने गए उपयोक्ता" + +#: kdm-users.cpp:186 +msgid "" +"KDM will show all checked users. Entries denoted with '@' are user groups. " +"Checking a group is like checking all users in that group." +msgstr "" +"केडीएम सभी चयनित उपयोक्ताओं को दिखाएगा. प्रविष्टियाँ जो कि '@' से चिह्नित हैं, वे " +"उपयोक्ता समूह हैं. किसी समूह को चेक करना वैसे ही है जैसे कि उस समूह के सभी उपयोक्ताओं को चेक " +"करना." + +#: kdm-users.cpp:195 +msgid "Excluded Users" +msgstr "अलग किए गए उपयोक्ता" + +#: kdm-users.cpp:197 +msgid "" +"KDM will show all non-checked non-system users. Entries denoted with '@' are " +"user groups. Checking a group is like checking all users in that group." +msgstr "" +"केडीएम सभी अ-चयनित नॉन-सिस्टम उपयोक्ताओं को दिखाएगा. प्रविष्टियाँ जो कि '@' से " +"चिह्नित हैं, वे उपयोक्ता समूह हैं. किसी समूह को चेक करना वैसे ही है जैसे कि उस समूह के सभी " +"उपयोक्ताओं को चेक करना." + +#: kdm-users.cpp:206 +msgctxt "@title:group source for user faces" +msgid "User Image Source" +msgstr "उपयोक्ता छवि स्रोत" + +#: kdm-users.cpp:208 +msgid "" +"Here you can specify where KDM will obtain the images that represent users. " +"\"System\" represents the global folder; these are the pictures you can set " +"below. \"User\" means that KDM should read the user's $HOME/.face.icon file. " +"The two selections in the middle define the order of preference if both " +"sources are available." +msgstr "" +"यहाँ आप उल्लेखित कर सकते हैं कि उपयोक्ताओं के प्रतिनिधित्व करती छवियों को केडीएम कहाँ से " +"प्राप्त करे. \"System\" वैश्विक फ़ोल्डर को दर्शाता है; ये नीचे दी गई तस्वीरें आप नियत कर " +"सकते हैं. \"User\" का अर्थ है कि केडीएम उपयोक्ता के $HOME/.face.icon फ़ाइल को पढ़ " +"सकता है. मध्य में दिए गए दो चयन प्राथमिकताओं के क्रम को पारिभाषित करते हैं, यदि दोनों " +"स्रोत उपलब्ध हैं." + +#: kdm-users.cpp:212 +msgctxt "@option:radio image source" +msgid "System" +msgstr "तंत्र" + +#: kdm-users.cpp:213 +msgctxt "@option:radio image source" +msgid "System, user" +msgstr "तंत्र, उपयोक्ता" + +#: kdm-users.cpp:214 +msgctxt "@option:radio image source" +msgid "User, system" +msgstr "उपयोक्ता, तंत्र" + +#: kdm-users.cpp:215 +msgctxt "@option:radio image source" +msgid "User" +msgstr "उपयोक्ता" + +#: kdm-users.cpp:230 +msgctxt "@title:group user face assignments" +msgid "User Images" +msgstr "उपयोक्ता छवियाँ" + +#: kdm-users.cpp:232 +msgid "The user the image below belongs to." +msgstr "निम्न छवि से यह उपयोक्ता संबंधित है-. " + +#: kdm-users.cpp:235 +msgid "User:" +msgstr "उपयोक्ता:" + +#: kdm-users.cpp:244 +msgid "Click or drop an image here" +msgstr "क्लिक करें या यहाँ कोई छवि डालें" + +#: kdm-users.cpp:246 +msgid "" +"Here you can see the image assigned to the user selected in the combo box " +"above. Click on the image button to select from a list of images or drag and " +"drop your own image on to the button (e.g. from Konqueror)." +msgstr "" +"यहाँ आप ऊपर कॉम्बो बक्से में चुने गए उपयोक्ता को आबंटित छवि को देख सकते हैं. छवियों की सूची " +"में से चुनने के लिए चित्र बटन पर क्लिक करें या आप कोई भी चित्र को बटन पर खींच और छोड़ कर " +"चित्र चयन कर सकते हैं (जैसे, कॉन्करर से)" + +#: kdm-users.cpp:250 +msgctxt "@action:button assign default user face" +msgid "R&eset" +msgstr "रीसेट करें (&e)" + +#: kdm-users.cpp:252 +msgid "" +"Click this button to make KDM use the default image for the selected user." +msgstr "" +"केडीएम चुने गए उपयोक्ताओं के लिए डिफ़ॉल्ट छवियों को उपयोग में ले इस के लिए इस बटन पर क्लिक " +"करें." + +#: kdm-users.cpp:351 +msgid "Save image as default?" +msgstr "छवि को डिफ़ॉल्ट छवि के रूप में सहेजें?" + +#: kdm-users.cpp:360 +#, kde-format +msgid "" +"There was an error while loading the image\n" +"%1" +msgstr "" +"छवि लोड करने में त्रुटि हुई\n" +"%1" + +#: kdm-users.cpp:379 +#, kde-format +msgid "" +"There was an error while saving the image:\n" +"%1" +msgstr "" +"छवि सहेजने में त्रुटि हुई:\n" +"%1" + +#: kdm-users.cpp:408 +#, kde-format +msgid "" +"There was an error while removing the image:\n" +"%1" +msgstr "" +"छवि हटाने करने में त्रुटि हुई:\n" +"%1" + +#: main.cpp:73 +#, kde-format +msgid "Unable to authenticate/execute the action: %1 (code %2)" +msgstr "" + +#: main.cpp:96 +#, kde-format +msgid "" +"%1 does not appear to be an image file.\n" +"Please use files with these extensions:\n" +"%2" +msgstr "" +"%1 छवि फ़ाइल जैसा प्रतीत नहीं होता है.\n" +"कृपया फ़ाइलें जो इन एक्सटेंशन के साथ हों का उपयोग करें:\n" +"%2" + +#: main.cpp:115 +msgid "KDE Login Manager Config Module" +msgstr "केडीई लॉगइन प्रबंधक कॉन्फ़िग मॉड्यूल" + +#: main.cpp:117 +msgid "(c) 1996-2010 The KDM Authors" +msgstr "(c) 1996-2010 केडीएम के लेखक गण" + +#: main.cpp:120 +msgid "Thomas Tanghus" +msgstr "थॉमस थानगस" + +#: main.cpp:120 +msgid "Original author" +msgstr "मूल लेखक" + +#: main.cpp:121 +msgid "Steffen Hansen" +msgstr "स्टीफन हानसेन" + +#: main.cpp:122 +msgid "Oswald Buddenhagen" +msgstr "ओसवाल्ड बडेनहैगन" + +#: main.cpp:122 +msgid "Current maintainer" +msgstr "वर्तमान मेंटेनर" + +#: main.cpp:123 +msgid "Stephen Leaf" +msgstr "स्टीफन लीफ" + +#: main.cpp:124 +msgid "Igor Krivenko" +msgstr "Igor Krivenko" + +#: main.cpp:127 +msgid "" +"<h1>Login Manager</h1> In this module you can configure the various aspects " +"of the KDE Login Manager. This includes the look and feel as well as the " +"users that can be selected for login. Note that you can only make changes if " +"you run the module with superuser rights.<h2>General</h2> On this tab page, " +"you can configure parts of the Login Manager's look, and which language it " +"should use. The language settings made here have no influence on the user's " +"language settings.<h2>Dialog</h2>Here you can configure the look of the " +"\"classical\" dialog based mode if you have chosen to use it. " +"<h2>Background</h2>If you want to set a special background for the dialog-" +"based login screen, this is where to do it.<h2>Themes</h2> Here you can " +"specify the theme to be used by the Login Manager.<h2>Shutdown</h2> Here you " +"can specify who is allowed to shutdown/reboot the machine and whether a boot " +"manager should be used.<h2>Users</h2>On this tab page, you can select which " +"users the Login Manager will offer you for logging in.<h2>Convenience</h2> " +"Here you can specify a user to be logged in automatically, users not needing " +"to provide a password to log in, and other convenience features.<br/>Note " +"that by their nature, these settings are security holes, so use them very " +"carefully." +msgstr "" + +#: main.cpp:212 +msgid "&General" +msgstr "सामान्य (&G)" + +#: main.cpp:218 +msgid "&Dialog" +msgstr "संवाद (&D)" + +#: main.cpp:223 +msgid "There is no login dialog window in themed mode." +msgstr "थीम्ड मोड में कोई लॉगइन संवाद विंडो नहीं है." + +#: main.cpp:229 +msgid "&Background" +msgstr "पृष्ठभूमि (&B)" + +#: main.cpp:234 +msgid "The background cannot be configured separately in themed mode." +msgstr "थीम्ड मोड में पृष्ठभूमि को अलग से कॉन्फ़िगर नहीं किया जा सकता." + +#: main.cpp:240 +msgid "&Theme" +msgstr "प्रसंग (&T)" + +#: main.cpp:242 +msgid "Themed mode is disabled. See \"General\" tab." +msgstr "थीम्ड मोड अक्षम है. देखें \"सामान्य\" टैब." + +#: main.cpp:251 +msgid "&Shutdown" +msgstr "बन्दकरें (&S)" + +#: main.cpp:255 +msgid "&Users" +msgstr "उपयोक्ता (&U)" + +#: main.cpp:265 +msgid "&Convenience" +msgstr "सुविधा (&C)" + +#: main.cpp:361 +#, kde-format +msgid "" +"Unable to install new kdmrc file from\n" +"%1" +msgstr "" + +#: main.cpp:366 +#, kde-format +msgid "" +"Unable to install new backgroundrc file from\n" +"%1" +msgstr "" + +#: main.cpp:371 +#, kde-format +msgid "" +"Unable to install new kdmrc file from\n" +"%1\n" +"and new backgroundrc file from\n" +"%2" +msgstr "" + +#: positioner.cpp:98 +msgid "" +"Drag the anchor to move the center of the dialog to the desired position. " +"Keyboard control is possible as well: Use the arrow keys or Home to center. " +"Note that the actual proportions of the dialog are probably different." +msgstr "" + +#~ msgid "&Use themed greeter" +#~ msgstr "प्रसंग युक्त ग्रीटर (स्वागतकर्ता) का प्रयोग करें (&U)" + +#~ msgid "Enable this if you would like to use a themed Login Manager." +#~ msgstr "इसे सक्षम करें यदि आप प्रसंग युक्त लॉगइन प्रबंधक इस्तेमाल करना चाहते हैं." diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kdmgreet.po kde-l10n-hi-4.13.0/messages/kde-workspace/kdmgreet.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kdmgreet.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kdmgreet.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,659 @@ +# translation of kdmgreet.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007. +# Ravishankar Shrivastava <raviratlami@aol.in>, 2008. +msgid "" +msgstr "" +"Project-Id-Version: kdmgreet\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2008-07-08 19:58+0530\n" +"Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" +"Language-Team: Hindi <Indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"X-Generator: KBabel 1.11.4\n" + +#: kchooser.cpp:59 +msgctxt "@action:inmenu" +msgid "&Local Login" +msgstr "स्थानीय लॉगइन (&L)" + +#: kchooser.cpp:63 +msgid "XDMCP Host Menu" +msgstr "एक्सडीएमसीपी होस्ट मेन्यू" + +#: kchooser.cpp:73 +msgctxt "@title:column" +msgid "Hostname" +msgstr "होस्टनाम" + +#: kchooser.cpp:74 +msgctxt "@title:column ... of named host" +msgid "Status" +msgstr "स्थिति" + +#: kchooser.cpp:82 +msgctxt "XDMCP server" +msgid "Hos&t:" +msgstr "होस्टः (&t)" + +#: kchooser.cpp:84 +msgctxt "@action:button" +msgid "A&dd" +msgstr "जोड़ें (&d)" + +#: kchooser.cpp:93 +msgctxt "@action:button" +msgid "&Accept" +msgstr "स्वीकारें (&A)" + +#: kchooser.cpp:95 +msgctxt "@action:button" +msgid "&Refresh" +msgstr "ताज़ा करें (&R)" + +#: kchooser.cpp:105 kgreeter.cpp:802 +msgctxt "@action:button" +msgid "&Menu" +msgstr "मेन्यू (&M)" + +#: kchooser.cpp:203 +msgctxt "hostname or status" +msgid "<unknown>" +msgstr "<अज्ञात>" + +#: kchooser.cpp:242 +#, kde-format +msgid "Unknown host %1" +msgstr "अज्ञात होस्ट %1" + +#: kconsole.cpp:70 +msgid "*** Cannot connect to console log ***" +msgstr "*** कंसोल लॉग खोल नहीं सकता***" + +#: kconsole.cpp:154 +msgid "" +"\n" +"*** Lost connection with console log ***" +msgstr "" +"\n" +"*** कंसोल लॉग से कनेक्शन टूटा ***" + +#: kdmconfig.cpp:131 +#, fuzzy +#| msgid "[fix kdmrc]" +msgctxt "" +"@item:intext substitution for an undefined %X placeholder wrongly given in " +"the config file 'kdmrc', telling the user to fix it" +msgid "[fix kdmrc]" +msgstr "[fix kdmrc]" + +#: kdmshutdown.cpp:90 +msgid "Root authorization required." +msgstr "रूट प्रमाणीकरण वांछित है." + +#: kdmshutdown.cpp:122 +msgctxt "@action:inmenu verb" +msgid "&Schedule..." +msgstr "कार्यक्रम...(&S)" + +#: kdmshutdown.cpp:264 +msgid "Shutdown Type" +msgstr "बंद करने का प्रकार" + +#: kdmshutdown.cpp:268 +msgid "&Turn off computer" +msgstr "कम्प्यूटर बन्द करें (&T)" + +#: kdmshutdown.cpp:272 +msgid "&Restart computer" +msgstr "कम्प्यूटर फिर से प्रारंभ करें (&R)" + +#: kdmshutdown.cpp:298 +msgctxt "@title:group ... of shutdown" +msgid "Scheduling" +msgstr "समय-सारणी" + +#: kdmshutdown.cpp:302 +msgid "&Start:" +msgstr "प्रारंभः (&S)" + +#: kdmshutdown.cpp:306 +msgid "T&imeout:" +msgstr "टाइमआउटः (&i)" + +#: kdmshutdown.cpp:309 +msgid "&Force after timeout" +msgstr "टाइमआउट के बाद बलपूर्वक (&F)" + +#: kdmshutdown.cpp:357 +msgid "Entered start date is invalid." +msgstr "जो प्रारंभ तिथि भरी गई है वह अवैध है." + +#: kdmshutdown.cpp:366 +msgid "Entered timeout date is invalid." +msgstr "जो टाइमआउट तिथि भरी गई है वह अवैध है." + +#: kdmshutdown.cpp:480 +msgid "&Turn Off Computer" +msgstr "कम्प्यूटर बन्द करें (&T)" + +#: kdmshutdown.cpp:487 +msgid "&Restart Computer" +msgstr "कम्प्यूटर पुनः प्रारंभ करें (&R)" + +#: kdmshutdown.cpp:497 +#, kde-format +msgctxt "current option in boot loader" +msgid "%1 (current)" +msgstr "%1 (वर्तमान)" + +#: kdmshutdown.cpp:508 +msgctxt "@action:button verb" +msgid "&Schedule..." +msgstr "कार्यक्रम...(&S)" + +#: kdmshutdown.cpp:587 +msgid "" +"<br/>Switching to console mode will terminate all local X servers and leave " +"you with console logins only. Graphical mode is automatically resumed 10 " +"seconds after the last console session ends or after 40 seconds if no-one " +"logs in in the first place.<br/>" +msgstr "" + +#: kdmshutdown.cpp:608 +msgid "Turn Off Computer" +msgstr "कम्प्यूटर बन्द करें" + +#: kdmshutdown.cpp:611 +msgid "Switch to Console" +msgstr "कंसोल में स्विच करें" + +#: kdmshutdown.cpp:613 +msgid "Restart Computer" +msgstr "कम्प्यूटर फिर से चालू करें " + +#: kdmshutdown.cpp:615 +#, kde-format +msgid "<br/>(Next boot: %1)" +msgstr "<br/>(अगला बूट: %1)" + +#: kdmshutdown.cpp:633 +msgid "Abort active sessions:" +msgstr "सक्रिय सत्र छोड़ें:" + +#: kdmshutdown.cpp:634 +msgid "No permission to abort active sessions:" +msgstr "सक्रिय सत्रों को छोड़ने हेतु कोई अनुमतियाँ नहीं:" + +#: kdmshutdown.cpp:645 +msgctxt "@title:column" +msgid "Session" +msgstr "सत्र" + +#: kdmshutdown.cpp:646 +msgctxt "@title:column ... of session" +msgid "Location" +msgstr "स्थान" + +#: kdmshutdown.cpp:688 +#, fuzzy +#| msgid "Abort pending shutdown:" +msgid "Cancel pending shutdown:" +msgstr "बंद करने की लंबित क्रिया को छोड़ें:" + +#: kdmshutdown.cpp:689 +#, fuzzy +#| msgid "No permission to abort pending shutdown:" +msgid "No permission to cancel pending shutdown:" +msgstr "बंद करने की लंबित क्रिया को छोडने हेतु कोई अनुमतियाँ नहीं:" + +#: kdmshutdown.cpp:695 +msgctxt "start of shutdown:" +msgid "now" +msgstr "अभी" + +#: kdmshutdown.cpp:701 +msgctxt "timeout of shutdown:" +msgid "infinite" +msgstr "असीमित" + +#: kdmshutdown.cpp:707 +#, kde-format +msgid "" +"Owner: %1\n" +"Type: %2%5\n" +"Start: %3\n" +"Timeout: %4" +msgstr "" +"मालिक: %1\n" +"क़िस्म: %2%5\n" +"प्रारंभt: %3\n" +"टाइमआउटt: %4" + +#: kdmshutdown.cpp:712 +msgctxt "owner of shutdown:" +msgid "console user" +msgstr "कंसोल उपयोक्ता" + +#: kdmshutdown.cpp:714 +msgctxt "owner of shutdown:" +msgid "control socket" +msgstr "नियंत्रण सॉकेट" + +#: kdmshutdown.cpp:717 +msgid "turn off computer" +msgstr "कम्प्यूटर बन्द करें" + +#: kdmshutdown.cpp:718 +msgid "restart computer" +msgstr "कम्प्यूटर पुनः प्रारंभ करें" + +#: kdmshutdown.cpp:721 +#, kde-format +msgid "" +"\n" +"Next boot: %1" +msgstr "" +"\n" +"अगला बूट: %1" + +#: kdmshutdown.cpp:724 +#, kde-format +msgid "" +"\n" +"After timeout: %1" +msgstr "" +"\n" +"टाइमआउट के बाद: %1" + +#: kdmshutdown.cpp:726 +msgctxt "after timeout:" +msgid "abort all sessions" +msgstr "सभी सत्रों को छोड़ें" + +#: kdmshutdown.cpp:728 +msgctxt "after timeout:" +msgid "abort own sessions" +msgstr "अपने सत्र छोड़ें" + +#: kdmshutdown.cpp:729 +msgctxt "after timeout:" +msgid "cancel shutdown" +msgstr "बन्द करना रद्द करें" + +#: kgdialog.cpp:57 +msgid "Sw&itch User" +msgstr "उपयोक्ता बदलें (&i)" + +#: kgdialog.cpp:72 +#, fuzzy +#| msgctxt "@title:column" +#| msgid "Session" +msgid "Canc&el Session" +msgstr "सत्र" + +#: kgdialog.cpp:73 +msgid "R&estart X Server" +msgstr "एक्स-सर्वर फिर से चालू करें (&e)" + +#: kgdialog.cpp:74 +msgid "Clos&e Connection" +msgstr "कनेक्शन बन्द करें (&e)" + +#: kgdialog.cpp:85 +msgid "Co&nsole Login" +msgstr "कंसोल लॉगइन (&n)" + +#: kgdialog.cpp:88 +msgid "&Shutdown..." +msgstr "बन्दकरें... (&S)" + +#: kgdialog.cpp:228 +#, kde-format +msgctxt "session (location)" +msgid "%1 (%2)" +msgstr "%1 (%2)" + +#: kgreeter.cpp:482 +msgctxt "@item:inlistbox session type" +msgid "Default" +msgstr "डिफ़ॉल्ट" + +#: kgreeter.cpp:483 +msgctxt "@item:inlistbox session type" +msgid "Custom" +msgstr "मनपसंद" + +#: kgreeter.cpp:484 +msgctxt "@item:inlistbox session type" +msgid "Failsafe" +msgstr "फेलसेफ" + +#: kgreeter.cpp:560 +#, fuzzy, kde-format +#| msgctxt "appended to session type" +#| msgid " (previous)" +msgctxt "@item:inmenu session type" +msgid "%1 (previous)" +msgstr "(पिछला)" + +#: kgreeter.cpp:622 +#, kde-format +msgid "" +"Your saved session type '%1' is not valid any more.\n" +"Please select a new one, otherwise 'default' will be used." +msgstr "" +"आपका रहेजा सत्र प्रकार '%1' अब वैध नहीं रहा.\n" +"कृपया कोई नया चुनें, अन्यथा 'डिफ़ॉल्ट' उपयोग में लिया जाएगा." + +#: kgreeter.cpp:745 +msgid "Warning: this is an unsecured session" +msgstr "चेतावनी: यह असुरक्षित तंत्र है" + +#: kgreeter.cpp:747 +msgid "" +"This display requires no X authorization.\n" +"This means that anybody can connect to it,\n" +"open windows on it or intercept your input." +msgstr "" +"इस प्रदर्शक को एक्स-ऑथोराइज़ेशन की आवश्यकता नहीं है.\n" +"इसका अर्थ है कि कोई भी इससे जुड़ सकता है,\n" +"इस पर विंडोज़ खोलें या अपने इनपुट को देखें." + +#: kgreeter.cpp:799 +msgctxt "@action:button" +msgid "L&ogin" +msgstr "लॉगइन (&o)" + +#: kgreeter.cpp:833 kgreeter.cpp:970 +msgctxt "@title:menu" +msgid "Session &Type" +msgstr "सत्र प्रकार (&T)" + +#: kgreeter.cpp:838 kgreeter.cpp:976 +msgctxt "@title:menu" +msgid "&Authentication Method" +msgstr "प्रमाणीकरण विधि (&A)" + +#: kgreeter.cpp:843 kgreeter.cpp:981 +msgctxt "@action:inmenu" +msgid "&Remote Login" +msgstr "रिमोट लॉगइन (&R)" + +#: kgreeter.cpp:921 kgverify.cpp:1085 +msgid "Login failed" +msgstr "लॉगइन असफल" + +#: kgverify.cpp:187 +msgid "No greeter widget plugin loaded. Check the configuration." +msgstr "कोई ग्रीटर विज़ेट प्लगइन लोड नहीं है. कॉन्फ़िगरेशन जाँचें." + +#: kgverify.cpp:496 +#, kde-format +msgid "" +"Logging in %1...\n" +"\n" +msgstr "" +" %1 में लॉग किया जा रहा है...\n" +"\n" + +#: kgverify.cpp:500 +msgid "You are required to change your password immediately (password aged)." +msgstr "" +"आपको अपना पासवर्ड आवश्यक रूप से तत्काल बदलना होगा (पासवर्ड कालबाधित हो चुका है)." + +#: kgverify.cpp:501 +msgid "You are required to change your password immediately (root enforced)." +msgstr "आपको अपना पासवर्ड आवश्यक रूप से तत्काल बदलना होगा (रूट द्वारा बाध्य)" + +#: kgverify.cpp:502 +msgid "You are not allowed to login at the moment." +msgstr "आप इस समय लॉगइन के लिए स्वीकार्य नहीं हैं." + +#: kgverify.cpp:503 +msgid "Home folder not available." +msgstr "होम फ़ोल्डर उपलब्ध नहीं" + +#: kgverify.cpp:504 +msgid "" +"Logins are not allowed at the moment.\n" +"Try again later." +msgstr "" +"आप इस समय लॉगइन के लिए स्वीकार्य नहीं हैं.\n" +" बाद में फिर से कोशिश करें" + +#: kgverify.cpp:505 +msgid "Your login shell is not listed in /etc/shells." +msgstr "आपका लॉगइन शेल /etc/shells में सूचीबद्ध नहीं है." + +#: kgverify.cpp:506 +msgid "Root logins are not allowed." +msgstr "रूट लॉगइन स्वीकार्य नहीं हैं." + +#: kgverify.cpp:507 +msgid "Your account has expired; please contact your system administrator." +msgstr "आपका खाते की अवधि खत्म हो गई है, कृपया अपने तंत्र प्रशासक से संपर्क करें" + +#: kgverify.cpp:517 +msgid "" +"A critical error occurred.\n" +"Please look at KDM's logfile(s) for more information\n" +"or contact your system administrator." +msgstr "" +"एक गंभीर त्रुटि हुई.\n" +"अधिक जानकारी के लिए कृपया केडीएम की लॉग फ़ाइल देखें\n" +"या अपने तंत्र प्रशासक से संपर्क करें." + +#: kgverify.cpp:542 +#, kde-format +msgid "Your account expires tomorrow." +msgid_plural "Your account expires in %1 days." +msgstr[0] "आपके खाते की अवधि कल बीत रही है." +msgstr[1] "आपके खाते की अवधि %1 दिनों में खत्म हो रही है." + +#: kgverify.cpp:544 +msgid "Your account expires today." +msgstr "आपके खाते की अवधि आज बीत रही है." + +#: kgverify.cpp:550 +#, kde-format +msgid "Your password expires tomorrow." +msgid_plural "Your password expires in %1 days." +msgstr[0] "आपके खाते की अवधि कल खत्म हो रही है." +msgstr[1] "आपके खाते की अवधि %1 दिनों में खत्म हो रही है." + +#: kgverify.cpp:552 +msgid "Your password expires today." +msgstr "आपका पासवर्ड आज ख़त्म हो रहा है." + +#: kgverify.cpp:626 kgverify.cpp:1086 +msgid "Authentication failed" +msgstr "प्रमाणीकरण असफल" + +#: kgverify.cpp:776 +#, kde-format +msgid "Authenticated user (%1) does not match requested user (%2).\n" +msgstr "प्रामाणिक उपयोक्ता (%1) निवेदित उपयोक्ता (%2) से मेल नहीं खाता.\n" + +#: kgverify.cpp:1067 +#, kde-format +msgid "Automatic login in 1 second..." +msgid_plural "Automatic login in %1 seconds..." +msgstr[0] "१ सेकण्ड में स्वचालित लॉगिन हो रहे हैं..." +msgstr[1] "%1 सेकण्डों में स्वचालित लॉगइन हो रहे हैं..." + +#: kgverify.cpp:1079 +msgid "Warning: Caps Lock is on" +msgstr "चेतावनी: कैप्स लॉक चालू है" + +#: kgverify.cpp:1083 +msgid "Change failed" +msgstr "परिवर्तन असफल" + +#: kgverify.cpp:1136 +#, kde-format +msgid "Theme not usable with authentication method '%1'." +msgstr "प्रमाणीकरण विधि '%1' से प्रसंग उपयोग में नहीं लिया जा सकता." + +#: kgverify.cpp:1173 +msgctxt "@title:window" +msgid "<qt><b>Changing authentication token</b></qt>" +msgstr "<qt><b>प्रमाणीकरण टोकन बदला जा रहा है</b></qt>" + +#: krootimage.cpp:330 +msgid "KRootImage" +msgstr "के_रूट_इमेज" + +#: krootimage.cpp:331 +msgid "Fancy desktop background for kdm" +msgstr "केडीएम के लिए सुंदर डेस्कटॉप बैकग्राउण्ड" + +#: krootimage.cpp:334 +msgid "Name of the configuration file" +msgstr "कॉन्फ़िगरेशन फ़ाइल का नाम" + +#: themer/kdmlabel.cpp:247 +msgctxt "@action:button" +msgid "Lan_guage" +msgstr "_भाषा" + +#: themer/kdmlabel.cpp:248 +msgctxt "@action:button" +msgid "Session _Type" +msgstr "सत्र_क़िस्म" + +#: themer/kdmlabel.cpp:249 +msgctxt "@action:button" +msgid "_Menu" +msgstr "_मेन्यू" + +#. i18n("Actions"); +#: themer/kdmlabel.cpp:250 +msgctxt "@action:button ... from XDMCP server" +msgid "Disconn_ect" +msgstr "_डिस्कनेक्ट" + +#: themer/kdmlabel.cpp:251 +msgctxt "@action:button" +msgid "_Quit" +msgstr "_बाहर" + +#: themer/kdmlabel.cpp:252 +msgctxt "@action:button" +msgid "Power o_ff" +msgstr "पावर _बंद" + +#: themer/kdmlabel.cpp:254 +msgctxt "@action:button" +msgid "Re_boot" +msgstr "फिर_से चालू" + +#: themer/kdmlabel.cpp:255 +msgctxt "@action:button" +msgid "_Remote login" +msgstr "_रिमोट लॉगइन" + +#: themer/kdmlabel.cpp:256 +#, fuzzy +#| msgid "Caps Lock is enabled" +msgid "Caps Lock is enabled" +msgstr "कैप्स लॉक सक्षम है" + +#: themer/kdmlabel.cpp:257 +#, fuzzy +#| msgid "User %u will log in in %t" +msgid "User %u will log in in %t" +msgstr "उपयोक्ता %u, %t सेकेण्ड में लॉगइन हो रहे हैं" + +#: themer/kdmlabel.cpp:258 +#, fuzzy +#| msgid "Welcome to %h" +msgid "Welcome to %h" +msgstr "%h में आपका स्वागत है" + +#: themer/kdmlabel.cpp:259 +#, fuzzy +#| msgid "_Domain:" +msgid "_Domain:" +msgstr "_डोमेन:" + +#: themer/kdmlabel.cpp:260 +#, fuzzy +#| msgid "_Username:" +msgid "_Username:" +msgstr "_उपयोक्ता नाम:" + +#: themer/kdmlabel.cpp:261 +#, fuzzy +#| msgid "_Password:" +msgid "_Password:" +msgstr "_पासवर्ड:" + +#: themer/kdmlabel.cpp:262 +msgctxt "@action:button" +msgid "_Login" +msgstr "_लॉगइन" + +#: themer/kdmlabel.cpp:293 +#, kde-format +msgctxt "will login in ..." +msgid "1 second" +msgid_plural "%1 seconds" +msgstr[0] "1 सेकण़्ड" +msgstr[1] "%1 सेकण्ड" + +#: themer/kdmlabel.cpp:301 +#, no-c-format +msgctxt "date format" +msgid "%a %d %B" +msgstr "%a %d %B" + +#: themer/kdmthemer.cpp:67 +#, kde-format +msgid "Cannot open theme file %1" +msgstr "प्रसंग फ़ाइल %1 को खोल नहीं सका" + +#: themer/kdmthemer.cpp:72 +#, kde-format +msgid "Cannot parse theme file %1" +msgstr "प्रसंग फ़ाइल %1 को समझ नहीं सका" + +#: themer/kdmthemer.cpp:79 +#, kde-format +msgid "%1 does not seem to be a correct theme file" +msgstr "प्रतीत होता है कि फ़ाइल %1 सही प्रसंग फ़ाइल नहीं है" + +#: utils.cpp:87 +#, kde-format +msgctxt "user: ..." +msgid "%2: TTY login" +msgid_plural "%2: %1 TTY logins" +msgstr[0] "%2: टीटीवाई लॉगइन" +msgstr[1] "%2: %1 टीटीवाई लॉगइन" + +#: utils.cpp:99 +msgctxt "... session" +msgid "Unused" +msgstr "उपयोग में नहीं" + +#: utils.cpp:101 +#, kde-format +msgctxt "user: session type" +msgid "%1: %2" +msgstr "%1: %2" + +#: utils.cpp:103 +#, kde-format +msgctxt "... host" +msgid "X login on %1" +msgstr "एक्स %1 पर लॉगइन हो रहे हैं" + +#~ msgid "Abort S&ession" +#~ msgstr "सत्र छोड़ें (&e)" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kfontinst.po kde-l10n-hi-4.13.0/messages/kde-workspace/kfontinst.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kfontinst.po 2014-03-19 06:15:59.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kfontinst.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kfontinst\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-19 04:21+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2007-09-05 19:08+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -66,7 +66,7 @@ msgid "Print" msgstr "छापें..." -#: apps/Printer.cpp:408 kcmfontinst/DuplicatesDialog.cpp:247 +#: apps/Printer.cpp:408 kcmfontinst/DuplicatesDialog.cpp:250 #, fuzzy #| msgid "Cancel" msgid "Canceling..." @@ -99,45 +99,45 @@ msgid "Remove file containing list of fonts to print" msgstr "" -#: apps/Viewer.cpp:79 +#: apps/Viewer.cpp:77 msgid "Select Font to View" msgstr "देखने के लिए फ़ॉन्ट चुनें" -#: apps/Viewer.cpp:148 +#: apps/Viewer.cpp:146 msgid "Font Viewer" msgstr "फ़ॉन्ट प्रदर्शक" -#: apps/Viewer.cpp:148 +#: apps/Viewer.cpp:146 msgid "Simple font viewer" msgstr "सादा फ़ॉन्ट प्रदर्शक" -#: apps/Viewer.cpp:149 +#: apps/Viewer.cpp:147 msgid "(C) Craig Drummond, 2004-2007" msgstr "(c) क्रेग ड्रमांड, 2004-2007" -#: apps/Viewer.cpp:157 +#: apps/Viewer.cpp:155 msgid "URL to open" msgstr "खोलने के लिए यूआरएल" -#: kcmfontinst/DuplicatesDialog.cpp:73 +#: kcmfontinst/DuplicatesDialog.cpp:76 #, fuzzy msgid "Duplicate Fonts" msgstr "फ़ाइलें मिटाएँ" -#: kcmfontinst/DuplicatesDialog.cpp:98 +#: kcmfontinst/DuplicatesDialog.cpp:101 #, fuzzy msgid "Scanning for duplicate fonts. Please wait..." msgstr "साफ करने में. कृपया इंतजार करें..." -#: kcmfontinst/DuplicatesDialog.cpp:121 +#: kcmfontinst/DuplicatesDialog.cpp:124 msgid "No duplicate fonts found." msgstr "कोई दोहरे फ़ॉन्ट नहीं मिले." -#: kcmfontinst/DuplicatesDialog.cpp:128 +#: kcmfontinst/DuplicatesDialog.cpp:131 msgid "Delete Marked Files" msgstr "" -#: kcmfontinst/DuplicatesDialog.cpp:130 +#: kcmfontinst/DuplicatesDialog.cpp:133 #, fuzzy, kde-format #| msgid "%1 duplicate fonts found." msgid "%1 duplicate font found." @@ -145,7 +145,7 @@ msgstr[0] "%1 दोहरे फ़ॉन्ट मिले" msgstr[1] "%1 दोहरे फ़ॉन्ट मिले" -#: kcmfontinst/DuplicatesDialog.cpp:219 +#: kcmfontinst/DuplicatesDialog.cpp:222 #, kde-format msgid "" "Are you sure you wish to delete:\n" @@ -154,44 +154,44 @@ "क्या आप वाक़ई :\n" "%1 को मिटाना चाहते हैं?" -#: kcmfontinst/DuplicatesDialog.cpp:221 +#: kcmfontinst/DuplicatesDialog.cpp:224 msgid "Are you sure you wish to delete:" msgstr "क्या आप वाक़ई इसको मिटाना चाहते हैं:" -#: kcmfontinst/DuplicatesDialog.cpp:245 +#: kcmfontinst/DuplicatesDialog.cpp:248 #, fuzzy #| msgid "Abort font scan?" msgid "Cancel font scan?" msgstr "फ़ॉन्ट स्कैन करना छोड़ें?" -#: kcmfontinst/DuplicatesDialog.cpp:405 +#: kcmfontinst/DuplicatesDialog.cpp:408 msgid "Font/File" msgstr "फ़ॉन्ट/फ़ाइलें" -#: kcmfontinst/DuplicatesDialog.cpp:407 +#: kcmfontinst/DuplicatesDialog.cpp:410 msgid "Size" msgstr "आकार" -#: kcmfontinst/DuplicatesDialog.cpp:408 +#: kcmfontinst/DuplicatesDialog.cpp:411 msgid "Date" msgstr "दिनांक " -#: kcmfontinst/DuplicatesDialog.cpp:409 +#: kcmfontinst/DuplicatesDialog.cpp:412 msgid "Links To" msgstr "पर लिंक" -#: kcmfontinst/DuplicatesDialog.cpp:422 kcmfontinst/FontList.cpp:1426 +#: kcmfontinst/DuplicatesDialog.cpp:425 kcmfontinst/FontList.cpp:1426 #, fuzzy msgid "Open in Font Viewer" msgstr "परियोजना खोलें... (&O)" -#: kcmfontinst/DuplicatesDialog.cpp:424 +#: kcmfontinst/DuplicatesDialog.cpp:427 #, fuzzy #| msgid "Properties..." msgid "Properties" msgstr "गुण..." -#: kcmfontinst/DuplicatesDialog.cpp:427 +#: kcmfontinst/DuplicatesDialog.cpp:430 #, fuzzy msgid "Unmark for Deletion" msgstr "" @@ -200,66 +200,66 @@ "#-#-#-#-# konqueror.po (konqueror) #-#-#-#-#\n" " पसंदीदा फ़ोल्डर मिटाना" -#: kcmfontinst/DuplicatesDialog.cpp:429 +#: kcmfontinst/DuplicatesDialog.cpp:432 #, fuzzy msgid "Mark for Deletion" msgstr "कार्य जानकारियाँ" -#: kcmfontinst/DuplicatesDialog.cpp:529 +#: kcmfontinst/DuplicatesDialog.cpp:532 #, fuzzy, kde-format msgid "Open font in font viewer?" msgid_plural "Open all %1 fonts in font viewer?" msgstr[0] "परियोजना खोलें... (&O)" msgstr[1] "परियोजना खोलें... (&O)" -#: kcmfontinst/FontFilter.cpp:126 +#: kcmfontinst/FontFilter.cpp:127 msgid "Set Criteria" msgstr "मापदण्ड सेट करें" -#: kcmfontinst/FontFilter.cpp:139 +#: kcmfontinst/FontFilter.cpp:140 msgid "Family" msgstr "परिवार" -#: kcmfontinst/FontFilter.cpp:140 +#: kcmfontinst/FontFilter.cpp:141 msgid "Style" msgstr "शैली" -#: kcmfontinst/FontFilter.cpp:142 +#: kcmfontinst/FontFilter.cpp:143 msgid "Foundry" msgstr "ढलाई" -#: kcmfontinst/FontFilter.cpp:149 +#: kcmfontinst/FontFilter.cpp:150 #, fuzzy msgid "FontConfig Match" msgstr "फ़ॉन्ट कॉन्फ़िगरेशन" -#: kcmfontinst/FontFilter.cpp:151 +#: kcmfontinst/FontFilter.cpp:152 #, fuzzy #| msgid "Preview Type" msgid "File Type" msgstr "पूर्वावलोकन किस्म" -#: kcmfontinst/FontFilter.cpp:182 +#: kcmfontinst/FontFilter.cpp:183 #, fuzzy #| msgid "Full Name" msgid "File Name" msgstr "पूरा नाम" -#: kcmfontinst/FontFilter.cpp:183 +#: kcmfontinst/FontFilter.cpp:184 msgid "File Location" msgstr "फ़ाइल स्थान" -#: kcmfontinst/FontFilter.cpp:185 +#: kcmfontinst/FontFilter.cpp:186 #, fuzzy msgid "Writing System" msgstr "छपाई तंत्र" -#: kcmfontinst/FontFilter.cpp:194 +#: kcmfontinst/FontFilter.cpp:195 #, fuzzy msgid "Symbol/Other" msgstr "प्रतीक" -#: kcmfontinst/FontFilter.cpp:287 kcmfontinst/FontFilter.cpp:349 +#: kcmfontinst/FontFilter.cpp:288 kcmfontinst/FontFilter.cpp:350 #, kde-format msgid "Type here to filter on %1" msgstr "" @@ -302,17 +302,17 @@ msgid "Delete" msgstr "मिटायें..." -#: kcmfontinst/FontList.cpp:1418 kcmfontinst/GroupList.cpp:832 +#: kcmfontinst/FontList.cpp:1418 kcmfontinst/GroupList.cpp:833 #: kcmfontinst/KCmFontInst.cpp:1204 kcmfontinst/KCmFontInst.cpp:1228 msgid "Enable" msgstr "सक्षम करें" -#: kcmfontinst/FontList.cpp:1420 kcmfontinst/GroupList.cpp:834 +#: kcmfontinst/FontList.cpp:1420 kcmfontinst/GroupList.cpp:835 #: kcmfontinst/KCmFontInst.cpp:1205 kcmfontinst/KCmFontInst.cpp:1229 msgid "Disable" msgstr "अक्षम" -#: kcmfontinst/FontList.cpp:1424 kcmfontinst/GroupList.cpp:843 +#: kcmfontinst/FontList.cpp:1424 kcmfontinst/GroupList.cpp:844 msgid "Print..." msgstr "छापें..." @@ -325,11 +325,11 @@ msgid "Open all %1 fonts in font viewer?" msgstr "" -#: kcmfontinst/GroupList.cpp:86 +#: kcmfontinst/GroupList.cpp:87 msgid "All Fonts" msgstr "सभी फ़ॉन्ट्स" -#: kcmfontinst/GroupList.cpp:89 +#: kcmfontinst/GroupList.cpp:90 #, fuzzy msgid "Personal Fonts" msgstr "" @@ -342,38 +342,38 @@ "#-#-#-#-# korganizer.po (korganizer) #-#-#-#-#\n" "व्यक्तिगत" -#: kcmfontinst/GroupList.cpp:92 +#: kcmfontinst/GroupList.cpp:93 msgid "System Fonts" msgstr "तंत्र फ़ॉन्ट" -#: kcmfontinst/GroupList.cpp:95 +#: kcmfontinst/GroupList.cpp:96 msgid "Unclassified" msgstr "अवर्गीकृत" -#: kcmfontinst/GroupList.cpp:386 +#: kcmfontinst/GroupList.cpp:387 msgid "Group" msgstr "समूह" -#: kcmfontinst/GroupList.cpp:575 +#: kcmfontinst/GroupList.cpp:576 #, fuzzy, kde-format msgid "" "<p>Do you really want to remove '<b>%1</b>'?</p><p><i>This will only remove " "the group, and not the actual fonts.</i></p>" msgstr "<p>क्या आप सचमुच <b>%1</b> को रद्दी में ले जाना चाहते हैं?</p>" -#: kcmfontinst/GroupList.cpp:578 +#: kcmfontinst/GroupList.cpp:579 msgid "Remove Group" msgstr "समूह मिटाएँ" -#: kcmfontinst/GroupList.cpp:578 kcmfontinst/GroupList.cpp:829 +#: kcmfontinst/GroupList.cpp:579 kcmfontinst/GroupList.cpp:830 msgid "Remove" msgstr "हटाएँ" -#: kcmfontinst/GroupList.cpp:579 kcmfontinst/KCmFontInst.cpp:250 +#: kcmfontinst/GroupList.cpp:580 kcmfontinst/KCmFontInst.cpp:250 msgid "Remove group" msgstr "समूह मिटाएँ" -#: kcmfontinst/GroupList.cpp:624 +#: kcmfontinst/GroupList.cpp:625 #, kde-format msgid "" "<h3>Font Groups</h3><p>This list displays the font groups available on your " @@ -385,14 +385,14 @@ "li></ul></p>" msgstr "" -#: kcmfontinst/GroupList.cpp:633 +#: kcmfontinst/GroupList.cpp:634 msgid "" "<li><i>All Fonts</i> contains all the fonts installed on your system.</" "li><li><i>Unclassified</i> contains all fonts that have not yet been placed " "within a \"Custom\" group.</li>" msgstr "" -#: kcmfontinst/GroupList.cpp:636 +#: kcmfontinst/GroupList.cpp:637 msgid "" "<li><i>All Fonts</i> contains all the fonts installed on your system - both " "\"System\" and \"Personal\".</li><li><i>System</i> contains all fonts that " @@ -402,47 +402,47 @@ "within a \"Custom\" group.</li>" msgstr "" -#: kcmfontinst/GroupList.cpp:743 +#: kcmfontinst/GroupList.cpp:744 #, fuzzy, kde-format msgid "<qt>A group named <b>'%1'</b> already exists.</qt>" msgstr "<qt>फ़ोल्डर बनाने में असफल <b>%1</b>, फ़ोल्डर पहले ही मौज़ूद है.</qt>" -#: kcmfontinst/GroupList.cpp:837 +#: kcmfontinst/GroupList.cpp:838 msgid "Rename..." msgstr "नाम बदलें..." -#: kcmfontinst/GroupList.cpp:849 +#: kcmfontinst/GroupList.cpp:850 #, fuzzy #| msgid "Print..." msgid "Export..." msgstr "छापें..." -#: kcmfontinst/GroupList.cpp:947 +#: kcmfontinst/GroupList.cpp:948 #, kde-format msgid "Add to \"%1\"." msgstr "" -#: kcmfontinst/GroupList.cpp:949 +#: kcmfontinst/GroupList.cpp:950 #, fuzzy #| msgid "Remove group" msgid "Remove from current group." msgstr "समूह मिटाएँ" -#: kcmfontinst/GroupList.cpp:951 +#: kcmfontinst/GroupList.cpp:952 msgid "Move to personal folder." msgstr "" -#: kcmfontinst/GroupList.cpp:953 +#: kcmfontinst/GroupList.cpp:954 msgid "Move to system folder." msgstr "" -#: kcmfontinst/JobRunner.cpp:186 +#: kcmfontinst/JobRunner.cpp:187 #, fuzzy #| msgid "Are you sure you wish to cancel?" msgid "<h3>Cancel?</h3><p>Are you sure you wish to cancel?</p>" msgstr "क्या आप वाक़ई रद्द करना चाहते हैं?" -#: kcmfontinst/JobRunner.cpp:201 +#: kcmfontinst/JobRunner.cpp:202 #, fuzzy msgid "" "<h3>Finished</h3><p>Please note that any open applications will need to be " @@ -451,128 +451,128 @@ "कृपया नोट करें कि सभी खुले अनुप्रयोगों को फिर से प्रारंभ करना होगा, ताकि किए गए परिवर्तन " "दिखाई दे सकें" -#: kcmfontinst/JobRunner.cpp:209 +#: kcmfontinst/JobRunner.cpp:210 msgid "Do not show this message again" msgstr "" -#: kcmfontinst/JobRunner.cpp:309 +#: kcmfontinst/JobRunner.cpp:310 msgid "Installing" msgstr "संस्थापित किया जा रहा है" -#: kcmfontinst/JobRunner.cpp:312 +#: kcmfontinst/JobRunner.cpp:313 msgid "Uninstalling" msgstr "असंस्थापित किया जा रहा है" -#: kcmfontinst/JobRunner.cpp:315 kcmfontinst/JobRunner.cpp:421 +#: kcmfontinst/JobRunner.cpp:316 kcmfontinst/JobRunner.cpp:422 msgid "Enabling" msgstr "सक्षम किया जा रहा है" -#: kcmfontinst/JobRunner.cpp:318 kcmfontinst/JobRunner.cpp:427 +#: kcmfontinst/JobRunner.cpp:319 kcmfontinst/JobRunner.cpp:428 msgid "Moving" msgstr "खिसकाते हुए " -#: kcmfontinst/JobRunner.cpp:321 +#: kcmfontinst/JobRunner.cpp:322 msgid "Updating" msgstr "अद्यतन किया जा रहा है" -#: kcmfontinst/JobRunner.cpp:325 +#: kcmfontinst/JobRunner.cpp:326 #, fuzzy #| msgid "Remove" msgid "Removing" msgstr "हटाएँ" -#: kcmfontinst/JobRunner.cpp:329 +#: kcmfontinst/JobRunner.cpp:330 msgid "Disabling" msgstr "अक्षम किया जा रहा है" -#: kcmfontinst/JobRunner.cpp:369 +#: kcmfontinst/JobRunner.cpp:370 msgid "Updating font configuration. Please wait..." msgstr "फ़ॉन्ट कॉन्फ़िगरेशन अद्यतन किया जा रहा है. कृपया इंतजार करें..." -#: kcmfontinst/JobRunner.cpp:450 +#: kcmfontinst/JobRunner.cpp:451 msgid "Unable to start backend." msgstr "" -#: kcmfontinst/JobRunner.cpp:460 +#: kcmfontinst/JobRunner.cpp:461 msgid "Backend died, but has been restarted. Please try again." msgstr "" -#: kcmfontinst/JobRunner.cpp:638 kcmfontinst/JobRunner.cpp:644 +#: kcmfontinst/JobRunner.cpp:639 kcmfontinst/JobRunner.cpp:645 msgid "<h3>Error</h3>" msgstr "" -#: kcmfontinst/JobRunner.cpp:640 +#: kcmfontinst/JobRunner.cpp:641 msgid "Skip" msgstr "" -#: kcmfontinst/JobRunner.cpp:641 +#: kcmfontinst/JobRunner.cpp:642 msgid "AutoSkip" msgstr "" -#: kcmfontinst/JobRunner.cpp:702 +#: kcmfontinst/JobRunner.cpp:703 #, kde-format msgid "Failed to download <i>%1</i>" msgstr "" -#: kcmfontinst/JobRunner.cpp:704 +#: kcmfontinst/JobRunner.cpp:705 #, kde-format msgid "System backend died. Please try again.<br><i>%1</i>" msgstr "" -#: kcmfontinst/JobRunner.cpp:706 +#: kcmfontinst/JobRunner.cpp:707 #, kde-format msgid "" "<i>%1</i> is a bitmap font, and these have been disabled on your system." msgstr "" -#: kcmfontinst/JobRunner.cpp:708 +#: kcmfontinst/JobRunner.cpp:709 #, fuzzy, kde-format msgid "" "<i>%1</i> contains the font <b>%2</b>, which is already installed on your " "system." msgstr "इस नाम का कनेक्शन पहले से ही मौजूद है." -#: kcmfontinst/JobRunner.cpp:711 +#: kcmfontinst/JobRunner.cpp:712 #, kde-format msgid "<i>%1</i> is not a font." msgstr "" -#: kcmfontinst/JobRunner.cpp:713 +#: kcmfontinst/JobRunner.cpp:714 #, fuzzy, kde-format msgid "Could not remove all files associated with <i>%1</i>" msgstr "घटना के साथ कोई समय सम्बद्ध नहीं" -#: kcmfontinst/JobRunner.cpp:715 +#: kcmfontinst/JobRunner.cpp:716 #, kde-format msgid "Failed to start the system daemon.<br><i>%1</i>" msgstr "" -#: kcmfontinst/JobRunner.cpp:720 kio/KioFonts.cpp:806 +#: kcmfontinst/JobRunner.cpp:721 kio/KioFonts.cpp:809 #, fuzzy, kde-format msgid "<i>%1</i> already exists." msgstr "<qt>फ़ोल्डर बनाने में असफल <b>%1</b>, फ़ोल्डर पहले ही मौज़ूद है.</qt>" -#: kcmfontinst/JobRunner.cpp:723 +#: kcmfontinst/JobRunner.cpp:724 #, kde-format msgid "<i>%1</i> does not exist." msgstr "" -#: kcmfontinst/JobRunner.cpp:725 +#: kcmfontinst/JobRunner.cpp:726 #, kde-format msgid "Permission denied.<br><i>%1</i>" msgstr "" -#: kcmfontinst/JobRunner.cpp:727 +#: kcmfontinst/JobRunner.cpp:728 #, fuzzy, kde-format msgid "Unsupported action.<br><i>%1</i>" msgstr "अनुमोदन संवाद " -#: kcmfontinst/JobRunner.cpp:729 +#: kcmfontinst/JobRunner.cpp:730 #, fuzzy, kde-format msgid "Authentication failed.<br><i>%1</i>" msgstr "अनुमोदन संवाद " -#: kcmfontinst/JobRunner.cpp:731 +#: kcmfontinst/JobRunner.cpp:732 #, kde-format msgid "Unexpected error while processing: <i>%1</i>" msgstr "" @@ -1037,36 +1037,36 @@ msgid "48pt" msgstr "48पाइं." -#: kio/KioFonts.cpp:225 +#: kio/KioFonts.cpp:227 #, kde-format msgid "Can only install fonts to either \"%1\" or \"%2\"." msgstr "" -#: kio/KioFonts.cpp:228 +#: kio/KioFonts.cpp:230 #, kde-format msgid "" "You cannot install a fonts package directly.\n" "Please extract %1, and install the components individually." msgstr "" -#: kio/KioFonts.cpp:476 +#: kio/KioFonts.cpp:478 #, fuzzy msgid "Cannot copy fonts" msgstr "नक़ल यहाँ रखें" -#: kio/KioFonts.cpp:481 +#: kio/KioFonts.cpp:483 #, fuzzy #| msgid "Cannot Print" msgid "Cannot move fonts" msgstr "मुद्रित नहीं किया जा सकता" -#: kio/KioFonts.cpp:492 +#: kio/KioFonts.cpp:494 #, fuzzy #| msgid "Only fonts may be installed." msgid "Only fonts may be deleted." msgstr "सिर्फ फ़ॉन्ट संस्थापित होंगे." -#: kio/KioFonts.cpp:495 +#: kio/KioFonts.cpp:497 #, fuzzy, kde-format #| msgid "" #| "Sorry, you cannot rename, move, copy, or delete either \"%1\" or \"%2\"." @@ -1075,46 +1075,46 @@ "माफ करें, आप \"%1\" या \"%2\" का नाम नहीं बदल सकते, मिटा, खिसका या नक़ल नहीं कर " "सकते." -#: kio/KioFonts.cpp:525 +#: kio/KioFonts.cpp:527 #, kde-format msgid "Please specify \"%1\" or \"%2\"." msgstr "कृपया उल्लेखित करें \"%1\" या \"%2\"." -#: kio/KioFonts.cpp:549 +#: kio/KioFonts.cpp:551 msgid "No special methods supported." msgstr "" -#: kio/KioFonts.cpp:629 +#: kio/KioFonts.cpp:631 msgid "Fonts" msgstr "फ़ॉन्ट्स" -#: kio/KioFonts.cpp:782 +#: kio/KioFonts.cpp:785 #, fuzzy msgid "Failed to start the system daemon" msgstr "प्लेयर प्रक्रिया बन्द करने में असफल." -#: kio/KioFonts.cpp:785 +#: kio/KioFonts.cpp:788 msgid "Backend died" msgstr "" -#: kio/KioFonts.cpp:789 +#: kio/KioFonts.cpp:792 #, kde-format msgid "%1 is a bitmap font, and these have been disabled on your system." msgstr "" -#: kio/KioFonts.cpp:793 +#: kio/KioFonts.cpp:796 #, fuzzy, kde-format msgid "" "%1 contains the font <b>%2</b>, which is already installed on your system." msgstr "इस नाम का कनेक्शन पहले से ही मौजूद है." -#: kio/KioFonts.cpp:797 +#: kio/KioFonts.cpp:800 #, fuzzy, kde-format #| msgid "Could not read font." msgid "%1 is not a font." msgstr "फ़ॉन्ट पढ़ नहीं सका." -#: kio/KioFonts.cpp:800 +#: kio/KioFonts.cpp:803 #, fuzzy, kde-format msgid "Could not remove all files associated with %1" msgstr "घटना के साथ कोई समय सम्बद्ध नहीं" @@ -1123,14 +1123,14 @@ msgid "Unknown" msgstr "अज्ञात" -#: lib/FcEngine.cpp:767 +#: lib/FcEngine.cpp:754 #, fuzzy #| msgid "Aa" msgctxt "First letter of the alphabet (in upper then lower case)" msgid "Aa" msgstr "अआ" -#: lib/FcEngine.cpp:769 +#: lib/FcEngine.cpp:756 #, fuzzy #| msgid "AaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz0123456789" msgctxt "" @@ -1138,43 +1138,43 @@ msgid "AaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz0123456789" msgstr "कखगघड चछजझञ पफबभम ककाकिकीकुकूकेकैकोकौकंकः १२३४५६७८९०" -#: lib/FcEngine.cpp:951 +#: lib/FcEngine.cpp:938 msgid "No characters found." msgstr "कोई अक्षर नहीं मिला." -#: lib/FcEngine.cpp:989 +#: lib/FcEngine.cpp:976 #, fuzzy #| msgid "The quick brown fox jumps over the lazy dog" msgctxt "A sentence that uses all of the letters of the alphabet" msgid "The quick brown fox jumps over the lazy dog" msgstr "सारे जहाँ से अच्छा हिंदोस्ताँ हमारा" -#: lib/FcEngine.cpp:994 +#: lib/FcEngine.cpp:981 #, fuzzy #| msgid "ABCDEFGHIJKLMNOPQRSTUVWXYZ" msgctxt "All of the letters of the alphabet, uppercase" msgid "ABCDEFGHIJKLMNOPQRSTUVWXYZ" msgstr "कखगघजझञटठडढणपफबभम" -#: lib/FcEngine.cpp:999 +#: lib/FcEngine.cpp:986 #, fuzzy #| msgid "abcdefghijklmnopqrstuvwxyz" msgctxt "All of the letters of the alphabet, lowercase" msgid "abcdefghijklmnopqrstuvwxyz" msgstr "कखगघजझञटठडढणपफबभम" -#: lib/FcEngine.cpp:1004 +#: lib/FcEngine.cpp:991 #, fuzzy #| msgid "0123456789.:,;(*!?'/\\\")£$€%^&-+@~#<>{}[]" msgctxt "Numbers and characters" msgid "0123456789.:,;(*!?'/\\\")£$€%^&-+@~#<>{}[]" msgstr "0१२३४५६७८९.:,;(*!?'/\\\")£$€%^&-+@~#<>{}[]" -#: lib/FcEngine.cpp:1401 +#: lib/FcEngine.cpp:1388 msgid "ERROR: Could not determine font's name." msgstr "त्रुटि: फ़ॉन्ट नाम पढ़ नहीं सका." -#: lib/FcEngine.cpp:1405 +#: lib/FcEngine.cpp:1392 #, fuzzy, kde-format msgid "%2 [1 pixel]" msgid_plural "%2 [%1 pixels]" @@ -1309,171 +1309,171 @@ msgid "Proportional" msgstr "समानुपातिक" -#: viewpart/CharTip.cpp:64 +#: viewpart/CharTip.cpp:65 msgid "Other, Control" msgstr "अन्य, नियंत्रण" -#: viewpart/CharTip.cpp:66 +#: viewpart/CharTip.cpp:67 msgid "Other, Format" msgstr "अन्य, फ़ॉर्मेट" -#: viewpart/CharTip.cpp:68 +#: viewpart/CharTip.cpp:69 msgid "Other, Not Assigned" msgstr "अन्य, आवंटित नहीं" -#: viewpart/CharTip.cpp:70 +#: viewpart/CharTip.cpp:71 msgid "Other, Private Use" msgstr "अन्य, निज़ी उपयोग" -#: viewpart/CharTip.cpp:72 +#: viewpart/CharTip.cpp:73 msgid "Other, Surrogate" msgstr "अन्य, प्रतिनिधि" -#: viewpart/CharTip.cpp:74 +#: viewpart/CharTip.cpp:75 msgid "Letter, Lowercase" msgstr "अक्षर, छोटा केस" -#: viewpart/CharTip.cpp:76 +#: viewpart/CharTip.cpp:77 msgid "Letter, Modifier" msgstr "अक्षर, परिवर्धक" -#: viewpart/CharTip.cpp:78 +#: viewpart/CharTip.cpp:79 msgid "Letter, Other" msgstr "अक्षर, अन्य" -#: viewpart/CharTip.cpp:80 +#: viewpart/CharTip.cpp:81 msgid "Letter, Titlecase" msgstr "अक्षर, शीर्षक केस" -#: viewpart/CharTip.cpp:82 +#: viewpart/CharTip.cpp:83 msgid "Letter, Uppercase" msgstr "अक्षर, बडा केस" -#: viewpart/CharTip.cpp:84 +#: viewpart/CharTip.cpp:85 msgid "Mark, Spacing Combining" msgstr "निशान, स्पेसिंग कम्बाइनिंग" -#: viewpart/CharTip.cpp:86 +#: viewpart/CharTip.cpp:87 msgid "Mark, Enclosing" msgstr "निशान, एनक्लोज़िंग" -#: viewpart/CharTip.cpp:88 +#: viewpart/CharTip.cpp:89 msgid "Mark, Non-Spacing" msgstr "निशान, नॉन-स्पेसिंग" -#: viewpart/CharTip.cpp:90 +#: viewpart/CharTip.cpp:91 msgid "Number, Decimal Digit" msgstr "संख्या, दशमलव अंक" -#: viewpart/CharTip.cpp:92 +#: viewpart/CharTip.cpp:93 msgid "Number, Letter" msgstr "संख्या, अक्षर" -#: viewpart/CharTip.cpp:94 +#: viewpart/CharTip.cpp:95 msgid "Number, Other" msgstr "संख्या, अन्य" -#: viewpart/CharTip.cpp:96 +#: viewpart/CharTip.cpp:97 msgid "Punctuation, Connector" msgstr "विरामचिह्न, कनेक्टर" -#: viewpart/CharTip.cpp:98 +#: viewpart/CharTip.cpp:99 msgid "Punctuation, Dash" msgstr "विरामचिह्न, टूटी-रेखा" -#: viewpart/CharTip.cpp:100 +#: viewpart/CharTip.cpp:101 msgid "Punctuation, Close" msgstr "विरामचिह्न, बन्द करें" -#: viewpart/CharTip.cpp:102 +#: viewpart/CharTip.cpp:103 msgid "Punctuation, Final Quote" msgstr "विरामचिह्न, अंतिम संदेश" -#: viewpart/CharTip.cpp:104 +#: viewpart/CharTip.cpp:105 msgid "Punctuation, Initial Quote" msgstr "विरामचिह्न, मूल संदेश" -#: viewpart/CharTip.cpp:106 +#: viewpart/CharTip.cpp:107 msgid "Punctuation, Other" msgstr "विरामचिह्न, अन्य" -#: viewpart/CharTip.cpp:108 +#: viewpart/CharTip.cpp:109 msgid "Punctuation, Open" msgstr "विरामचिह्न, खोलें" -#: viewpart/CharTip.cpp:110 +#: viewpart/CharTip.cpp:111 msgid "Symbol, Currency" msgstr "निशान, मुद्रा" -#: viewpart/CharTip.cpp:112 +#: viewpart/CharTip.cpp:113 msgid "Symbol, Modifier" msgstr "निशान, परिवर्धक" -#: viewpart/CharTip.cpp:114 +#: viewpart/CharTip.cpp:115 msgid "Symbol, Math" msgstr "निशान, गणित" -#: viewpart/CharTip.cpp:116 +#: viewpart/CharTip.cpp:117 msgid "Symbol, Other" msgstr "निशान, अन्य" -#: viewpart/CharTip.cpp:118 +#: viewpart/CharTip.cpp:119 msgid "Separator, Line" msgstr "पृथक्कारक, पंक्ति" -#: viewpart/CharTip.cpp:120 +#: viewpart/CharTip.cpp:121 msgid "Separator, Paragraph" msgstr "पृथक्कारक, अनुच्छेद" -#: viewpart/CharTip.cpp:122 +#: viewpart/CharTip.cpp:123 msgid "Separator, Space" msgstr "पृथक्कारक, स्थान" -#: viewpart/CharTip.cpp:173 +#: viewpart/CharTip.cpp:174 msgid "Category" msgstr "श्रेणी" -#: viewpart/CharTip.cpp:175 +#: viewpart/CharTip.cpp:176 msgid "UCS-4" msgstr "यूसीएस-4" -#: viewpart/CharTip.cpp:179 +#: viewpart/CharTip.cpp:180 msgid "UTF-16" msgstr "यूटीएफ़-16" -#: viewpart/CharTip.cpp:190 +#: viewpart/CharTip.cpp:191 msgid "UTF-8" msgstr "यूटीएफ़-8" -#: viewpart/CharTip.cpp:207 +#: viewpart/CharTip.cpp:208 msgid "XML Decimal Entity" msgstr "एक्सएमएल दशमलव एंटिटी" -#: viewpart/FontViewPart.cpp:125 +#: viewpart/FontViewPart.cpp:126 msgid "Show Face:" msgstr "फेस दिखाएँ:" -#: viewpart/FontViewPart.cpp:128 +#: viewpart/FontViewPart.cpp:129 msgid "Install..." msgstr "संस्थापित करें..." -#: viewpart/FontViewPart.cpp:151 +#: viewpart/FontViewPart.cpp:152 msgid "Change Text..." msgstr "पाठ बदलें..." -#: viewpart/FontViewPart.cpp:388 +#: viewpart/FontViewPart.cpp:389 msgid "Could not read font." msgstr "फ़ॉन्ट पढ़ नहीं सका." -#: viewpart/FontViewPart.cpp:435 +#: viewpart/FontViewPart.cpp:436 msgid "Preview String" msgstr "वाक्यांश पूर्वावलोकन" -#: viewpart/FontViewPart.cpp:436 +#: viewpart/FontViewPart.cpp:437 msgid "Please enter new string:" msgstr "कृपया नया वाक्यांश भरें:" -#: viewpart/FontViewPart.cpp:529 +#: viewpart/FontViewPart.cpp:530 msgid "<p>No information</p>" msgstr "<p>जानकारियाँ नहीं</p>" @@ -1482,24 +1482,24 @@ msgid "&Main Toolbar" msgstr "" -#: viewpart/PreviewSelectAction.cpp:32 +#: viewpart/PreviewSelectAction.cpp:33 msgid "Preview Type" msgstr "पूर्वावलोकन किस्म" -#: viewpart/PreviewSelectAction.cpp:50 +#: viewpart/PreviewSelectAction.cpp:51 msgid "Standard Preview" msgstr "मानक पूर्वावलोकन" -#: viewpart/PreviewSelectAction.cpp:51 +#: viewpart/PreviewSelectAction.cpp:52 msgid "All Characters" msgstr "सभी अक्षर" -#: viewpart/PreviewSelectAction.cpp:60 +#: viewpart/PreviewSelectAction.cpp:61 #, kde-format msgid "Unicode Block: %1" msgstr "यूनिकोड ब्लॉक: %1" -#: viewpart/PreviewSelectAction.cpp:63 +#: viewpart/PreviewSelectAction.cpp:64 #, kde-format msgid "Unicode Script: %1" msgstr "यूनिकोड स्क्रिप्ट: %1" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kgreet_classic.po kde-l10n-hi-4.13.0/messages/kde-workspace/kgreet_classic.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kgreet_classic.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kgreet_classic.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,55 @@ +# translation of kgreet_classic.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007. +msgid "" +msgstr "" +"Project-Id-Version: kgreet_classic\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2007-10-27 11:49+0530\n" +"Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" + +#: kgreet_classic.cpp:92 +msgid "&Username:" +msgstr "उपयोक्ता नाम: (&U)" + +#: kgreet_classic.cpp:97 +msgid "Username:" +msgstr "उपयोक्ता नाम:" + +#: kgreet_classic.cpp:109 +msgid "&Password:" +msgstr "पासवर्ड: (&P)" + +#: kgreet_classic.cpp:110 +msgid "Current &password:" +msgstr "मौजूदा पासवर्ड: (&p)" + +#: kgreet_classic.cpp:122 +msgid "&New password:" +msgstr "नया पासवर्डः (&N)" + +#: kgreet_classic.cpp:125 +msgid "Con&firm password:" +msgstr "पासवर्ड की पुष्टि करें: (&f)" + +#: kgreet_classic.cpp:261 +#, kde-format +msgid "Unrecognized prompt \"%1\"" +msgstr "\"%1\" प्रॉम्प्ट पहचाना नहीं जा सका" + +#: kgreet_classic.cpp:475 +#, fuzzy +#| msgid "Username + password (classic)" +msgctxt "@item:inmenu authentication method" +msgid "Username + password (classic)" +msgstr "उपयोक्ता-नाम + पासवर्ड (क्लासिक)" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kgreet_generic.po kde-l10n-hi-4.13.0/messages/kde-workspace/kgreet_generic.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kgreet_generic.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kgreet_generic.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,24 @@ +# translation of kgreet_generic.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@aol.in>, 2008. +msgid "" +msgstr "" +"Project-Id-Version: kgreet_generic\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2008-07-08 20:05+0530\n" +"Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" +"Language-Team: Hindi <Indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" + +#: kgreet_generic.cpp:350 +msgctxt "@item:inmenu authentication method" +msgid "Generic" +msgstr "जेनेरिक" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kgreet_winbind.po kde-l10n-hi-4.13.0/messages/kde-workspace/kgreet_winbind.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kgreet_winbind.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kgreet_winbind.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,63 @@ +# translation of kgreet_winbind.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007. +msgid "" +msgstr "" +"Project-Id-Version: kgreet_winbind\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2007-10-27 13:58+0530\n" +"Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" + +#: kgreet_winbind.cpp:126 +msgid "&Domain:" +msgstr "डोमेनः (&D)" + +#: kgreet_winbind.cpp:128 +msgid "&Username:" +msgstr "उपयोक्ता नाम: (&U)" + +#: kgreet_winbind.cpp:142 +msgid "Domain:" +msgstr "डोमेनः" + +#: kgreet_winbind.cpp:145 +msgid "Username:" +msgstr "उपयोक्ता नाम:" + +#: kgreet_winbind.cpp:159 +msgid "&Password:" +msgstr "पासवर्ड: (&P)" + +#: kgreet_winbind.cpp:160 +msgid "Current &password:" +msgstr "मौजूदा पासवर्ड: (&p)" + +#: kgreet_winbind.cpp:174 +msgid "&New password:" +msgstr "नया पासवर्डः (&N)" + +#: kgreet_winbind.cpp:177 +msgid "Con&firm password:" +msgstr "पासवर्ड की पुष्टि करें: (&f)" + +#: kgreet_winbind.cpp:348 +#, kde-format +msgid "Unrecognized prompt \"%1\"" +msgstr "\"%1\" प्रॉम्प्ट पहचाना नहीं जा सका" + +#: kgreet_winbind.cpp:631 +#, fuzzy +#| msgid "Winbind / Samba" +msgctxt "@item:inmenu authentication method" +msgid "Winbind / Samba" +msgstr "विन बाइंड / साम्बा" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/khotkeys.po kde-l10n-hi-4.13.0/messages/kde-workspace/khotkeys.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/khotkeys.po 2014-03-20 03:51:10.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/khotkeys.po 2014-02-08 06:26:18.000000000 +0000 @@ -8,7 +8,7 @@ msgstr "" "Project-Id-Version: khotkeys\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-20 01:50+0000\n" +"POT-Creation-Date: 2014-02-08 05:23+0000\n" "PO-Revision-Date: 2010-12-09 01:45+0530\n" "Last-Translator: G Karunakar\n" "Language-Team: Hindi <en@li.org>\n" @@ -152,7 +152,7 @@ #. i18n: ectx: property (text), widget (QPushButton, delete_button) #: kcm_hotkeys/conditions/conditions_widget.ui:44 -#: kcm_hotkeys/hotkeys_context_menu.cpp:136 +#: kcm_hotkeys/hotkeys_context_menu.cpp:137 msgid "Delete" msgstr "मिटाएँ" @@ -357,70 +357,70 @@ msgid "Dock" msgstr "डॉक" -#: kcm_hotkeys/hotkeys_context_menu.cpp:43 -#: kcm_hotkeys/hotkeys_context_menu.cpp:55 +#: kcm_hotkeys/hotkeys_context_menu.cpp:44 +#: kcm_hotkeys/hotkeys_context_menu.cpp:56 msgid "Test" msgstr "जांच" -#: kcm_hotkeys/hotkeys_context_menu.cpp:129 -#: kcm_hotkeys/hotkeys_context_menu.cpp:142 kcm_hotkeys/hotkeys_model.cpp:91 +#: kcm_hotkeys/hotkeys_context_menu.cpp:130 +#: kcm_hotkeys/hotkeys_context_menu.cpp:143 kcm_hotkeys/hotkeys_model.cpp:92 msgid "New Group" msgstr "नया समूह" -#: kcm_hotkeys/hotkeys_context_menu.cpp:146 +#: kcm_hotkeys/hotkeys_context_menu.cpp:147 msgid "Export Group..." msgstr "समूह निर्यात..." -#: kcm_hotkeys/hotkeys_context_menu.cpp:147 +#: kcm_hotkeys/hotkeys_context_menu.cpp:148 msgid "Import..." msgstr "आयात..." -#: kcm_hotkeys/hotkeys_context_menu.cpp:155 +#: kcm_hotkeys/hotkeys_context_menu.cpp:156 #, fuzzy #| msgid "New" msgctxt "@title:menu create various trigger types" msgid "New" msgstr "नया" -#: kcm_hotkeys/hotkeys_context_menu.cpp:161 +#: kcm_hotkeys/hotkeys_context_menu.cpp:162 msgid "Global Shortcut" msgstr "वैश्विक शॉर्टकट" -#: kcm_hotkeys/hotkeys_context_menu.cpp:174 +#: kcm_hotkeys/hotkeys_context_menu.cpp:175 msgid "Window Action" msgstr "क्रिया विंडो" -#: kcm_hotkeys/hotkeys_context_menu.cpp:187 +#: kcm_hotkeys/hotkeys_context_menu.cpp:188 msgid "Mouse Gesture Action" msgstr "" -#: kcm_hotkeys/hotkeys_context_menu.cpp:268 +#: kcm_hotkeys/hotkeys_context_menu.cpp:269 msgid "Command/URL" msgstr "कमांड/ यूआरएलः" -#: kcm_hotkeys/hotkeys_context_menu.cpp:275 +#: kcm_hotkeys/hotkeys_context_menu.cpp:276 msgid "D-Bus Command" msgstr "डी-बस कमांड" -#: kcm_hotkeys/hotkeys_context_menu.cpp:282 +#: kcm_hotkeys/hotkeys_context_menu.cpp:283 msgid "K-Menu Entry" msgstr "के-मेन्यू प्रविष्टि" -#: kcm_hotkeys/hotkeys_context_menu.cpp:289 +#: kcm_hotkeys/hotkeys_context_menu.cpp:290 msgid "Send Keyboard Input" msgstr "कुंजीपट इनपुट भेजें" #. i18n: ectx: attribute (title), widget (QWidget, comment_tab) -#: kcm_hotkeys/hotkeys_context_menu.cpp:311 -#: kcm_hotkeys/hotkeys_context_menu.cpp:340 -#: kcm_hotkeys/hotkeys_context_menu.cpp:369 kcm_hotkeys/hotkeys_model.cpp:91 +#: kcm_hotkeys/hotkeys_context_menu.cpp:312 +#: kcm_hotkeys/hotkeys_context_menu.cpp:341 +#: kcm_hotkeys/hotkeys_context_menu.cpp:370 kcm_hotkeys/hotkeys_model.cpp:92 #: kcm_hotkeys/hotkeys_widget_base.ui:23 msgid "Comment" msgstr "टिप्पणी" -#: kcm_hotkeys/hotkeys_context_menu.cpp:311 -#: kcm_hotkeys/hotkeys_context_menu.cpp:340 -#: kcm_hotkeys/hotkeys_context_menu.cpp:369 +#: kcm_hotkeys/hotkeys_context_menu.cpp:312 +#: kcm_hotkeys/hotkeys_context_menu.cpp:341 +#: kcm_hotkeys/hotkeys_context_menu.cpp:370 msgid "New Action" msgstr "नयी क्रिया" @@ -556,48 +556,48 @@ "same name." msgstr "" -#: kcm_hotkeys/hotkeys_model.cpp:402 +#: kcm_hotkeys/hotkeys_model.cpp:403 msgctxt "action name" msgid "Name" msgstr "नाम" -#: kcm_hotkeys/hotkeys_model.cpp:406 +#: kcm_hotkeys/hotkeys_model.cpp:407 msgctxt "action enabled" msgid "Enabled" msgstr "सक्षम" -#: kcm_hotkeys/hotkeys_model.cpp:409 +#: kcm_hotkeys/hotkeys_model.cpp:410 msgid "Type" msgstr "क़िस्म" -#: kcm_hotkeys/kcm_hotkeys.cpp:97 +#: kcm_hotkeys/kcm_hotkeys.cpp:110 msgid "KDE Hotkeys Configuration Module" msgstr "केडीई हॉट-की कॉन्फ़िगरेशन मॉड्यूल" -#: kcm_hotkeys/kcm_hotkeys.cpp:101 +#: kcm_hotkeys/kcm_hotkeys.cpp:114 msgid "Copyright 2008 (c) Michael Jansen" msgstr "सर्वाधिकार (c) 2008 माइकल जानसन" -#: kcm_hotkeys/kcm_hotkeys.cpp:104 +#: kcm_hotkeys/kcm_hotkeys.cpp:117 msgid "Michael Jansen" msgstr "माइकल जानसन" -#: kcm_hotkeys/kcm_hotkeys.cpp:105 +#: kcm_hotkeys/kcm_hotkeys.cpp:118 msgid "Maintainer" msgstr "मेंटेनर" -#: kcm_hotkeys/kcm_hotkeys.cpp:333 +#: kcm_hotkeys/kcm_hotkeys.cpp:346 msgid "" "The current action has unsaved changes. If you continue these changes will " "be lost." msgstr "" "इस क्रिया में सहेजे नहीं गए परिवर्तन हैं. यदि आपके जारी रखते हैं तो परिवर्तन मिट जाएंगे!" -#: kcm_hotkeys/kcm_hotkeys.cpp:334 +#: kcm_hotkeys/kcm_hotkeys.cpp:347 msgid "Save changes" msgstr "परिवर्तन सहेजें" -#: kcm_hotkeys/kcm_hotkeys.cpp:367 kcm_hotkeys/kcm_hotkeys.cpp:391 +#: kcm_hotkeys/kcm_hotkeys.cpp:380 kcm_hotkeys/kcm_hotkeys.cpp:404 msgid "" "Unable to contact khotkeys. Your changes are saved, but they could not be " "activated." @@ -646,11 +646,11 @@ msgid "Window loses focus" msgstr "" -#: libkhotkeysprivate/actions/activate_window_action.cpp:86 +#: libkhotkeysprivate/actions/activate_window_action.cpp:91 msgid "Activate window: " msgstr "विंडो सक्रिय करें: " -#: libkhotkeysprivate/actions/command_url_action.cpp:80 +#: libkhotkeysprivate/actions/command_url_action.cpp:79 msgid "Command/URL : " msgstr "कमांड/ यूआरएलः " @@ -704,11 +704,11 @@ msgid "Or" msgstr "या" -#: libkhotkeysprivate/khotkeysglobal.h:41 +#: libkhotkeysprivate/khotkeysglobal.h:40 msgid "Menu Editor entries" msgstr "मेन्यू संपादक प्रविष्टियाँ" -#: libkhotkeysprivate/settings.cpp:319 +#: libkhotkeysprivate/settings.cpp:318 msgid "" "This \"actions\" file has already been imported before. Are you sure you " "want to import it again?" @@ -716,7 +716,7 @@ "यह \"फ़ाइल\" पहले ही आयातित कर लिया गया है. क्या आप सुनिश्चित हैं कि आप इसे फिर से " "आयात करना चाहते हैं?" -#: libkhotkeysprivate/settings.cpp:347 +#: libkhotkeysprivate/settings.cpp:346 msgid "" "This \"actions\" file has no ImportId field and therefore it cannot be " "determined whether or not it has been imported already. Are you sure you " @@ -727,7 +727,7 @@ msgid "Gesture trigger" msgstr "गेस्चर ट्रिगर" -#: libkhotkeysprivate/triggers/shortcut_trigger.cpp:156 +#: libkhotkeysprivate/triggers/shortcut_trigger.cpp:137 msgid "Shortcut trigger: " msgstr "शॉर्टकट ट्रिगरः " diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kinfocenter.po kde-l10n-hi-4.13.0/messages/kde-workspace/kinfocenter.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kinfocenter.po 2013-10-16 03:07:22.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kinfocenter.po 2014-02-08 06:26:18.000000000 +0000 @@ -8,7 +8,7 @@ msgstr "" "Project-Id-Version: kinfocenter\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-10-16 01:35+0000\n" +"POT-Creation-Date: 2014-02-08 05:23+0000\n" "PO-Revision-Date: 2008-07-09 10:50+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" "Language-Team: Hindi <Indlinux-hindi@lists.sourceforge.net>\n" @@ -25,9 +25,9 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" -#: infocenter.cpp:58 +#: infocenter.cpp:57 #, fuzzy #| msgid "KDE Info Center" msgctxt "Main window title" @@ -68,32 +68,32 @@ msgid "Search Modules" msgstr "" -#: infocenter.cpp:255 +#: infocenter.cpp:250 msgid "Export of the module has produced no output." msgstr "" -#: infocenter.cpp:265 +#: infocenter.cpp:261 msgid "Unable to open file to write export information" msgstr "" -#: infocenter.cpp:270 +#: infocenter.cpp:266 #, kde-format msgid "Export information for %1" msgstr "" -#: infocenter.cpp:274 +#: infocenter.cpp:270 #, fuzzy #| msgid "Information" msgid "Information exported" msgstr "जानकारी" -#: infokcmmodel.cpp:32 +#: infokcmmodel.cpp:31 #, fuzzy #| msgid "Information" msgid "Information Modules" msgstr "जानकारी" -#: kcmcontainer.cpp:111 +#: kcmcontainer.cpp:117 #, kde-format msgid "%1 ( %2 )" msgstr "" @@ -104,65 +104,65 @@ msgid "Main Toolbar" msgstr "" -#: main.cpp:37 main.cpp:44 +#: main.cpp:41 msgid "KDE Info Center" msgstr "केडीई जानकारी केंद्र" -#: main.cpp:45 +#: main.cpp:42 msgid "The KDE Info Center" msgstr "केडीई जानकारी केंद्र" -#: main.cpp:46 +#: main.cpp:43 #, fuzzy #| msgid "(c) 1998-2004, The KDE Control Center Developers" msgid "(c) 2009-2010, The KDE SC KInfocenter Development Team" msgstr "(c) 1998-2004, केडीई नियंत्रण केंद्र डेवलपर्स" -#: main.cpp:50 +#: main.cpp:48 msgid "David Hubner" msgstr "" -#: main.cpp:50 +#: main.cpp:48 msgid "Current Maintainer" msgstr "वर्तमान मेंटेनर" -#: main.cpp:51 +#: main.cpp:49 msgid "Helge Deller" msgstr "हेल्ग डेलर" -#: main.cpp:51 +#: main.cpp:49 msgid "Previous Maintainer" msgstr "पूर्व मेंटेनर" -#: main.cpp:52 +#: main.cpp:50 msgid "Matthias Hoelzer-Kluepfel" msgstr "मैथियास होल्ज़र-क्लूपफेल" -#: main.cpp:53 +#: main.cpp:51 msgid "Matthias Elter" msgstr "मैथियास एल्टर" -#: main.cpp:54 +#: main.cpp:52 msgid "Matthias Ettrich" msgstr "मेथियास एट्रिच" -#: main.cpp:55 +#: main.cpp:53 msgid "Waldo Bastian" msgstr "वाल्दो बास्तियान" -#: main.cpp:56 +#: main.cpp:54 msgid "Nicolas Ternisien" msgstr "निकोलस टेरनीसिएन" -#: sidepanel.cpp:103 +#: sidepanel.cpp:99 msgid "Clear Search" msgstr "" -#: sidepanel.cpp:106 +#: sidepanel.cpp:102 msgid "Expand All Categories" msgstr "" -#: sidepanel.cpp:109 +#: sidepanel.cpp:105 msgid "Collapse All Categories" msgstr "" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/klipper.po kde-l10n-hi-4.13.0/messages/kde-workspace/klipper.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/klipper.po 2014-01-15 03:22:32.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/klipper.po 2014-01-14 07:06:57.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: klipper\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-01-15 01:38+0000\n" +"POT-Creation-Date: 2014-01-14 05:45+0000\n" "PO-Revision-Date: 2007-10-28 16:31+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -18,6 +18,14 @@ "Plural-Forms: nplurals=2; plural=(n!=1);\n" "X-Generator: KBabel 1.11.4\n" +msgctxt "NAME OF TRANSLATORS" +msgid "Your names" +msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर" + +msgctxt "EMAIL OF TRANSLATORS" +msgid "Your emails" +msgstr "raviratlami@aol.in" + #. i18n: ectx: property (text), widget (QCheckBox, kcfg_ReplayActionInHistory) #: actionsconfig.ui:17 #, fuzzy @@ -51,7 +59,7 @@ msgstr "" #. i18n: ectx: property (text), widget (ActionsTreeWidget, kcfg_ActionList) -#: actionsconfig.ui:54 editactiondialog.cpp:224 +#: actionsconfig.ui:54 editactiondialog.cpp:223 msgid "Description" msgstr "वर्णन" @@ -93,7 +101,7 @@ "wikipedia.org/wiki/Regular_expression\">Wikipedia entry about this topic</a>." msgstr "" -#: configdialog.cpp:38 +#: configdialog.cpp:36 #, fuzzy #| msgid " sec" msgid " second" @@ -101,7 +109,7 @@ msgstr[0] "सेक." msgstr[1] "सेक." -#: configdialog.cpp:39 +#: configdialog.cpp:37 #, fuzzy #| msgid " entry" #| msgid_plural " entries" @@ -110,54 +118,54 @@ msgstr[0] " प्रविष्टि" msgstr[1] " प्रविष्टि" -#: configdialog.cpp:265 +#: configdialog.cpp:263 msgid "Advanced Settings" msgstr "विस्तृत विन्यास" -#: configdialog.cpp:284 +#: configdialog.cpp:286 #, fuzzy #| msgid "&General" msgctxt "General Config" msgid "General" msgstr "सामान्य (&G)" -#: configdialog.cpp:284 +#: configdialog.cpp:286 #, fuzzy #| msgid "&General" msgid "General Configuration" msgstr "सामान्य (&G)" -#: configdialog.cpp:285 +#: configdialog.cpp:287 #, fuzzy #| msgid "Ac&tions" msgctxt "Actions Config" msgid "Actions" msgstr "क्रियाएँ (&t)" -#: configdialog.cpp:285 +#: configdialog.cpp:287 #, fuzzy #| msgid "Ac&tions" msgid "Actions Configuration" msgstr "क्रियाएँ (&t)" -#: configdialog.cpp:289 +#: configdialog.cpp:291 #, fuzzy #| msgid "&Shortcuts" msgctxt "Shortcuts Config" msgid "Shortcuts" msgstr "शॉर्टकट्स (&S)" -#: configdialog.cpp:289 +#: configdialog.cpp:291 #, fuzzy #| msgid "&Shortcuts" msgid "Shortcuts Configuration" msgstr "शॉर्टकट्स (&S)" -#: configdialog.cpp:379 +#: configdialog.cpp:381 msgid "D&isable Actions for Windows of Type WM_CLASS" msgstr "WM_CLASS प्रकार के विंडोज़ के लिए क्रियाएँ अक्षम करें (&i)" -#: configdialog.cpp:387 +#: configdialog.cpp:389 msgid "" "<qt>This lets you specify windows in which Klipper should not invoke " "\"actions\". Use<br /><br /><center><b>xprop | grep WM_CLASS</b></" @@ -166,43 +174,43 @@ "equal sign is the one you need to enter here.</qt>" msgstr "" -#: editactiondialog.cpp:36 +#: editactiondialog.cpp:35 msgid "Ignore" msgstr "" -#: editactiondialog.cpp:38 +#: editactiondialog.cpp:37 #, fuzzy #| msgid "Clipboard" msgid "Replace Clipboard" msgstr "क्लिपबोर्ड" -#: editactiondialog.cpp:40 +#: editactiondialog.cpp:39 #, fuzzy #| msgid "Clipboard" msgid "Add to Clipboard" msgstr "क्लिपबोर्ड" -#: editactiondialog.cpp:220 +#: editactiondialog.cpp:219 #, fuzzy #| msgid "Add Command" msgid "Command" msgstr "कमांड जोड़ें" -#: editactiondialog.cpp:222 +#: editactiondialog.cpp:221 msgid "Output Handling" msgstr "" -#: editactiondialog.cpp:264 +#: editactiondialog.cpp:263 msgid "Action Properties" msgstr "" -#: editactiondialog.cpp:367 +#: editactiondialog.cpp:366 #, fuzzy #| msgid "<new command>" msgid "new command" msgstr "<नया कमांड>" -#: editactiondialog.cpp:368 +#: editactiondialog.cpp:367 #, fuzzy #| msgid "Description" msgid "Command Description" @@ -315,58 +323,58 @@ msgid "Clipboard history size:" msgstr "क्लिपबोर्ड इतिहास आकारः (&l)" -#: klipper.cpp:150 +#: klipper.cpp:147 #, fuzzy #| msgid "Enable/Disable Clipboard Actions" msgid "Enable Clipboard Actions" msgstr "क्लिपबोर्ड क्रियाओं को सक्षम/अक्षम करें " -#: klipper.cpp:176 +#: klipper.cpp:173 msgid "C&lear Clipboard History" msgstr "क्लिपबोर्ड इतिहास साफ करें (&l)" -#: klipper.cpp:182 +#: klipper.cpp:179 msgid "&Configure Klipper..." msgstr "कॉन्फ़िगर क्लिपर (&C)" -#: klipper.cpp:187 +#: klipper.cpp:184 #, fuzzy #| msgid "&Quit" msgctxt "@item:inmenu Quit Klipper" msgid "&Quit" msgstr "बाहर जाएँ (&Q)" -#: klipper.cpp:191 +#: klipper.cpp:188 msgid "Manually Invoke Action on Current Clipboard" msgstr "मौज़ूदा क्लिपबोर्ड पर क्रिया हाथों से इन्वोक करें" -#: klipper.cpp:198 +#: klipper.cpp:195 msgid "&Edit Contents..." msgstr "विषय-वस्तु का संपादन करें.... (&E)" -#: klipper.cpp:205 +#: klipper.cpp:202 msgid "&Show Barcode..." msgstr "" -#: klipper.cpp:212 +#: klipper.cpp:209 #, fuzzy #| msgid "C&lipboard history size:" msgid "Next History Item" msgstr "क्लिपबोर्ड इतिहास आकारः (&l)" -#: klipper.cpp:216 +#: klipper.cpp:213 #, fuzzy #| msgid "C&lipboard history size:" msgid "Previous History Item" msgstr "क्लिपबोर्ड इतिहास आकारः (&l)" -#: klipper.cpp:222 +#: klipper.cpp:219 #, fuzzy #| msgid "&Popup menu at mouse-cursor position" msgid "Open Klipper at Mouse Position" msgstr "माउस संकेतक स्थान पर पॉपअप मेन्यू (&P)" -#: klipper.cpp:473 +#: klipper.cpp:472 #, fuzzy #| msgid "" #| "You can enable URL actions later by right-clicking on the Klipper icon " @@ -378,7 +386,7 @@ "क्लिपर प्रतीक के ऊपर दायाँ-क्लिक कर तथा 'क्रिया सक्षम करें' चुन कर आप यूआरएल क्रियाओं को " "सक्षम कर सकते हैं" -#: klipper.cpp:501 +#: klipper.cpp:500 #, fuzzy #| msgid "" #| "Should Klipper start automatically\n" @@ -388,27 +396,27 @@ "क्या क्लिपर स्वचलित प्रारंभ हो\n" "जब आप लॉगइन हों?" -#: klipper.cpp:502 +#: klipper.cpp:501 msgid "Automatically Start Klipper?" msgstr "क्लिपर स्वचलित प्रारंभ करें?" -#: klipper.cpp:502 +#: klipper.cpp:501 msgid "Start" msgstr "प्रारंभ" -#: klipper.cpp:503 +#: klipper.cpp:502 msgid "Do Not Start" msgstr "चालू नहीं करें" -#: klipper.cpp:848 klipperpopup.cpp:95 +#: klipper.cpp:912 msgid "KDE cut & paste history utility" msgstr "केडीई काटें एवं चिपकाएं इतिहास यूटिलिटी " -#: klipper.cpp:852 tray.cpp:36 +#: klipper.cpp:916 tray.cpp:37 msgid "Klipper" msgstr "क्लिपर" -#: klipper.cpp:854 +#: klipper.cpp:918 #, fuzzy #| msgid "" #| "(c) 1998, Andrew Stanley-Jones\n" @@ -423,81 +431,81 @@ "1998-2002, कार्स्टेन पेइफ़र\n" "2001, पेट्रिक डुबराय" -#: klipper.cpp:858 +#: klipper.cpp:922 msgid "Carsten Pfeiffer" msgstr "कार्स्टेन फेइफर" -#: klipper.cpp:859 +#: klipper.cpp:923 msgid "Author" msgstr "लेखक" -#: klipper.cpp:862 +#: klipper.cpp:926 msgid "Andrew Stanley-Jones" msgstr "एंड्रयू स्टेनली-जोन्स" -#: klipper.cpp:863 +#: klipper.cpp:927 msgid "Original Author" msgstr "मूल लेखक" -#: klipper.cpp:866 +#: klipper.cpp:930 msgid "Patrick Dubroy" msgstr "पेट्रिक डुबराय" -#: klipper.cpp:867 +#: klipper.cpp:931 msgid "Contributor" msgstr "सहयोगी" -#: klipper.cpp:870 +#: klipper.cpp:934 msgid "Luboš Luňák" msgstr "Luboš Luňák" -#: klipper.cpp:871 +#: klipper.cpp:935 msgid "Bugfixes and optimizations" msgstr "बगफिक्सेस तथा ऑप्टीमाइजेशन्स" -#: klipper.cpp:874 +#: klipper.cpp:938 msgid "Esben Mose Hansen" msgstr "एसबेन मोज़ हैनसन" -#: klipper.cpp:875 +#: klipper.cpp:939 msgid "Maintainer" msgstr "मेंटेनर" -#: klipper.cpp:898 +#: klipper.cpp:962 msgid "Edit Contents" msgstr "विषय-वस्तु का संपादन करें" -#: klipper.cpp:931 +#: klipper.cpp:995 msgid "Mobile Barcode" msgstr "" -#: klipper.cpp:959 +#: klipper.cpp:1023 #, fuzzy #| msgid "C&lear Clipboard History" msgid "Really delete entire clipboard history?" msgstr "क्लिपबोर्ड इतिहास साफ करें (&l)" -#: klipper.cpp:960 +#: klipper.cpp:1024 #, fuzzy #| msgid "C&lear Clipboard History" msgid "Delete clipboard history?" msgstr "क्लिपबोर्ड इतिहास साफ करें (&l)" -#: klipper.cpp:978 klipper.cpp:987 +#: klipper.cpp:1042 klipper.cpp:1051 #, fuzzy #| msgid "C&lipboard history size:" msgid "Clipboard history" msgstr "क्लिपबोर्ड इतिहास आकारः (&l)" -#: klipper.cpp:1004 +#: klipper.cpp:1068 msgid "up" msgstr "" -#: klipper.cpp:1011 +#: klipper.cpp:1075 msgid "current" msgstr "" -#: klipper.cpp:1018 +#: klipper.cpp:1082 msgid "down" msgstr "" @@ -658,40 +666,32 @@ msgid "&More" msgstr "अधिक (&M)" -#: tray.cpp:38 +#: tray.cpp:39 #, fuzzy #| msgid "Save clipboard contents on e&xit" msgid "Clipboard Contents" msgstr "बाहर होने पर क्लिपबोर्ड की वस्तुओं को सहेजें (&x)" -#: tray.cpp:38 tray.cpp:55 +#: tray.cpp:39 tray.cpp:56 #, fuzzy #| msgid "C&lipboard history size:" msgid "Clipboard is empty" msgstr "क्लिपबोर्ड इतिहास आकारः (&l)" -#: urlgrabber.cpp:229 +#: urlgrabber.cpp:222 #, fuzzy, kde-format #| msgid " - Actions For: " msgid "%1 - Actions For: %2" msgstr "के लिए क्रियाः" -#: urlgrabber.cpp:257 +#: urlgrabber.cpp:250 msgid "Disable This Popup" msgstr "इस पॉपअप को अक्षम करें" -#: urlgrabber.cpp:263 +#: urlgrabber.cpp:256 msgid "&Cancel" msgstr "रद्द करें (&C)" -#~ msgctxt "NAME OF TRANSLATORS" -#~ msgid "Your names" -#~ msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर" - -#~ msgctxt "EMAIL OF TRANSLATORS" -#~ msgid "Your emails" -#~ msgstr "raviratlami@aol.in," - #, fuzzy #~| msgid "Enable/Disable Clipboard Actions" #~ msgid "Enable Clipboard &Actions" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kmenuedit.po kde-l10n-hi-4.13.0/messages/kde-workspace/kmenuedit.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kmenuedit.po 2013-10-16 03:07:22.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kmenuedit.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kmenuedit\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-10-16 01:35+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2008-07-09 10:57+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -24,25 +24,9 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" -#: basictab.cpp:75 -msgid "&Name:" -msgstr "नाम: (&N)" - -#: basictab.cpp:83 -msgid "&Description:" -msgstr "वर्णनः (&D)" - -#: basictab.cpp:91 -msgid "&Comment:" -msgstr "टिप्पणीः (&C)" - -#: basictab.cpp:99 -msgid "Co&mmand:" -msgstr "कमांडः (&m)" - -#: basictab.cpp:104 +#: basictab.cpp:72 msgid "" "Following the command, you can have several place holders which will be " "replaced with the actual values when the actual program is run:\n" @@ -58,51 +42,67 @@ "%c - the caption" msgstr "" -#: basictab.cpp:119 +#: basictab.cpp:84 msgid "Enable &launch feedback" msgstr "लांच फ़ीडबैक सक्षम करें (&l)" -#: basictab.cpp:123 +#: basictab.cpp:85 msgid "&Place in system tray" msgstr "तंत्र तश्तरी में रखें (&P)" -#: basictab.cpp:127 +#: basictab.cpp:86 msgid "Only show in KDE" msgstr "सिर्फ केडीई में दिखाएं" -#: basictab.cpp:131 +#: basictab.cpp:87 msgid "Hidden entry" msgstr "छुपी प्रविष्टि" -#: basictab.cpp:143 preferencesdlg.cpp:75 +#: basictab.cpp:91 +msgid "&Name:" +msgstr "नाम: (&N)" + +#: basictab.cpp:93 +msgid "&Description:" +msgstr "वर्णनः (&D)" + +#: basictab.cpp:95 +msgid "&Comment:" +msgstr "टिप्पणीः (&C)" + +#: basictab.cpp:97 +msgid "Co&mmand:" +msgstr "कमांडः (&m)" + +#: basictab.cpp:138 preferencesdlg.cpp:37 msgid "General" msgstr "सामान्य" -#: basictab.cpp:157 +#: basictab.cpp:149 msgid "&Work path:" msgstr "कार्य पथः (&W)" -#: basictab.cpp:171 +#: basictab.cpp:168 msgid "Run in term&inal" msgstr "टर्मिनल में चलाएँ (&i)" -#: basictab.cpp:177 +#: basictab.cpp:176 msgid "Terminal &options:" msgstr "टर्मिनल विकल्पः (&o)" -#: basictab.cpp:192 +#: basictab.cpp:196 msgid "&Run as a different user" msgstr "भिन्न उपयोगकर्ता जैसे चलाएँ (&R)" -#: basictab.cpp:198 +#: basictab.cpp:204 msgid "&Username:" msgstr "उपयोक्ता नाम: (&U)" -#: basictab.cpp:213 +#: basictab.cpp:226 msgid "Current shortcut &key:" msgstr "मौज़ूदा शॉर्टकट कुंजीः (&k)" -#: basictab.cpp:224 +#: basictab.cpp:236 msgid "Advanced" msgstr "विस्तृत" @@ -112,63 +112,63 @@ "activated." msgstr "" -#: kmenuedit.cpp:76 +#: kmenuedit.cpp:79 msgid "&New Submenu..." msgstr "नया सब मेन्यू... (&N)" -#: kmenuedit.cpp:80 +#: kmenuedit.cpp:83 msgid "New &Item..." msgstr "नई वस्तु... (&I)" -#: kmenuedit.cpp:84 +#: kmenuedit.cpp:87 msgid "New S&eparator" msgstr "नया सेपरेटर (&e)" -#: kmenuedit.cpp:88 +#: kmenuedit.cpp:91 msgid "&Sort" msgstr "" -#: kmenuedit.cpp:92 +#: kmenuedit.cpp:95 #, fuzzy #| msgid "&Description:" msgid "&Sort selection by Name" msgstr "वर्णनः (&D)" -#: kmenuedit.cpp:95 +#: kmenuedit.cpp:98 #, fuzzy #| msgid "&Description:" msgid "&Sort selection by Description" msgstr "वर्णनः (&D)" -#: kmenuedit.cpp:99 +#: kmenuedit.cpp:102 msgid "&Sort all by Name" msgstr "" -#: kmenuedit.cpp:102 +#: kmenuedit.cpp:105 #, fuzzy #| msgid "&Description:" msgid "&Sort all by Description" msgstr "वर्णनः (&D)" -#: kmenuedit.cpp:108 +#: kmenuedit.cpp:111 msgid "Move &Up" msgstr "" -#: kmenuedit.cpp:111 +#: kmenuedit.cpp:114 msgid "Move &Down" msgstr "" -#: kmenuedit.cpp:119 +#: kmenuedit.cpp:122 #, fuzzy #| msgid "Restore to system menu" msgid "Restore to System Menu" msgstr "तंत्र मेन्यू में बहाल करें" -#: kmenuedit.cpp:195 +#: kmenuedit.cpp:202 msgid "&Delete" msgstr "मिटाएँ (&D)" -#: kmenuedit.cpp:219 +#: kmenuedit.cpp:226 msgid "" "You have made changes to the menu.\n" "Do you want to save the changes or discard them?" @@ -176,7 +176,7 @@ "आपने मेन्यू में परिवर्तन किए हैं.\n" "क्या आप परिवर्तनों को सहेजना चाहेंगे या रद्द करना चाहेंगे?" -#: kmenuedit.cpp:221 +#: kmenuedit.cpp:228 msgid "Save Menu Changes?" msgstr "मेन्यू परिवर्तन सहेजें?" @@ -195,43 +195,43 @@ msgid "Main Toolbar" msgstr "मुख्य औज़ार पट्टी" -#: main.cpp:34 +#: main.cpp:32 msgid "KDE menu editor" msgstr "केडीई मेनू संपादक" -#: main.cpp:48 main.cpp:58 main.cpp:71 +#: main.cpp:63 msgid "KDE Menu Editor" msgstr "केडीई मेन्यू संपादक" -#: main.cpp:60 +#: main.cpp:65 msgid "(C) 2000-2003, Waldo Bastian, Raffaele Sandrini, Matthias Elter" msgstr "(C) 2000-2003, वाल्दो बास्तियान, राफेल सांद्रीनी, मैथियास एल्टर" -#: main.cpp:61 +#: main.cpp:66 msgid "Waldo Bastian" msgstr "वाल्दो बास्तियान" -#: main.cpp:61 +#: main.cpp:66 msgid "Maintainer" msgstr "मेंटेनर" -#: main.cpp:62 +#: main.cpp:67 msgid "Raffaele Sandrini" msgstr "राफेल सांद्रीनी" -#: main.cpp:62 +#: main.cpp:67 msgid "Previous Maintainer" msgstr "पूर्व मेंटेनर" -#: main.cpp:63 +#: main.cpp:68 msgid "Matthias Elter" msgstr "मैथियास एल्टर" -#: main.cpp:63 +#: main.cpp:68 msgid "Original Author" msgstr "मूल लेखक" -#: main.cpp:64 +#: main.cpp:69 msgid "Montel Laurent" msgstr "मोंटेल लारेंट" @@ -239,63 +239,57 @@ msgid "Sub menu to pre-select" msgstr "सब मेन्यू टू प्री-सलेक्ट" -#: main.cpp:78 +#: main.cpp:76 msgid "Menu entry to pre-select" msgstr "मेन्यू एन्ट्री टू प्री-सलेक्ट" -#: menufile.cpp:101 menufile.cpp:114 +#: menufile.cpp:102 menufile.cpp:115 #, kde-format msgid "Could not write to %1" msgstr " %1 पर लिख नहीं सका" -#: preferencesdlg.cpp:38 -#, fuzzy -#| msgid "Terminal &options:" -msgid "General options" -msgstr "टर्मिनल विकल्पः (&o)" - -#: preferencesdlg.cpp:43 +#: preferencesdlg.cpp:42 msgid "Spell Checking" msgstr "वर्तनी की जांच " -#: preferencesdlg.cpp:44 +#: preferencesdlg.cpp:43 msgid "Spell checking Options" msgstr "वर्तनी जाँच के लिए विकल्प" -#: preferencesdlg.cpp:77 +#: preferencesdlg.cpp:74 msgid "Show hidden entries" msgstr "छुपी प्रविष्टियाँ दिखाएँ" -#: treeview.cpp:194 +#: treeview.cpp:192 msgid " [Hidden]" msgstr "(छुपा)" -#: treeview.cpp:1132 +#: treeview.cpp:1134 msgid "New Submenu" msgstr "नया सब-मेन्यू" -#: treeview.cpp:1133 +#: treeview.cpp:1135 msgid "Submenu name:" msgstr "सब-मेन्यू नामः" -#: treeview.cpp:1202 +#: treeview.cpp:1204 msgid "New Item" msgstr "नई वस्तु" -#: treeview.cpp:1203 +#: treeview.cpp:1205 msgid "Item name:" msgstr "वस्तु का नामः" -#: treeview.cpp:1692 +#: treeview.cpp:1694 #, kde-format msgid "All submenus of '%1' will be removed. Do you want to continue?" msgstr "'%1' के सभी सबमेन्यू मिटा दिए जाएंगे. क्या आप जारी रखना चाहते हैं?" -#: treeview.cpp:1858 +#: treeview.cpp:1860 msgid "Menu changes could not be saved because of the following problem:" msgstr "निम्न कारणों की वजह से मेन्यू परिवर्तनों को सहेजा नहीं जा सकता:" -#: treeview.cpp:1903 +#: treeview.cpp:1905 msgid "" "Do you want to restore the system menu? Warning: This will remove all custom " "menus." diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/krandr.po kde-l10n-hi-4.13.0/messages/kde-workspace/krandr.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/krandr.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/krandr.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,591 @@ +# translation of krandr.po to Hindi +# Copyright (C) 2004, 2007, 2008 Free Software Foundation, Inc. +# +# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2004. +# Ravishankar Shrivastava <raviratlami@gmail.com>, 2004. +# G Karunakar <karunakar@indlinux.org>, 2007. +# Ravishankar Shrivastava <raviratlami@aol.in>, 2008. +msgid "" +msgstr "" +"Project-Id-Version: krandr\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2008-07-09 11:33+0530\n" +"Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" +"Language-Team: Hindi <Indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" + +msgctxt "NAME OF TRANSLATORS" +msgid "Your names" +msgstr "रविशंकर श्रीवास्तव" + +msgctxt "EMAIL OF TRANSLATORS" +msgid "Your emails" +msgstr "raviratlami@gmail.com" + +#: krandrmodule.cpp:47 +msgid "" +"Your X server does not support resizing and rotating the display. Please " +"update to version 4.3 or greater. You need the X Resize, Rotate, and Reflect " +"extension (RANDR) version 1.1 or greater to use this feature." +msgstr "" + +#: krandrtray.cpp:94 +msgid "Required X Extension Not Available" +msgstr "आवश्यक X विस्तार उपलब्ध नहीं है" + +#: krandrtray.cpp:111 legacyrandrconfig.cpp:38 +#, kde-format +msgid "Screen %1" +msgstr "स्क्रीन %1" + +#: krandrtray.cpp:134 +msgid "Configure Display..." +msgstr "कॉन्फ़िगर प्रकटन..." + +#: krandrtray.cpp:152 +msgid "Display" +msgstr "" + +#: krandrtray.cpp:153 +msgid "Resize, rotate and configure screens." +msgstr "" + +#: krandrtray.cpp:170 +#, kde-format +msgid "Resolution: %1 x %2" +msgstr "" + +#: krandrtray.cpp:185 +#, fuzzy, kde-format +#| msgid "No Rotation" +msgid "Rotation: %1" +msgstr "कोई घूर्णन नहीं" + +#: krandrtray.cpp:200 +#, fuzzy +#| msgid "Disabled" +msgid "Disabled" +msgstr "अक्षम" + +#: krandrtray.cpp:218 +#, kde-format +msgid "<td align=\"right\">Resolution: </td><td>%1 x %2</td></tr>" +msgstr "" + +#: krandrtray.cpp:224 +#, fuzzy +#| msgid "Refresh:" +msgid "Refresh: " +msgstr "ताज़ा करें:" + +#: krandrtray.cpp:225 krandrtray.cpp:512 legacyrandrconfig.cpp:274 +#: legacyrandrscreen.cpp:246 outputconfig.cpp:501 +#, kde-format +msgid "%1 Hz" +msgstr "%1 हर्त्ज" + +#: krandrtray.cpp:233 +#, fuzzy +#| msgid "No Rotation" +msgid "Rotation: " +msgstr "कोई घूर्णन नहीं" + +#: krandrtray.cpp:270 +msgid "Screen configuration has changed" +msgstr "स्क्रीन कॉन्फ़िगरेशन बदला गया" + +#: krandrtray.cpp:305 krandrtray.cpp:430 +msgid "Screen Size" +msgstr "स्क्रीन आकार" + +#: krandrtray.cpp:313 krandrtray.cpp:379 krandrtray.cpp:443 +msgid "Orientation" +msgstr "दिशा" + +#: krandrtray.cpp:330 +msgid "Outputs" +msgstr "आउटपुट" + +#: krandrtray.cpp:346 +#, kde-format +msgid "%1 - Screen Size" +msgstr "%1 - स्क्रीन आकार" + +#: krandrtray.cpp:363 +msgid "Disable" +msgstr "अक्षम" + +#: krandrtray.cpp:389 krandrtray.cpp:452 +msgid "Refresh Rate" +msgstr "रिफ्रेश दर" + +#: krandrtray.cpp:400 +msgctxt "(checkbox) designate this output as the primary output" +msgid "Primary output" +msgstr "" + +#: krandrtray.cpp:418 +msgid "Unify Outputs" +msgstr "संयुक्त आउटपुट" + +#: krandrtray.cpp:606 +msgid "Configure Display" +msgstr "प्रकटन कॉन्फ़िगर करें" + +#: ktimerdialog.cpp:167 +#, kde-format +msgid "1 second remaining:" +msgid_plural "%1 seconds remaining:" +msgstr[0] "१ सेकण्ड बाकी:" +msgstr[1] "%1 सेकण्ड बाकी:" + +#. i18n: ectx: property (windowTitle), widget (QWidget, LegacyRandRConfigBase) +#: legacyrandrconfigbase.ui:14 +msgid "Screen Resize and Rotate Settings" +msgstr "स्क्रीन आकार बदलना व घुमाना सेटिंग" + +#. i18n: ectx: property (whatsThis), widget (QWidget, LegacyRandRConfigBase) +#: legacyrandrconfigbase.ui:17 +msgid "" +"If this option is enabled, options set by the system tray applet will be " +"saved and loaded when KDE starts instead of being temporary." +msgstr "" +"यदि यह विकल्प सक्षम किया जाता है, तंत्र तश्तरी में सेट किए गए विकल्पों को सहेजा जाएगा व " +"केडीई प्रारंभ होगा तब लोड होगा बजाए कि वह अस्थाई रहे." + +#. i18n: ectx: property (text), widget (QLabel, screenLabel) +#: legacyrandrconfigbase.ui:25 +msgid "Settings for screen:" +msgstr "स्क्रीन के लिए विन्यासः" + +#. i18n: ectx: property (whatsThis), widget (KComboBox, screenCombo) +#: legacyrandrconfigbase.ui:38 +msgid "" +"The screen whose settings you would like to change can be selected using " +"this drop-down list." +msgstr "" +"जिस स्क्रीन का विन्यास आप बदलना चाहते हैं, ड्राप-डाउन सूची के उपयोग से आप उसे चुन सकते हैं." + +#. i18n: ectx: property (text), widget (QLabel, sizeLabel) +#: legacyrandrconfigbase.ui:49 +msgid "Screen size:" +msgstr "स्क्रीन आकारः" + +#. i18n: ectx: property (whatsThis), widget (KComboBox, sizeCombo) +#: legacyrandrconfigbase.ui:62 +msgid "" +"The size, otherwise known as the resolution, of your screen can be selected " +"from this drop-down list." +msgstr "" +"आकार, जो कि अन्य प्रकार से आपके स्क्रीन रेज़ोल्यूशन के नाम से जाना जाता है, इस ड्राप-डाउन " +"सूची से चयनित किया जा सकता है." + +#. i18n: ectx: property (text), widget (QLabel, rateLabel) +#: legacyrandrconfigbase.ui:73 +msgid "Refresh rate:" +msgstr "रिफ्रेश दरः" + +#. i18n: ectx: property (whatsThis), widget (KComboBox, rateCombo) +#: legacyrandrconfigbase.ui:83 +msgid "" +"The refresh rate of your screen can be selected from this drop-down list." +msgstr "आपके स्क्रीन का रिफ्रेश दर इस ड्राप-डाउन सूची से चयनित किया जा सकता है." + +#. i18n: ectx: property (whatsThis), widget (QGroupBox, rotationGroup) +#: legacyrandrconfigbase.ui:98 +msgid "" +"The options in this section allow you to change the rotation of your screen." +msgstr "इस वर्ग के विकल्प आपको आपके स्क्रीन को घुमाने की अनुमति देते हैं." + +#. i18n: ectx: property (title), widget (QGroupBox, rotationGroup) +#: legacyrandrconfigbase.ui:101 +msgid "Orientation (degrees counterclockwise)" +msgstr "दिशा-निर्धारण (अंश घड़ी की विपरीत दिशा में)" + +#. i18n: ectx: property (whatsThis), widget (QCheckBox, applyOnStartup) +#: legacyrandrconfigbase.ui:108 +msgid "" +"If this option is enabled the size and orientation settings will be used " +"when KDE starts." +msgstr "" +"यदि यह विकल्प सक्षम किया जाता है तो जब केडीई प्रारंभ होगा तो आकार तथा दिशा विन्यास " +"इस्तेमाल किया जाएगा." + +#. i18n: ectx: property (text), widget (QCheckBox, applyOnStartup) +#: legacyrandrconfigbase.ui:111 +msgid "Apply settings on KDE startup" +msgstr "केडीई प्रारंभ होते समय विन्यास लोड करें" + +#. i18n: ectx: property (text), widget (QCheckBox, syncTrayApp) +#: legacyrandrconfigbase.ui:118 +msgid "Allow tray application to change startup settings" +msgstr "ट्रे अनुप्रयोग को शुरुआती विन्यास परिवर्तित करने की अनुमति दें" + +#: legacyrandrscreen.cpp:140 +#, kde-format +msgid "" +"New configuration:\n" +"Resolution: %1 x %2\n" +"Orientation: %3" +msgstr "" +"नया कॉन्फ़िगरेशन:\n" +"रेजॉल्यूशन: %1 x %2\n" +"दिशा-निर्धारण: %3" + +#: legacyrandrscreen.cpp:145 +#, kde-format +msgid "" +"New configuration:\n" +"Resolution: %1 x %2\n" +"Orientation: %3\n" +"Refresh rate: %4" +msgstr "" +"नया कॉन्फ़िगरेशन:\n" +"रेजॉल्यूशन: %1 x %2\n" +"दिशा-निर्धारण: %3\n" +"रिफ्रेश दर: %4" + +#: legacyrandrscreen.cpp:236 legacyrandrscreen.cpp:241 +#, kde-format +msgctxt "Refresh rate in Hertz (Hz)" +msgid "%1 Hz" +msgstr "%1 Hz" + +#: main.cpp:33 +msgid "Resize and Rotate" +msgstr "आकार बदलें तथा घुमाएँ " + +#: main.cpp:34 +msgid "X Resize and Rotate System Tray App" +msgstr "तंत्र तश्तरी ऐपलेट का X आकार बदलें तथा घुमाएँ " + +#: main.cpp:35 +msgid "(c) 2007 Gustavo Pichorim Boiko, 2002-2003 Hamish Rodda" +msgstr "(c) 2007 गुस्तावो पिकोरिम वोइको, 2002-2003 हामिष रोद्दा" + +#: main.cpp:36 +msgid "Gustavo Pichorim Boiko" +msgstr "गुस्तावो पिकोरिम वोइको" + +#: main.cpp:36 +msgid "Maintainer" +msgstr "मेंटेनर" + +#: main.cpp:37 +msgid "Hamish Rodda" +msgstr "हामिष रोद्दा" + +#: main.cpp:37 +msgid "Original Author" +msgstr "मूल लेखक" + +#: main.cpp:38 +msgid "Lubos Lunak" +msgstr "लुबोस लुनाक" + +#: main.cpp:38 +msgid "Many fixes" +msgstr "बहुत से फिक्सेस" + +#: main.cpp:39 +msgid "Harry Bock" +msgstr "हैरी बॉक" + +#: main.cpp:39 +msgid "Many fixes, multi-head support" +msgstr "बहुत से सुधार, मल्टी हेड समर्थन" + +#: main.cpp:46 +msgid "Application is being auto-started at KDE session start" +msgstr "केडीई सत्र प्रारंभ पर अनुप्रयोग स्वतः प्रारंभ हों" + +#: outputconfig.cpp:229 +msgid "Left of" +msgstr "के बांये" + +#: outputconfig.cpp:230 +msgid "Right of" +msgstr "के दाँये" + +#: outputconfig.cpp:231 +msgctxt "Output is placed above another one" +msgid "Above" +msgstr "ऊपर" + +#: outputconfig.cpp:232 +msgctxt "Output is placed below another one" +msgid "Below" +msgstr "नीचे" + +#: outputconfig.cpp:233 +msgid "Clone of" +msgstr "का प्रतिरूप" + +#: outputconfig.cpp:234 +msgctxt "Fixed, abitrary position" +msgid "Absolute" +msgstr "निरपेक्ष" + +#: outputconfig.cpp:237 +msgid "No relative position" +msgstr "कोई सापेक्ष स्थिति नहीं" + +#: outputconfig.cpp:450 +#, fuzzy +#| msgid "Disabled" +msgctxt "Screen size" +msgid "Disabled" +msgstr "अक्षम" + +#: outputconfig.cpp:456 +#, fuzzy, kde-format +#| msgctxt "Automatic (native resolution)" +#| msgid " (Auto)" +msgctxt "Automatic screen size (native resolution)" +msgid "%1 (Auto)" +msgstr " (स्वतः)" + +#: outputconfig.cpp:494 +#, fuzzy +#| msgctxt "Automatic configuration" +#| msgid "Auto" +msgctxt "Automatic refresh rate configuration" +msgid "Auto" +msgstr "स्वतः" + +#. i18n: ectx: property (windowTitle), widget (QWidget, OutputConfigBase) +#: outputconfigbase.ui:26 +msgid "Output Config" +msgstr "आउटपुट कॉन्फिग" + +#. i18n: ectx: property (text), widget (QLabel, label_2) +#: outputconfigbase.ui:32 +msgid "Size:" +msgstr "आकारः" + +#. i18n: ectx: property (text), widget (QLabel, rateLabel) +#: outputconfigbase.ui:48 +msgid "Refresh:" +msgstr "ताज़ा करें:" + +#. i18n: ectx: property (text), widget (QLabel, orientationLabel) +#: outputconfigbase.ui:64 +msgid "Orientation:" +msgstr "दिशा निर्धारणः" + +#. i18n: ectx: property (text), widget (QLabel, positionLabel) +#: outputconfigbase.ui:80 +msgctxt "Position of the screen" +msgid "Position:" +msgstr "स्थितिः" + +#: outputgraphicsitem.cpp:72 +#, kde-format +msgctxt "Configuration options. Output name, width x height (refresh rate Hz)" +msgid "" +"%1\n" +"%2x%3 (%4 Hz)" +msgstr "" + +#: randr.cpp:32 +msgid "No Rotation" +msgstr "कोई घूर्णन नहीं" + +#: randr.cpp:34 +msgid "Left (90 degrees)" +msgstr "बायाँ (90 अंश)" + +#: randr.cpp:36 +#, fuzzy +#| msgid "Upside-down (180 degrees)" +msgid "Upside-Down (180 degrees)" +msgstr "ऊपर-नीचे (180 अंश)" + +#: randr.cpp:38 +msgid "Right (270 degrees)" +msgstr "दायाँ (270 अंश)" + +#: randr.cpp:40 +#, fuzzy +#| msgid "Mirror horizontally" +msgid "Mirror Horizontally" +msgstr "प्रतिबिम्ब आड़ा" + +#: randr.cpp:42 +#, fuzzy +#| msgid "Mirror vertically" +msgid "Mirror Vertically" +msgstr "प्रतिबिम्ब खड़ा" + +#: randr.cpp:44 randr.cpp:75 +#, fuzzy +#| msgid "Unknown orientation" +msgid "Unknown Orientation" +msgstr "अज्ञात दिशा-निर्धारण" + +#: randr.cpp:49 +#, fuzzy +#| msgid "Not rotated" +msgid "Not Rotated" +msgstr "घूमा हुआ नहीं" + +#: randr.cpp:51 +#, fuzzy +#| msgid "Rotated 90 degrees counterclockwise" +msgid "Rotated 90 Degrees Counterclockwise" +msgstr "घुमाएँ 90 अंश घड़ी की विपरीत दिशा में" + +#: randr.cpp:53 +#, fuzzy +#| msgid "Rotated 180 degrees counterclockwise" +msgid "Rotated 180 Degrees Counterclockwise" +msgstr "घुमाएँ 180 अंश घड़ी की विपरीत दिशा में" + +#: randr.cpp:55 +#, fuzzy +#| msgid "Rotated 270 degrees counterclockwise" +msgid "Rotated 270 Degrees Counterclockwise" +msgstr "घुमाएँ 270 अंश घड़ी की विपरीत दिशा में" + +#: randr.cpp:60 +#, fuzzy +#| msgid "Mirrored horizontally and vertically" +msgid "Mirrored Horizontally And Vertically" +msgstr "प्रतिबिम्बित आड़ा तथा खड़ा" + +#: randr.cpp:62 +msgid "mirrored horizontally and vertically" +msgstr "प्रतिबिम्बित आड़ा तथा खड़ा" + +#: randr.cpp:65 +#, fuzzy +#| msgid "Mirrored horizontally" +msgid "Mirrored Horizontally" +msgstr "प्रतिबिम्बित आड़ा" + +#: randr.cpp:67 +msgid "mirrored horizontally" +msgstr "प्रतिबिम्बित आड़ा" + +#: randr.cpp:70 +#, fuzzy +#| msgid "Mirrored vertically" +msgid "Mirrored Vertically" +msgstr "प्रतिबिम्बित खड़ा" + +#: randr.cpp:72 +msgid "mirrored vertically" +msgstr "प्रतिबिम्बित आड़ा" + +#: randr.cpp:77 +msgid "unknown orientation" +msgstr "अज्ञात दिशा-निर्धारण" + +#: randr.cpp:129 +msgid "Confirm Display Setting Change" +msgstr "प्रदर्शक विन्यास परिवर्तन पुष्टि करें" + +#: randr.cpp:133 +msgid "&Accept Configuration" +msgstr "कॉन्फ़िगरेशन स्वीकारें (&A)" + +#: randr.cpp:134 +msgid "&Revert to Previous Configuration" +msgstr "पिछले कॉन्फ़िगरेशन में वापस जाएँ (&R)" + +#: randr.cpp:136 +msgid "" +"Your screen configuration has been changed to the requested settings. Please " +"indicate whether you wish to keep this configuration. In 15 seconds the " +"display will revert to your previous settings." +msgstr "" + +#. i18n: ectx: property (text), widget (QPushButton, saveAsDefaultButton) +#: randrconfig.cpp:61 randrconfigbase.ui:81 +msgid "Save as Default" +msgstr "" + +#: randrconfig.cpp:62 +msgid "Reset" +msgstr "" + +#: randrconfig.cpp:125 +msgctxt "No display selected" +msgid "None" +msgstr "" + +#: randrconfig.cpp:140 randrconfig.cpp:185 +#, kde-format +msgid "%1 (Connected)" +msgstr "" + +#: randrconfig.cpp:329 +msgid "Configuration has been set as the desktop default." +msgstr "" + +#: randrconfig.cpp:338 +msgid "Default desktop setup has been reset." +msgstr "" + +#: randrconfig.cpp:456 +msgid "" +"Insufficient virtual size for the total screen size.\n" +"The configured virtual size of your X server is insufficient for this setup. " +"This configuration needs to be adjusted.\n" +"Do you wish to run a tool to adjust the configuration?" +msgstr "" + +#: randrconfig.cpp:464 +msgid "" +"Configuration has been adjusted. Please restart your session for this change " +"to take effect." +msgstr "" + +#: randrconfig.cpp:467 +msgid "Changing configuration failed. Please adjust your xorg.conf manually." +msgstr "" + +#. i18n: ectx: property (windowTitle), widget (QWidget, RandRConfigBase) +#: randrconfigbase.ui:14 +msgid "Display Configuration (X11 Resize, Rotate and Reflect)" +msgstr "प्रदर्शक कॉन्फ़िगुरेशऩ (X11 नया आकार, घूर्णन था प्रतिबिम्ब)" + +#. i18n: ectx: property (text), widget (QCheckBox, unifyOutputs) +#: randrconfigbase.ui:27 +#, fuzzy +#| msgid "Unify Outputs" +msgid "Unify outputs" +msgstr "संयुक्त आउटपुट" + +#. i18n: ectx: property (text), widget (QLabel, label) +#: randrconfigbase.ui:52 +#, fuzzy +#| msgid "Unify Outputs" +msgid "Primary output:" +msgstr "संयुक्त आउटपुट" + +#. i18n: ectx: property (text), widget (QPushButton, identifyOutputsButton) +#: randrconfigbase.ui:74 +#, fuzzy +#| msgid "Unify Outputs" +msgid "Identify Outputs" +msgstr "संयुक्त आउटपुट" + +#: randrdisplay.cpp:49 +#, kde-format +msgid "X Resize and Rotate extension version %1.%2" +msgstr "एक्स नया आकार व घुमाना संस्करण %1.%2" + +#, fuzzy +#~| msgid "Screen Size" +#~ msgid "Screen Settings" +#~ msgstr "स्क्रीन आकार" + +#~ msgid "Screen resize & rotate" +#~ msgstr "स्क्रीन को नया आकार दें तथा घुमाएँ" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/krdb.po kde-l10n-hi-4.13.0/messages/kde-workspace/krdb.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/krdb.po 2014-01-02 03:12:55.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/krdb.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: krdb\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-01-02 01:34+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2007-10-29 15:51+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -18,7 +18,7 @@ "X-Generator: KBabel 1.11.4\n" "Plural-Forms: nplurals=2; plural=(n!=1);\n" -#: krdb.cpp:250 +#: krdb.cpp:251 #, kde-format msgid "" "# created by KDE, %1\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/krunner.po kde-l10n-hi-4.13.0/messages/kde-workspace/krunner.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/krunner.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/krunner.po 2014-03-20 07:12:47.000000000 +0000 @@ -0,0 +1,453 @@ +# translation of krunner.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007. +msgid "" +msgstr "" +"Project-Id-Version: krunner\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2014-03-20 06:06+0000\n" +"PO-Revision-Date: 2008-07-09 11:59+0530\n" +"Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"X-Generator: KBabel 1.11.4\n" + +msgctxt "NAME OF TRANSLATORS" +msgid "Your names" +msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर" + +msgctxt "EMAIL OF TRANSLATORS" +msgid "Your emails" +msgstr "raviratlami@aol.in" + +#: configdialog.cpp:53 +msgid "Plugins" +msgstr "" + +#: configdialog.cpp:82 +msgid "User Interface" +msgstr "" + +#: configdialog.cpp:150 +msgid "Available Plugins" +msgstr "" + +#. i18n: ectx: property (text), widget (QLabel, label_2) +#: interfaceOptions.ui:17 +msgid "Positioning:" +msgstr "" + +#. i18n: ectx: property (text), widget (QRadioButton, topEdgeButton) +#: interfaceOptions.ui:27 +msgid "Top edge of screen" +msgstr "" + +#. i18n: ectx: property (text), widget (QRadioButton, freeFloatingButton) +#: interfaceOptions.ui:37 +msgid "Free floating window" +msgstr "" + +#. i18n: ectx: property (text), widget (QLabel, label) +#: interfaceOptions.ui:57 +msgid "Style:" +msgstr "" + +#. i18n: ectx: property (text), widget (QRadioButton, commandButton) +#: interfaceOptions.ui:67 +#, fuzzy +#| msgid "Command" +msgid "Command oriented" +msgstr "कमांड" + +#. i18n: ectx: property (text), widget (QRadioButton, taskButton) +#: interfaceOptions.ui:77 +#, fuzzy +#| msgid "Command" +msgid "Task oriented" +msgstr "कमांड" + +#. i18n: ectx: property (text), widget (QPushButton, previewButton) +#: interfaceOptions.ui:97 +msgid "Preview" +msgstr "" + +#: interfaces/default/interface.cpp:90 interfaces/default/interface.cpp:91 +#: interfaces/quicksand/qs_dialog.cpp:59 interfaces/quicksand/qs_dialog.cpp:60 +msgid "Settings" +msgstr "विन्यास" + +#: interfaces/default/interface.cpp:112 +msgid "Help" +msgstr "" + +#: interfaces/default/interface.cpp:113 +msgid "Information on using this application" +msgstr "" + +#: interfaces/default/interface.cpp:277 interfaces/quicksand/qs_dialog.cpp:317 +#, fuzzy, kde-format +#| msgid "%1 (%2)" +msgctxt "tooltip, shortcut" +msgid "%1 (%2)" +msgstr "%1 (%2)" + +#: interfaces/default/interface.cpp:441 +#, kde-format +msgid "(From %1, %2)" +msgstr "" + +#: interfaces/quicksand/qs_dialog.cpp:108 +#, fuzzy +#| msgid "Location" +msgid "Actions" +msgstr "स्थान" + +#: interfaces/quicksand/qs_matchview.cpp:193 +msgid "Type to search." +msgstr "" + +#: interfaces/quicksand/qs_matchview.cpp:274 +#, kde-format +msgid "1 item" +msgid_plural "%1 items" +msgstr[0] "" +msgstr[1] "" + +#: interfaces/quicksand/qs_matchview.cpp:276 +#, fuzzy, kde-format +#| msgid "Location" +msgid "1 action" +msgid_plural "%1 actions" +msgstr[0] "स्थान" +msgstr[1] "स्थान" + +#: interfaces/quicksand/qs_matchview.cpp:361 +msgid "Loading..." +msgstr "" + +#: interfaces/quicksand/qs_matchview.cpp:446 +msgid "No results found." +msgstr "" + +#: interfaces/quicksand/qs_statusbar.cpp:57 +#, fuzzy, kde-format +#| msgid "%1 - %2" +msgctxt "%1 current item number, %2 total number of items" +msgid "%1 of %2" +msgstr "%1 - %2" + +#. i18n: ectx: label, entry, group (General) +#: kcfg/krunner.kcfg:13 +msgid "The interface style to use in KRunner" +msgstr "" + +#. i18n: ectx: label, entry, group (General) +#: kcfg/krunner.kcfg:21 +msgid "" +"Set to true to show the interface in a freely floating dialog instead of at " +"the top of the screen" +msgstr "" + +#. i18n: ectx: label, entry, group (General) +#: kcfg/krunner.kcfg:26 +msgid "Completion mode used for the query text." +msgstr "क्वैरी पाठ के लिए प्रयोग में लिया गया कम्प्लीशन मोड" + +#. i18n: ectx: label, entry (PastQueries), group (General) +#: kcfg/krunner.kcfg:31 +msgid "History if past queries successfully completed" +msgstr "यदि पिछली क्वैरीज सफलता पूर्वक सम्पन्न हैं तो इतिहास" + +#. i18n: ectx: label, entry (KeepTaskDialogAbove), group (TaskDialog) +#: kcfg/krunner.kcfg:40 +msgid "Whether to keep the tasks dialog above other windows when shown." +msgstr "जब दिखाया जाए तो क्या कार्य संवाद को अन्य विंडो के ऊपर रखा जाए." + +#: krunnerapp.cpp:120 +msgid "Run Command" +msgstr "कमांड चलाएँ" + +#: krunnerapp.cpp:125 +msgid "Run Command on clipboard contents" +msgstr "क्लिपबोर्ड सामग्री में रन कमांड" + +#: krunnerapp.cpp:131 +msgid "Show System Activity" +msgstr "तंत्र क्रियाओं को दिखाएँ" + +#: krunnerapp.cpp:137 +msgid "Switch User" +msgstr "उपयोक्ता स्विच करें" + +#: krunnerapp.cpp:176 +#, kde-format +msgctxt "Run krunner restricting the search only to runner %1" +msgid "Run Command (runner \"%1\" only)" +msgstr "" + +#: krunnerdialog.cpp:76 +#, fuzzy +#| msgid "Run Command" +msgctxt "@title:window" +msgid "Run Command" +msgstr "कमांड चलाएँ" + +#: ksystemactivitydialog.cpp:40 +msgid "System Activity" +msgstr "तंत्र क्रिया" + +#: main.cpp:37 +msgid "KDE run command interface" +msgstr "केडीई रन कमांड इंटरफ़ेस" + +#: main.cpp:48 +msgid "Run Command Interface" +msgstr "रन कमांड इंटरफ़ेस" + +#: main.cpp:50 +msgid "(c) 2006, Aaron Seigo" +msgstr "(c) 2006, एरॉन सीगो" + +#: main.cpp:51 +msgid "Aaron J. Seigo" +msgstr "एरॉन जे. सीगो" + +#: main.cpp:52 +msgid "Author and maintainer" +msgstr "लेखक तथा मेंटेनर" + +#~ msgid "Enable screen saver" +#~ msgstr "स्क्रीन सेवर सक्षम करें" + +#~ msgid "Enables the screen saver." +#~ msgstr "स्क्रीन सेवर को सक्षम करता है." + +#~ msgid "Screen saver timeout" +#~ msgstr "स्क्रीन सेवर टाइमआउट" + +#~ msgid "Sets the seconds after which the screen saver is started." +#~ msgstr "स्क्रीन सेवर चालू होने के बाद के सेकण्ड को सेट करता है." + +#~ msgid "Suspend screen saver when DPMS kicks in" +#~ msgstr "जब डीपीएमएस चालू हो तो स्क्रीन सेवर निलंबित रखें" + +#~ msgid "Lock Session" +#~ msgstr "सत्र पर ताला लगाएँ" + +#~ msgid "<qt><nobr><b>Automatic Log Out</b></nobr></qt>" +#~ msgstr "<qt><nobr><b>स्वचालित लॉगआउट</b></nobr></qt>" + +#~ msgid "" +#~ "<qt>To prevent being logged out, resume using this session by moving the " +#~ "mouse or pressing a key.</qt>" +#~ msgstr "" +#~ "<qt>लॉगआउट से बचने के लिए माउस को खिसका कर या किसी कुंजी को दबाकर रीज्यूम करें.</" +#~ "qt>" + +#~ msgid "Time Remaining:" +#~ msgstr "बाकाया समय:" + +#~ msgid "" +#~ "<qt><nobr>You will be automatically logged out in 1 second</nobr></qt>" +#~ msgid_plural "" +#~ "<qt><nobr>You will be automatically logged out in %1 seconds</nobr></qt>" +#~ msgstr[0] "<qt><nobr>आप १ सेकण्ड में स्वचालित लॉगआउट हो जाएंगे</nobr></qt>" +#~ msgstr[1] "<qt><nobr>आप %1 सेकण्ड में स्वचालित लॉग आउट हो जाएंगे</nobr></qt>" + +#~ msgid "<nobr><b>The session is locked</b></nobr><br />" +#~ msgstr "<nobr><b>सत्र तालाबंद है</b></nobr><br />" + +#~ msgid "<nobr><b>The session was locked by %1</b></nobr><br />" +#~ msgstr "<nobr><b>सत्र %1 के द्वारा तालाबंद है</b></nobr><br />" + +#~ msgid "Unl&ock" +#~ msgstr "ताला खोलें (&o)" + +#~ msgid "Sw&itch User..." +#~ msgstr "उपयोक्ता बदलें (&i)..." + +#~ msgid "<b>Unlocking failed</b>" +#~ msgstr "<b>ताला खोलना असफल</b>" + +#~ msgid "<b>Warning: Caps Lock on</b>" +#~ msgstr "<b>चेतावनी: केप्स लॉक चालू है</b>" + +#, fuzzy +#~| msgid "" +#~| "Cannot unlock the session because the authentication system failed to " +#~| "work;\n" +#~| "you must kill krunner_lock (pid %1) manually." +#~ msgid "" +#~ "Cannot unlock the session because the authentication system failed to " +#~ "work;\n" +#~ "you must kill kscreenlocker (pid %1) manually." +#~ msgstr "" +#~ "सत्र का ताला नहीं हटाया जा सका चूंकि प्रमाणीकरण तंत्र कार्य करने में असफल रहा;\n" +#~ "आपको स्वयं krunner_lock (pid %1) को बन्द (kill) करना होगा." + +#~ msgid "&Start New Session" +#~ msgstr "नया सत्र प्रारंभ करें (&S)" + +#~ msgid "&Do not ask again" +#~ msgstr "दोबारा मत पूछें (&D)" + +#~ msgid "Session" +#~ msgstr "सत्र" + +#~ msgid "Location" +#~ msgstr "स्थान" + +#~ msgctxt "session" +#~ msgid "&Activate" +#~ msgstr "सक्रिय करें (&A)" + +#~ msgid "Start &New Session" +#~ msgstr "नया सत्र प्रारंभ करें (&N)" + +#~ msgid "Will not lock the session, as unlocking would be impossible:\n" +#~ msgstr "सत्र को ताला नहीं लगा सकता, चूंकि स्क्रीन का ताला खोलना संभव नहीं है:\n" + +#~ msgid "Cannot start <i>kcheckpass</i>." +#~ msgstr "चालू नहीं कर सकता <i>के-चेकपास</i>." + +#~ msgid "" +#~ "<i>kcheckpass</i> is unable to operate. Possibly it is not setuid root." +#~ msgstr "<i>के-चेकपास</i> कार्य करने में अक्षम है. संभवतः यह setuid रूट नहीं है." + +#~ msgid "No appropriate greeter plugin configured." +#~ msgstr "कोई उपयुक्त ग्रीटर प्लगइन कॉन्फ़िगर्ड नहीं है." + +#, fuzzy +#~| msgid "Session Locker for KRunner" +#~ msgid "Session Locker for KDE Workspace" +#~ msgstr "केरनर हेतु सत्र लॉकर" + +#~ msgid "Force session locking" +#~ msgstr "सत्र में ताला लगाना बाध्य करें" + +#~ msgid "Only start screen saver" +#~ msgstr "सिर्फ स्क्रीन सेवर प्रारंभ करें" + +#~ msgid "Only use the blank screen saver" +#~ msgstr "सिर्फ खाली(ब्लैंक) स्क्रीन सेवर इस्तेमाल करें" + +#~ msgid "Log Out" +#~ msgstr "लॉग आउट" + +#~ msgid "Log Out Without Confirmation" +#~ msgstr "पुष्टि किए बगैर लॉग आउट करें" + +#~ msgid "Halt Without Confirmation" +#~ msgstr "पुष्टि किए बगैर बन्द (हाल्ट) करें" + +#~ msgid "Reboot Without Confirmation" +#~ msgstr "पुष्टि किए बगैर फिर से चालू (रिबूट) करें" + +#~ msgid "" +#~ "Could not log out properly.\n" +#~ "The session manager cannot be contacted. You can try to force a shutdown " +#~ "by pressing Ctrl+Alt+Backspace; note, however, that your current session " +#~ "will not be saved with a forced shutdown." +#~ msgstr "" +#~ "ठीक ढंग से लॉगआउट नहीं हो सका.\n" +#~ "सत्र प्रबंधक से संपर्क नहीं हो सका. आप कंट्रोल+ऑल्ट+बैकस्पेस दबा कर कम्प्यूटर बन्द करना " +#~ "बाध्य कर सकते हैं. टीप लें कि, हालाकि कम्पयूटर को बाध्य करके बन्द करने से आपका मौज़ूदा " +#~ "सत्र सहेजा नहीं जा सकेगा." + +#~ msgid "KRunner Settings" +#~ msgstr "के-रनर विन्यास" + +#, fuzzy +#~| msgid "%1 (%2)" +#~ msgid "%1: %2" +#~ msgstr "%1 (%2)" + +#~ msgid "KRunner Locker" +#~ msgstr "के-रनर लॉकर" + +#, fuzzy +#~| msgid "KRunner Settings" +#~ msgid "General Settings" +#~ msgstr "के-रनर विन्यास" + +#~ msgid "Launch" +#~ msgstr "लांच" + +#~ msgid "Click to execute the selected item above" +#~ msgstr "ऊपर दिए गए चयनित वस्तु को चलाने के लिए क्लिक करें" + +#~ msgid "Show Options" +#~ msgstr "विकल्प दिखाएँ" + +#, fuzzy +#~| msgid "Enables the screen saver." +#~ msgid "Plasma widgets over the screensaver" +#~ msgstr "स्क्रीन सेवर को सक्षम करता है." + +#, fuzzy +#~| msgid "Enables the screen saver." +#~ msgid "Plasma for the Screensaver" +#~ msgstr "स्क्रीन सेवर को सक्षम करता है." + +#, fuzzy +#~| msgid "Author and maintainer" +#~ msgid "Plasma Author and maintainer" +#~ msgstr "लेखक तथा मेंटेनर" + +#, fuzzy +#~| msgid "Settings" +#~ msgctxt "@title:window" +#~ msgid "Settings" +#~ msgstr "विन्यास" + +#, fuzzy +#~| msgid "Unl&ock" +#~ msgid "Unlock" +#~ msgstr "ताला खोलें (&o)" + +#, fuzzy +#~| msgid "Show Taskmanager" +#~ msgid "Show plasma-overlay" +#~ msgstr "कार्यमैनेजर दिखाएँ" + +#~ msgid "Runners" +#~ msgstr "रनर्स" + +#~| msgid "%1 (%2)" +#~ msgid "%1 (%2, %3)" +#~ msgstr "%1 (%2)" + +#~ msgid "Default: " +#~ msgstr "डिफ़ॉल्ट:" + +#~ msgid "Switch users" +#~ msgstr "उपयोक्ता बदलें" + +#~ msgid "No desktop sessions available" +#~ msgstr "कोई डेस्कटॉप सत्र उपलब्ध नहीं है" + +#~ msgid "Enter the name of an application, location or search term below." +#~ msgstr "अनुप्रयोग का नाम, स्थान या ढूंढने का वाक्यांश नीचे भरें." + +#~| msgid "Hide Options" +#~ msgid "Hide &Options" +#~ msgstr "विकल्प छुपाएँ" + +#, fuzzy +#~ msgid "Run %1" +#~ msgstr "परिणाम: %1" + +#~ msgid "Application" +#~ msgstr "अनुप्रयोग" + +#~ msgid "New Session" +#~ msgstr "नया सत्र" + +#~ msgid "Warning - New Session" +#~ msgstr "चेतावनी- नया सत्र" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kscreensaver.po kde-l10n-hi-4.13.0/messages/kde-workspace/kscreensaver.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kscreensaver.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kscreensaver.po 2014-02-08 06:26:18.000000000 +0000 @@ -0,0 +1,62 @@ +# translation of kscreensaver.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007. +msgid "" +msgstr "" +"Project-Id-Version: kscreensaver\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2014-02-08 05:23+0000\n" +"PO-Revision-Date: 2007-10-31 13:22+0530\n" +"Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" + +#: random.cpp:48 +#, kde-format +msgid "" +"Usage: %1 [-setup] [args]\n" +"Starts a random screen saver.\n" +"Any arguments (except -setup) are passed on to the screen saver." +msgstr "" +"उपयोग: %1 [-setup] [args]\n" +"बेतरतीब स्क्रीन सेवर प्रारंभ करता है.\n" +"कोई आर्गुमेंट( -setup के अलावा) को स्क्रीन सेवर पर पास कर दिया जाता है." + +#: random.cpp:55 +msgid "Start a random KDE screen saver" +msgstr "बेतरतीब केडीई स्क्रीन सेवर प्रारंभ करता है" + +#: random.cpp:70 +msgid "Random screen saver" +msgstr "बेतरतीब स्क्रीन सेवर" + +#: random.cpp:76 +msgid "Setup screen saver" +msgstr "स्क्रीन सेवर सेटअप करें" + +#: random.cpp:78 +msgid "Run in the specified XWindow" +msgstr "निर्दिष्ट एक्स-विंडो में चलाएँ" + +#: random.cpp:80 +msgid "Run in the root XWindow" +msgstr "रूट एक्स-विंडो में चलाएँ" + +#: random.cpp:194 +msgid "Setup Random Screen Saver" +msgstr "बेतरतीब स्क्रीन सेवर सेटअप करें" + +#: random.cpp:202 +msgid "Use OpenGL screen savers" +msgstr "ओपन जीएल स्क्रीन सेवर्स इस्तेमाल करें" + +#: random.cpp:205 +msgid "Use screen savers that manipulate the screen" +msgstr "स्क्रीन सेवर्स इस्तेमाल करें जो स्क्रीन में हेरफेर करते हैं" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/ksmserver.po kde-l10n-hi-4.13.0/messages/kde-workspace/ksmserver.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/ksmserver.po 2014-03-11 04:22:41.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/ksmserver.po 2013-11-05 12:40:10.000000000 +0000 @@ -8,7 +8,7 @@ msgstr "" "Project-Id-Version: ksmserver\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-11 01:51+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2008-07-09 13:43+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -19,7 +19,15 @@ "X-Generator: KBabel 1.11.4\n" "Plural-Forms: nplurals=2; plural=(n!=1);\n" -#: main.cpp:53 +msgctxt "NAME OF TRANSLATORS" +msgid "Your names" +msgstr "रविशंकर श्रीवास्तव" + +msgctxt "EMAIL OF TRANSLATORS" +msgid "Your emails" +msgstr "raviratlami@gmail.com" + +#: main.cpp:52 msgid "" "The reliable KDE session manager that talks the standard X11R6 \n" "session management protocol (XSMP)." @@ -27,52 +35,69 @@ "विश्वसनीय सत्र प्रबंधक जो मानक X11R6 से वार्तालाप करता है \n" "सत्र प्रबंधक प्रोटोकॉल (XSMP)." -#: main.cpp:256 +#: main.cpp:233 +msgid "The KDE Session Manager" +msgstr "केडीई सत्र प्रबंधक" + +#: main.cpp:235 +msgid "(C) 2000, The KDE Developers" +msgstr "(c) 2000, केडीई डेवलपर्स" + +#: main.cpp:236 +msgid "Matthias Ettrich" +msgstr "मेथियास एट्रिच" + +#: main.cpp:237 +msgid "Luboš Luňák" +msgstr "लुबोस लुनाक" + +#: main.cpp:237 +msgid "Maintainer" +msgstr "अनुरक्षक" + +#: main.cpp:245 msgid "Restores the saved user session if available" msgstr "यदि उपलब्ध हो तो सहेजा गया उपयोक्ता सत्र बहाल करें" -#: main.cpp:260 -#, fuzzy -#| msgid "" -#| "Starts 'wm' in case no other window manager is \n" -#| "participating in the session. Default is 'kwin'" +#: main.cpp:247 msgid "" -"Starts <wm> in case no other window manager is \n" +"Starts 'wm' in case no other window manager is \n" "participating in the session. Default is 'kwin'" msgstr "" "प्रारंभ करता है 'wm' यदि कोई अन्य विंडो प्रबंधक उपलब्ध नहीं होता है\n" "सत्र में. डिफ़ॉल्ट है 'kwin'" -#: main.cpp:261 -msgid "wm" -msgstr "" - -#: main.cpp:265 +#: main.cpp:248 msgid "Also allow remote connections" msgstr "रिमोट कनेक्शन स्वीकारें" -#: main.cpp:270 +#: main.cpp:250 msgid "Starts the session in locked mode" msgstr "" -#: server.cpp:1052 +#: server.cpp:1043 #, fuzzy #| msgid "&Logout" msgid "Log Out" msgstr "लॉगआउट (&L)" -#: server.cpp:1057 +#: server.cpp:1048 msgid "Log Out Without Confirmation" msgstr "" -#: server.cpp:1062 +#: server.cpp:1053 msgid "Halt Without Confirmation" msgstr "" -#: server.cpp:1067 +#: server.cpp:1058 msgid "Reboot Without Confirmation" msgstr "" +#: shutdown.cpp:388 +#, kde-format +msgid "Logout canceled by '%1'" +msgstr "लॉगआउट '%1' द्वारा रद्द किया गया" + #: themes/contour/main.qml:73 #, fuzzy, kde-format #| msgid "Log out in 1 second." @@ -129,11 +154,23 @@ msgid "&Turn Off Computer" msgstr "कम्प्यूटर बन्द करें (&T)" +#: themes/default/main.qml:284 +msgid "&Standby" +msgstr "स्टैंडबाय (&S)" + +#: themes/default/main.qml:288 +msgid "Suspend to &RAM" +msgstr "रैम में सस्पेंड करें (&R)" + +#: themes/default/main.qml:292 +msgid "Suspend to &Disk" +msgstr "डिस्क में सस्पेंड करें (&D)" + #: themes/default/main.qml:313 msgid "&Restart Computer" msgstr "कम्प्यूटर फिर से चालू करें (&R)" -#: themes/default/main.qml:358 +#: themes/default/main.qml:358 themes/default/main.qml:411 msgctxt "default option in boot loader" msgid " (default)" msgstr "" @@ -142,41 +179,6 @@ msgid "&Cancel" msgstr "रद्द करें (&C)" -#~ msgid "Logout canceled by '%1'" -#~ msgstr "लॉगआउट '%1' द्वारा रद्द किया गया" - -#~ msgid "&Standby" -#~ msgstr "स्टैंडबाय (&S)" - -#~ msgid "Suspend to &RAM" -#~ msgstr "रैम में सस्पेंड करें (&R)" - -#~ msgid "Suspend to &Disk" -#~ msgstr "डिस्क में सस्पेंड करें (&D)" - -#~ msgctxt "NAME OF TRANSLATORS" -#~ msgid "Your names" -#~ msgstr "रविशंकर श्रीवास्तव" - -#~ msgctxt "EMAIL OF TRANSLATORS" -#~ msgid "Your emails" -#~ msgstr "raviratlami@gmail.com" - -#~ msgid "The KDE Session Manager" -#~ msgstr "केडीई सत्र प्रबंधक" - -#~ msgid "(C) 2000, The KDE Developers" -#~ msgstr "(c) 2000, केडीई डेवलपर्स" - -#~ msgid "Matthias Ettrich" -#~ msgstr "मेथियास एट्रिच" - -#~ msgid "Luboš Luňák" -#~ msgstr "लुबोस लुनाक" - -#~ msgid "Maintainer" -#~ msgstr "अनुरक्षक" - #~ msgctxt "current option in boot loader" #~ msgid " (current)" #~ msgstr "(मौज़ूदा)" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/ksplashthemes.po kde-l10n-hi-4.13.0/messages/kde-workspace/ksplashthemes.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/ksplashthemes.po 2013-08-31 17:18:08.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/ksplashthemes.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: ksplashthemes\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2012-08-20 05:31+0200\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2007-10-31 13:36+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -24,7 +24,7 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" #: installer.cpp:127 msgid "Get New Themes..." diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kstyle_config.po kde-l10n-hi-4.13.0/messages/kde-workspace/kstyle_config.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kstyle_config.po 2014-03-21 04:12:46.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kstyle_config.po 2014-02-08 06:26:18.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kstyle_config\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-21 02:05+0000\n" +"POT-Creation-Date: 2014-02-08 05:23+0000\n" "PO-Revision-Date: 2010-11-27 03:57+0530\n" "Last-Translator: G Karunakar\n" "Language-Team: Hindi <en@li.org>\n" @@ -18,330 +18,345 @@ "X-Generator: KBabel 1.11.4\n" "Plural-Forms: nplurals=2; plural=(n!=1);\n" -#: config/main.cpp:37 config/oxygenconfigdialog.cpp:53 -#: config/oxygenconfigdialog.cpp:156 +msgctxt "NAME OF TRANSLATORS" +msgid "Your names" +msgstr "G Karunakar" + +msgctxt "EMAIL OF TRANSLATORS" +msgid "Your emails" +msgstr "karunakar@indlinux.org" + +#: oxygen/config/main.cpp:39 oxygen/config/oxygenconfigdialog.cpp:56 +#: oxygen/config/oxygenconfigdialog.cpp:158 #, fuzzy msgid "Oxygen Settings" msgstr "आक्सीजन विन्यास" -#: config/oxygenanimationconfigwidget.cpp:50 +#: oxygen/config/main.cpp:41 +#, fuzzy +msgid "Oxygen expert configuration tool" +msgstr "आक्सीजन" + +#: oxygen/config/main.cpp:43 oxygen/demo/main.cpp:45 +msgid "(c) 2010, Hugo Pereira Da Costa" +msgstr "(c) 2010, हुगो परेरा दा कोस्टा" + +#: oxygen/config/main.cpp:45 oxygen/demo/main.cpp:47 +msgid "Hugo Pereira Da Costa" +msgstr "हुगो परेरा दा कोस्टा" + +#: oxygen/config/oxygenanimationconfigwidget.cpp:50 msgid "Focus, mouseover and widget state transition" msgstr "" -#: config/oxygenanimationconfigwidget.cpp:51 +#: oxygen/config/oxygenanimationconfigwidget.cpp:51 msgid "" "Configure widgets' focus and mouseover highlight animation, as well as " "widget enabled/disabled state transition" msgstr "" -#: config/oxygenanimationconfigwidget.cpp:54 +#: oxygen/config/oxygenanimationconfigwidget.cpp:54 msgid "Toolbar highlight" msgstr "औज़ार पट्टी उभारें" -#: config/oxygenanimationconfigwidget.cpp:55 +#: oxygen/config/oxygenanimationconfigwidget.cpp:55 #, fuzzy #| msgid "Custom mouseover highlight color:" msgid "Configure toolbars' mouseover highlight animation" msgstr "माउस के ऊपर आने पर उभारने का अनुकूलित रंग:" -#: config/oxygenanimationconfigwidget.cpp:59 +#: oxygen/config/oxygenanimationconfigwidget.cpp:59 msgid "Menu bar highlight" msgstr "मेन्यू पट्टी उभार" -#: config/oxygenanimationconfigwidget.cpp:60 +#: oxygen/config/oxygenanimationconfigwidget.cpp:60 #, fuzzy #| msgid "Custom mouseover highlight color:" msgid "Configure menu bars' mouseover highlight animation" msgstr "माउस के ऊपर आने पर उभारने का अनुकूलित रंग:" -#: config/oxygenanimationconfigwidget.cpp:63 +#: oxygen/config/oxygenanimationconfigwidget.cpp:63 msgid "Menu highlight" msgstr "मेन्यू उभार" -#: config/oxygenanimationconfigwidget.cpp:64 +#: oxygen/config/oxygenanimationconfigwidget.cpp:64 #, fuzzy #| msgid "Custom mouseover highlight color:" msgid "Configure menus' mouseover highlight animation" msgstr "माउस के ऊपर आने पर उभारने का अनुकूलित रंग:" -#: config/oxygenanimationconfigwidget.cpp:67 +#: oxygen/config/oxygenanimationconfigwidget.cpp:67 #, fuzzy msgid "Progress bar animation" msgstr "प्रगति एनीमेशन" -#: config/oxygenanimationconfigwidget.cpp:68 +#: oxygen/config/oxygenanimationconfigwidget.cpp:68 #, fuzzy msgid "Configure progress bars' steps animation" msgstr "कॉन्फ़िगर एनीमेशन" -#: config/oxygenanimationconfigwidget.cpp:71 +#: oxygen/config/oxygenanimationconfigwidget.cpp:71 #, fuzzy msgid "Tab transitions" msgstr "टैब" -#: config/oxygenanimationconfigwidget.cpp:71 +#: oxygen/config/oxygenanimationconfigwidget.cpp:71 #, fuzzy msgid "Configure fading transition between tabs" msgstr "कॉन्फ़िगर" -#: config/oxygenanimationconfigwidget.cpp:74 +#: oxygen/config/oxygenanimationconfigwidget.cpp:74 #, fuzzy msgid "Label transitions" msgstr "लेबल" -#: config/oxygenanimationconfigwidget.cpp:74 +#: oxygen/config/oxygenanimationconfigwidget.cpp:74 #, fuzzy msgid "Configure fading transition when a label's text is changed" msgstr "कॉन्फ़िगर ए लेबल से. पाठ है बदला" -#: config/oxygenanimationconfigwidget.cpp:77 +#: oxygen/config/oxygenanimationconfigwidget.cpp:77 #, fuzzy msgid "Text editor transitions" msgstr "पाठ" -#: config/oxygenanimationconfigwidget.cpp:77 +#: oxygen/config/oxygenanimationconfigwidget.cpp:77 #, fuzzy msgid "Configure fading transition when an editor's text is changed" msgstr "कॉन्फ़िगर से. पाठ है बदला" -#: config/oxygenanimationconfigwidget.cpp:80 +#: oxygen/config/oxygenanimationconfigwidget.cpp:80 #, fuzzy msgid "Combo box transitions" msgstr "बक्सा" -#: config/oxygenanimationconfigwidget.cpp:80 +#: oxygen/config/oxygenanimationconfigwidget.cpp:80 #, fuzzy msgid "" "Configure fading transition when a combo box's selected choice is changed" msgstr "कॉन्फ़िगर ए बक्सा से. चयनित है बदला" -#: config/oxygenanimationconfigwidget.cpp:90 +#: oxygen/config/oxygenanimationconfigwidget.cpp:90 #, fuzzy msgid "Busy indicator steps" msgstr "व्यस्त" -#: config/oxygenanimationconfigwidget.cpp:91 +#: oxygen/config/oxygenanimationconfigwidget.cpp:91 #, fuzzy msgid "Configure progress bars' busy indicator animation" msgstr "कॉन्फ़िगर एनीमेशन" -#: config/oxygenconfigdialog.cpp:73 +#: oxygen/config/oxygenconfigdialog.cpp:72 #, fuzzy msgid "Widget Style" msgstr "विजेट शैली" -#: config/oxygenconfigdialog.cpp:74 +#: oxygen/config/oxygenconfigdialog.cpp:73 #, fuzzy msgid "Modify the appearance of widgets" msgstr "परिवर्धित करें,संशोधित करें का" -#: config/oxygenconfigdialog.cpp:92 +#: oxygen/config/oxygenconfigdialog.cpp:91 #, fuzzy msgid "Window Decorations" msgstr "विंडो" -#: config/oxygenconfigdialog.cpp:93 +#: oxygen/config/oxygenconfigdialog.cpp:92 #, fuzzy msgid "Modify the appearance of window decorations" msgstr "परिवर्धित करें,संशोधित करें का विंडो" -#: config/oxygenconfigdialog.cpp:191 config/oxygenconfigdialog.cpp:202 +#: oxygen/config/oxygenconfigdialog.cpp:191 +#: oxygen/config/oxygenconfigdialog.cpp:201 #, fuzzy msgid "Unable to find oxygen style configuration plugin" msgstr "को ढूंढें प्लगइन" -#: config/oxygenconfigdialog.cpp:239 config/oxygenconfigdialog.cpp:249 +#: oxygen/config/oxygenconfigdialog.cpp:237 +#: oxygen/config/oxygenconfigdialog.cpp:247 #, fuzzy msgid "Unable to find oxygen decoration configuration plugin" msgstr "को ढूंढें प्लगइन" -#: config/oxygenstyleconfig.cpp:182 +#: oxygen/config/oxygenstyleconfig.cpp:187 msgid "Hide Advanced Configuration Options" msgstr "" -#: config/oxygenstyleconfig.cpp:182 +#: oxygen/config/oxygenstyleconfig.cpp:187 msgid "Show Advanced Configuration Options" msgstr "" -#: config/oxygenstyleconfig.cpp:200 +#: oxygen/config/oxygenstyleconfig.cpp:205 msgid "Animations" msgstr "" -#. i18n: ectx: property (windowTitle), widget (QDialog, OxygenDemoDialog) -#. i18n: ectx: property (windowTitle), widget (QWidget, OxygenStyleConfig) -#. i18n: ectx: property (windowTitle), widget (QDialog, OxygenConfigDialog) -#: config/ui/oxygenconfigdialog.ui:14 config/ui/oxygenstyleconfig.ui:26 -#: demo/ui/oxygendemodialog.ui:14 -msgid "Dialog" -msgstr "संवाद" - #. i18n: ectx: property (text), widget (QLabel, label_2) #. i18n: ectx: property (windowTitle), widget (QFrame, FollowMouseAnimationConfigBox) -#: config/ui/oxygenfollowmouseanimationconfigbox.ui:20 -#: demo/ui/oxygenframedemowidget.ui:111 +#: oxygen/config/ui/oxygenfollowmouseanimationconfigbox.ui:20 +#: oxygen/demo/ui/oxygenframedemowidget.ui:111 msgid "Frame" msgstr "फ्रेम" #. i18n: ectx: property (text), widget (QLabel, label) -#: config/ui/oxygenfollowmouseanimationconfigbox.ui:32 +#: oxygen/config/ui/oxygenfollowmouseanimationconfigbox.ui:32 msgid "Animation type:" msgstr "एनीमेशन क़िस्म:" #. i18n: ectx: property (text), item, widget (KComboBox, typeComboBox) -#: config/ui/oxygenfollowmouseanimationconfigbox.ui:46 +#: oxygen/config/ui/oxygenfollowmouseanimationconfigbox.ui:46 msgid "Fade" msgstr "फीका" #. i18n: ectx: property (text), item, widget (KComboBox, typeComboBox) -#: config/ui/oxygenfollowmouseanimationconfigbox.ui:51 +#: oxygen/config/ui/oxygenfollowmouseanimationconfigbox.ui:51 msgid "Follow Mouse" msgstr "माउस अनुसरण करें" #. i18n: ectx: property (text), widget (QLabel, durationLabel) -#: config/ui/oxygenfollowmouseanimationconfigbox.ui:59 +#: oxygen/config/ui/oxygenfollowmouseanimationconfigbox.ui:59 #, fuzzy msgid "Fade duration:" msgstr "फीका:" +#. i18n: ectx: property (suffix), widget (KIntSpinBox, durationSpinBox) +#. i18n: ectx: property (suffix), widget (KIntSpinBox, followMouseDurationSpinBox) +#: oxygen/config/ui/oxygenfollowmouseanimationconfigbox.ui:72 +#: oxygen/config/ui/oxygenfollowmouseanimationconfigbox.ui:101 +msgid "ms" +msgstr "" + #. i18n: ectx: property (text), widget (QLabel, followMouseDurationLabel) -#: config/ui/oxygenfollowmouseanimationconfigbox.ui:72 +#: oxygen/config/ui/oxygenfollowmouseanimationconfigbox.ui:88 #, fuzzy msgid "Follow mouse duration:" msgstr "अनुसरण करें माउस:" -#. i18n: ectx: property (suffix), widget (QSpinBox, durationSpinBox) -#. i18n: ectx: property (suffix), widget (QSpinBox, followMouseDurationSpinBox) -#: config/ui/oxygenfollowmouseanimationconfigbox.ui:98 -#: config/ui/oxygenfollowmouseanimationconfigbox.ui:114 -msgid "ms" -msgstr "" +#. i18n: ectx: property (windowTitle), widget (QWidget, OxygenStyleConfig) +#: oxygen/config/ui/oxygenstyleconfig.ui:26 +msgid "Dialog" +msgstr "संवाद" #. i18n: ectx: attribute (title), widget (QWidget, tab_1) -#: config/ui/oxygenstyleconfig.ui:45 +#: oxygen/config/ui/oxygenstyleconfig.ui:45 msgid "General" msgstr "सामान्य" -#. i18n: ectx: property (text), widget (QCheckBox, _useBackgroundGradient) -#: config/ui/oxygenstyleconfig.ui:51 -msgid "Draw window background gradient" -msgstr "" - #. i18n: ectx: property (text), widget (QCheckBox, _toolBarDrawItemSeparator) -#: config/ui/oxygenstyleconfig.ui:58 +#: oxygen/config/ui/oxygenstyleconfig.ui:51 msgid "Draw toolbar item separators" msgstr "औज़ार पट्टी वस्तु सेपरेटर बनाएँ" #. i18n: ectx: property (text), widget (QCheckBox, _checkDrawX) -#: config/ui/oxygenstyleconfig.ui:65 +#: oxygen/config/ui/oxygenstyleconfig.ui:58 #, fuzzy msgid "Use 'X' in checkboxes instead of check" msgstr "उपयोग एक्स इंच का" #. i18n: ectx: property (text), widget (QCheckBox, _splitterProxyEnabled) -#: config/ui/oxygenstyleconfig.ui:72 +#: oxygen/config/ui/oxygenstyleconfig.ui:65 msgid "Enable extended resize handles" msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, _cacheEnabled) -#: config/ui/oxygenstyleconfig.ui:79 +#: oxygen/config/ui/oxygenstyleconfig.ui:72 #, fuzzy msgid "Enable pixmap cache" msgstr "सक्षम करें" #. i18n: ectx: property (text), widget (QCheckBox, _animationsEnabled) -#: config/ui/oxygenstyleconfig.ui:86 +#: oxygen/config/ui/oxygenstyleconfig.ui:79 msgid "Enable animations" msgstr "एनिमेशन सक्षम करें" #. i18n: ectx: property (text), widget (QLabel, label_3) -#: config/ui/oxygenstyleconfig.ui:101 +#: oxygen/config/ui/oxygenstyleconfig.ui:94 #, fuzzy msgid "Windows' drag mode:" msgstr "विंडोज़ मोड:" #. i18n: ectx: property (text), item, widget (KComboBox, _windowDragMode) -#: config/ui/oxygenstyleconfig.ui:115 +#: oxygen/config/ui/oxygenstyleconfig.ui:108 #, fuzzy msgid "Drag windows from titlebar only" msgstr "खीचें और उपकरण-पट्टियाँ" #. i18n: ectx: property (text), item, widget (KComboBox, _windowDragMode) -#: config/ui/oxygenstyleconfig.ui:120 +#: oxygen/config/ui/oxygenstyleconfig.ui:113 #, fuzzy msgid "Drag windows from titlebar, menubar and toolbars" msgstr "खीचें और उपकरण-पट्टियाँ" #. i18n: ectx: property (text), item, widget (KComboBox, _windowDragMode) -#: config/ui/oxygenstyleconfig.ui:125 +#: oxygen/config/ui/oxygenstyleconfig.ui:118 #, fuzzy msgid "Drag windows from all empty areas" msgstr "खीचें सभी खाली" #. i18n: ectx: property (text), widget (QLabel, _mnemonicsLabel) -#: config/ui/oxygenstyleconfig.ui:133 +#: oxygen/config/ui/oxygenstyleconfig.ui:126 #, fuzzy #| msgid "Draw toolbar item separators" msgid "Keyboard accelerators visibility:" msgstr "औज़ार पट्टी वस्तु सेपरेटर बनाएँ" #. i18n: ectx: property (text), item, widget (KComboBox, _mnemonicsMode) -#: config/ui/oxygenstyleconfig.ui:154 +#: oxygen/config/ui/oxygenstyleconfig.ui:147 #, fuzzy #| msgid "Draw toolbar item separators" msgid "Always Hide Keyboard Accelerators" msgstr "औज़ार पट्टी वस्तु सेपरेटर बनाएँ" #. i18n: ectx: property (text), item, widget (KComboBox, _mnemonicsMode) -#: config/ui/oxygenstyleconfig.ui:159 +#: oxygen/config/ui/oxygenstyleconfig.ui:152 #, fuzzy #| msgid "Draw toolbar item separators" msgid "Show Keyboard Accelerators When Needed" msgstr "औज़ार पट्टी वस्तु सेपरेटर बनाएँ" #. i18n: ectx: property (text), item, widget (KComboBox, _mnemonicsMode) -#: config/ui/oxygenstyleconfig.ui:164 +#: oxygen/config/ui/oxygenstyleconfig.ui:157 #, fuzzy #| msgid "Draw toolbar item separators" msgid "Always Show Keyboard Accelerators" msgstr "औज़ार पट्टी वस्तु सेपरेटर बनाएँ" #. i18n: ectx: property (text), widget (QCheckBox, _useWMMoveResize) -#: config/ui/oxygenstyleconfig.ui:174 +#: oxygen/config/ui/oxygenstyleconfig.ui:167 #, fuzzy msgid "Use window manager to perform windows' drag" msgstr "उपयोग विंडो को" #. i18n: ectx: attribute (title), widget (QWidget, tab_2) -#: config/ui/oxygenstyleconfig.ui:195 +#: oxygen/config/ui/oxygenstyleconfig.ui:188 msgid "Views" msgstr "दृश्य" #. i18n: ectx: property (text), widget (QCheckBox, _viewDrawFocusIndicator) -#: config/ui/oxygenstyleconfig.ui:201 +#: oxygen/config/ui/oxygenstyleconfig.ui:194 #, fuzzy msgid "Draw focus indicator" msgstr "खीचें" #. i18n: ectx: property (text), widget (QCheckBox, _viewDrawTreeBranchLines) -#: config/ui/oxygenstyleconfig.ui:208 +#: oxygen/config/ui/oxygenstyleconfig.ui:201 #, fuzzy msgid "Draw tree branch lines" msgstr "खीचें ट्री पंक्तियाँ" #. i18n: ectx: property (text), widget (QCheckBox, _viewDrawTriangularExpander) -#: config/ui/oxygenstyleconfig.ui:215 +#: oxygen/config/ui/oxygenstyleconfig.ui:208 #, fuzzy #| msgid "Triangular tree expander" msgid "Use triangle tree expander instead of +/-" msgstr "त्रिकोणीय ट्री एक्सपांडर" #. i18n: ectx: property (text), widget (QLabel, label_4) -#: config/ui/oxygenstyleconfig.ui:244 +#: oxygen/config/ui/oxygenstyleconfig.ui:237 msgid "Triangle size:" msgstr "त्रिभुज आकार :" #. i18n: ectx: property (text), item, widget (KComboBox, _viewTriangularExpanderSize) -#: config/ui/oxygenstyleconfig.ui:255 +#: oxygen/config/ui/oxygenstyleconfig.ui:248 #, fuzzy #| msgid "Tiny" msgctxt "triangle size" @@ -349,7 +364,7 @@ msgstr "नन्हा" #. i18n: ectx: property (text), item, widget (KComboBox, _viewTriangularExpanderSize) -#: config/ui/oxygenstyleconfig.ui:260 +#: oxygen/config/ui/oxygenstyleconfig.ui:253 #, fuzzy #| msgid "Small" msgctxt "triangle size" @@ -357,412 +372,412 @@ msgstr "छोटा" #. i18n: ectx: property (text), item, widget (KComboBox, _viewTriangularExpanderSize) -#: config/ui/oxygenstyleconfig.ui:265 +#: oxygen/config/ui/oxygenstyleconfig.ui:258 #, fuzzy msgctxt "triangle size" msgid "Normal" msgstr "सामान्य" #. i18n: ectx: attribute (title), widget (QWidget, tab_3) -#: config/ui/oxygenstyleconfig.ui:303 +#: oxygen/config/ui/oxygenstyleconfig.ui:296 msgid "Tabs" msgstr "टैब्स" #. i18n: ectx: property (text), widget (QRadioButton, _tabStyleSingle) -#: config/ui/oxygenstyleconfig.ui:322 +#: oxygen/config/ui/oxygenstyleconfig.ui:315 msgctxt "Renders each inactive tab in a tabbar as separate darker slab" msgid "Single" msgstr "एकल" #. i18n: ectx: property (text), widget (QRadioButton, _tabStylePlain) -#: config/ui/oxygenstyleconfig.ui:329 +#: oxygen/config/ui/oxygenstyleconfig.ui:322 msgctxt "Renders inactive tabs in a tabbar as a unique darker slab" msgid "Plain" msgstr "सादा" #. i18n: ectx: property (text), widget (QLabel, label_2) -#: config/ui/oxygenstyleconfig.ui:336 +#: oxygen/config/ui/oxygenstyleconfig.ui:329 #, fuzzy msgid "Inactive tabs style:" msgstr "अक्रियाशील:" #. i18n: ectx: attribute (title), widget (QWidget, tab_4) -#: config/ui/oxygenstyleconfig.ui:344 +#: oxygen/config/ui/oxygenstyleconfig.ui:337 #, fuzzy msgid "Scrollbars" msgstr "स्क्रोल बार,चलपट्टी" #. i18n: ectx: property (text), widget (QLabel, label) -#: config/ui/oxygenstyleconfig.ui:352 +#: oxygen/config/ui/oxygenstyleconfig.ui:345 msgid "Scrollbar width:" msgstr "स्क्रॉलबार चौड़ाई:" -#. i18n: ectx: property (suffix), widget (QSpinBox, _scrollBarWidth) -#: config/ui/oxygenstyleconfig.ui:390 +#. i18n: ectx: property (suffix), widget (KIntSpinBox, _scrollBarWidth) +#: oxygen/config/ui/oxygenstyleconfig.ui:383 msgid "px" msgstr "" #. i18n: ectx: property (text), widget (QLabel, label_5) -#: config/ui/oxygenstyleconfig.ui:420 +#: oxygen/config/ui/oxygenstyleconfig.ui:413 msgid "Top arrow button type:" msgstr "ऊपर तीर क़िस्म:" #. i18n: ectx: property (text), widget (QLabel, label_6) -#: config/ui/oxygenstyleconfig.ui:430 +#: oxygen/config/ui/oxygenstyleconfig.ui:423 msgid "Bottom arrow button type:" msgstr "नीचे तीर क़िस्म:" #. i18n: ectx: property (text), item, widget (KComboBox, _scrollBarSubLineButtons) -#: config/ui/oxygenstyleconfig.ui:441 +#: oxygen/config/ui/oxygenstyleconfig.ui:434 msgid "No buttons" msgstr "नहीं बटन" #. i18n: ectx: property (text), item, widget (KComboBox, _scrollBarSubLineButtons) #. i18n: ectx: property (text), item, widget (KComboBox, _scrollBarAddLineButtons) -#: config/ui/oxygenstyleconfig.ui:446 config/ui/oxygenstyleconfig.ui:478 +#: oxygen/config/ui/oxygenstyleconfig.ui:439 +#: oxygen/config/ui/oxygenstyleconfig.ui:471 msgid "One button" msgstr "एक बटन" #. i18n: ectx: property (text), item, widget (KComboBox, _scrollBarSubLineButtons) #. i18n: ectx: property (text), item, widget (KComboBox, _scrollBarAddLineButtons) -#: config/ui/oxygenstyleconfig.ui:451 config/ui/oxygenstyleconfig.ui:483 +#: oxygen/config/ui/oxygenstyleconfig.ui:444 +#: oxygen/config/ui/oxygenstyleconfig.ui:476 msgid "Two buttons" msgstr "दो बटन" #. i18n: ectx: property (text), item, widget (KComboBox, _scrollBarAddLineButtons) -#: config/ui/oxygenstyleconfig.ui:473 +#: oxygen/config/ui/oxygenstyleconfig.ui:466 msgid "No button" msgstr "नहीं बटन" #. i18n: ectx: attribute (title), widget (QWidget, tab_5) -#: config/ui/oxygenstyleconfig.ui:507 +#: oxygen/config/ui/oxygenstyleconfig.ui:500 msgid "Menu Highlight" msgstr "मेन्यू उभारें" #. i18n: ectx: property (text), widget (QRadioButton, _menuHighlightDark) -#: config/ui/oxygenstyleconfig.ui:513 +#: oxygen/config/ui/oxygenstyleconfig.ui:506 msgid "Use dark color" msgstr "गहरा रंग उपयोग करें" #. i18n: ectx: property (text), widget (QRadioButton, _menuHighlightStrong) -#: config/ui/oxygenstyleconfig.ui:520 +#: oxygen/config/ui/oxygenstyleconfig.ui:513 #, fuzzy msgid "Use selection color (plain)" msgstr "उपयोग रंग सादा" #. i18n: ectx: property (text), widget (QRadioButton, _menuHighlightSubtle) -#: config/ui/oxygenstyleconfig.ui:527 +#: oxygen/config/ui/oxygenstyleconfig.ui:520 #, fuzzy msgid "Use selection color (subtle)" msgstr "उपयोग रंग" -#: demo/main.cpp:38 demo/oxygendemodialog.cpp:54 demo/oxygendemodialog.cpp:190 +#: oxygen/demo/main.cpp:41 oxygen/demo/oxygendemodialog.cpp:57 +#: oxygen/demo/oxygendemodialog.cpp:198 #, fuzzy msgid "Oxygen Demo" msgstr "आक्सीजन" +#: oxygen/demo/main.cpp:43 +#, fuzzy +msgid "Oxygen style demonstration" +msgstr "आक्सीजन" + +#. i18n: ectx: property (text), widget (KPushButton, pushButton) +#. i18n: ectx: property (text), widget (KPushButton, pushButton_2) #. i18n: ectx: property (text), item, widget (KComboBox, kcombobox) +#. i18n: ectx: property (text), widget (KPushButton, pushButton_3) +#. i18n: ectx: property (text), widget (KPushButton, pushButton_4) #. i18n: ectx: property (text), widget (QToolButton, toolButton) #. i18n: ectx: property (text), widget (QToolButton, toolButton_2) -#. i18n: ectx: property (text), widget (QPushButton, pushButton) -#. i18n: ectx: property (text), widget (QPushButton, pushButton_2) -#. i18n: ectx: property (text), widget (QPushButton, pushButton_3) -#. i18n: ectx: property (text), widget (QPushButton, pushButton_4) #. i18n: ectx: property (text), widget (QToolButton, toolButton_3) #. i18n: ectx: property (text), widget (QToolButton, toolButton_4) #. i18n: ectx: property (text), widget (QToolButton, toolButton_5) -#: demo/oxygenbuttondemowidget.cpp:57 demo/ui/oxygenbuttondemowidget.ui:154 -#: demo/ui/oxygenbuttondemowidget.ui:207 demo/ui/oxygenbuttondemowidget.ui:217 -#: demo/ui/oxygenbuttondemowidget.ui:227 demo/ui/oxygenbuttondemowidget.ui:237 -#: demo/ui/oxygenbuttondemowidget.ui:247 demo/ui/oxygenbuttondemowidget.ui:257 -#: demo/ui/oxygenbuttondemowidget.ui:285 demo/ui/oxygenbuttondemowidget.ui:295 -#: demo/ui/oxygenbuttondemowidget.ui:305 +#: oxygen/demo/oxygenbuttondemowidget.cpp:57 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:145 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:155 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:174 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:213 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:223 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:247 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:257 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:285 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:295 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:305 #, fuzzy msgid "Normal" msgstr "सामान्य" -#: demo/oxygenbuttondemowidget.cpp:58 demo/oxygenbuttondemowidget.cpp:77 -#: demo/oxygenbuttondemowidget.cpp:249 demo/oxygenbuttondemowidget.cpp:259 +#: oxygen/demo/oxygenbuttondemowidget.cpp:58 +#: oxygen/demo/oxygenbuttondemowidget.cpp:77 +#: oxygen/demo/oxygenbuttondemowidget.cpp:249 +#: oxygen/demo/oxygenbuttondemowidget.cpp:259 #, fuzzy msgid "New" msgstr "नया" -#: demo/oxygenbuttondemowidget.cpp:59 demo/oxygenbuttondemowidget.cpp:78 -#: demo/oxygenbuttondemowidget.cpp:250 demo/oxygenbuttondemowidget.cpp:260 +#: oxygen/demo/oxygenbuttondemowidget.cpp:59 +#: oxygen/demo/oxygenbuttondemowidget.cpp:78 +#: oxygen/demo/oxygenbuttondemowidget.cpp:250 +#: oxygen/demo/oxygenbuttondemowidget.cpp:260 #, fuzzy msgid "Open" msgstr "खोलें" -#: demo/oxygenbuttondemowidget.cpp:60 demo/oxygenbuttondemowidget.cpp:79 -#: demo/oxygenbuttondemowidget.cpp:251 demo/oxygenbuttondemowidget.cpp:261 +#: oxygen/demo/oxygenbuttondemowidget.cpp:60 +#: oxygen/demo/oxygenbuttondemowidget.cpp:79 +#: oxygen/demo/oxygenbuttondemowidget.cpp:251 +#: oxygen/demo/oxygenbuttondemowidget.cpp:261 #, fuzzy msgid "Save" msgstr "सहेजें" -#: demo/oxygenbuttondemowidget.cpp:80 +#: oxygen/demo/oxygenbuttondemowidget.cpp:80 msgid "Toggle authentication" msgstr "" -#: demo/oxygendemodialog.cpp:66 +#: oxygen/demo/oxygendemodialog.cpp:69 #, fuzzy msgid "Enabled" msgstr "सक्षम" -#: demo/oxygendemodialog.cpp:71 +#: oxygen/demo/oxygendemodialog.cpp:74 #, fuzzy msgid "Right to left layout" msgstr "दायाँ को बायाँ" -#: demo/oxygendemodialog.cpp:84 +#: oxygen/demo/oxygendemodialog.cpp:92 #, fuzzy msgid "Input Widgets" msgstr "इनपुट" -#: demo/oxygendemodialog.cpp:86 +#: oxygen/demo/oxygendemodialog.cpp:94 #, fuzzy msgid "Shows the appearance of text input widgets" msgstr "का पाठ" -#: demo/oxygendemodialog.cpp:94 +#: oxygen/demo/oxygendemodialog.cpp:102 #, fuzzy msgid "Tab Widgets" msgstr "टैब" -#: demo/oxygendemodialog.cpp:96 +#: oxygen/demo/oxygendemodialog.cpp:104 #, fuzzy msgid "Shows the appearance of tab widgets" msgstr "का टैब" -#: demo/oxygendemodialog.cpp:104 +#: oxygen/demo/oxygendemodialog.cpp:112 #, fuzzy msgid "Buttons" msgstr "बटन्स" -#: demo/oxygendemodialog.cpp:106 +#: oxygen/demo/oxygendemodialog.cpp:114 msgid "Shows the appearance of buttons" msgstr "" -#: demo/oxygendemodialog.cpp:114 +#: oxygen/demo/oxygendemodialog.cpp:122 msgid "Lists" msgstr "सूचियां" -#: demo/oxygendemodialog.cpp:116 +#: oxygen/demo/oxygendemodialog.cpp:124 msgid "Shows the appearance of lists, trees and tables" msgstr "" -#: demo/oxygendemodialog.cpp:125 +#: oxygen/demo/oxygendemodialog.cpp:133 msgid "Frames" msgstr "फ़्रेम" -#: demo/oxygendemodialog.cpp:127 +#: oxygen/demo/oxygendemodialog.cpp:135 #, fuzzy msgid "Shows the appearance of various framed widgets" msgstr "का टैब" -#: demo/oxygendemodialog.cpp:135 -msgid "MDI Windows" -msgstr "" - -#: demo/oxygendemodialog.cpp:137 -#, fuzzy -msgid "Shows the appearance of MDI windows" -msgstr "का टैब" - -#: demo/oxygendemodialog.cpp:145 +#: oxygen/demo/oxygendemodialog.cpp:153 msgid "Sliders" msgstr "" -#: demo/oxygendemodialog.cpp:147 +#: oxygen/demo/oxygendemodialog.cpp:155 msgid "Shows the appearance of sliders, progress bars and scrollbars" msgstr "" -#: demo/oxygendemodialog.cpp:156 +#: oxygen/demo/oxygendemodialog.cpp:164 msgid "Benchmark" msgstr "बेंचमार्क" -#: demo/oxygendemodialog.cpp:158 +#: oxygen/demo/oxygendemodialog.cpp:166 #, fuzzy msgid "Emulates user interaction with widgets for benchmarking" msgstr "के साथ के लिये" -#: demo/oxygeninputdemowidget.cpp:39 +#: oxygen/demo/oxygeninputdemowidget.cpp:39 msgid "Example text" msgstr "उदाहरण पाठ" -#: demo/oxygeninputdemowidget.cpp:40 +#: oxygen/demo/oxygeninputdemowidget.cpp:40 msgid "password" msgstr "पासवर्ड" -#: demo/oxygenmdidemowidget.cpp:50 -msgid "Layout" -msgstr "" - -#: demo/oxygenmdidemowidget.cpp:51 +#: oxygen/demo/oxygenmdidemowidget.cpp:51 msgid "Tile" msgstr "टाइल" -#: demo/oxygenmdidemowidget.cpp:52 +#: oxygen/demo/oxygenmdidemowidget.cpp:54 msgid "Cascade" msgstr "एक के बाद एक" -#: demo/oxygenmdidemowidget.cpp:54 -#, fuzzy -#| msgid "Two buttons" -msgid "Tools" -msgstr "दो बटन" - -#: demo/oxygenmdidemowidget.cpp:56 +#: oxygen/demo/oxygenmdidemowidget.cpp:58 msgid "Select Next Window" msgstr "अगला विंडो चुनें " -#: demo/oxygenmdidemowidget.cpp:60 +#: oxygen/demo/oxygenmdidemowidget.cpp:62 msgid "Select Previous Window" msgstr "पिछला विंडो चुनें " -#: demo/oxygensimulator.h:91 +#: oxygen/demo/oxygensimulator.h:91 msgid "This is a sample text" msgstr "" #. i18n: ectx: property (title), widget (QGroupBox, groupBox) -#: demo/ui/oxygenbenchmarkwidget.ui:20 +#: oxygen/demo/ui/oxygenbenchmarkwidget.ui:20 msgid "Modules" msgstr "मॉड्यूल्स" #. i18n: ectx: property (text), widget (QLabel, label) -#: demo/ui/oxygenbenchmarkwidget.ui:26 +#: oxygen/demo/ui/oxygenbenchmarkwidget.ui:26 msgid "Select below the modules for which you want to run the simulation:" msgstr "" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_2) -#: demo/ui/oxygenbenchmarkwidget.ui:39 +#: oxygen/demo/ui/oxygenbenchmarkwidget.ui:39 msgid "Options" msgstr "विकल्प" #. i18n: ectx: property (text), widget (QCheckBox, grabMouseCheckBox) -#: demo/ui/oxygenbenchmarkwidget.ui:45 +#: oxygen/demo/ui/oxygenbenchmarkwidget.ui:45 msgid "Grab mouse" msgstr "पकड़ें माउस" -#. i18n: ectx: property (text), widget (QPushButton, runButton) -#: demo/ui/oxygenbenchmarkwidget.ui:86 +#. i18n: ectx: property (text), widget (KPushButton, runButton) +#: oxygen/demo/ui/oxygenbenchmarkwidget.ui:86 #, fuzzy msgid "Run Simulation" msgstr "चलाएँ" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_3) -#: demo/ui/oxygenbuttondemowidget.ui:20 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:20 msgid "Checkboxes" msgstr "चेक बॉक्स" #. i18n: ectx: property (text), widget (QCheckBox, checkBox) -#: demo/ui/oxygenbuttondemowidget.ui:28 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:28 msgid "Off" msgstr "बंद" #. i18n: ectx: property (text), widget (QCheckBox, checkBox_2) -#: demo/ui/oxygenbuttondemowidget.ui:35 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:35 msgid "Partial" msgstr "आंशिक" #. i18n: ectx: property (text), widget (QCheckBox, checkBox_3) -#: demo/ui/oxygenbuttondemowidget.ui:45 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:45 msgid "On" msgstr "चालू" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_4) -#: demo/ui/oxygenbuttondemowidget.ui:73 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:73 msgid "Radiobuttons" msgstr "रेडियोबटन" #. i18n: ectx: property (text), widget (QRadioButton, radioButton) -#: demo/ui/oxygenbuttondemowidget.ui:84 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:84 msgid "First Choice" msgstr "प्रथम चुनाव" #. i18n: ectx: property (text), widget (QRadioButton, radioButton_2) -#: demo/ui/oxygenbuttondemowidget.ui:94 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:94 msgid "Second Choice" msgstr "दूसरा चुनाव" #. i18n: ectx: property (text), widget (QRadioButton, radioButton_3) -#: demo/ui/oxygenbuttondemowidget.ui:101 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:101 msgid "Third Choice" msgstr "तीसरा चुनाव" #. i18n: ectx: property (title), widget (QGroupBox, groupBox) -#: demo/ui/oxygenbuttondemowidget.ui:126 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:126 #, fuzzy #| msgid "No buttons" msgid "Pushbuttons" msgstr "नहीं बटन" #. i18n: ectx: property (text), widget (QLabel, label_7) -#: demo/ui/oxygenbuttondemowidget.ui:132 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:132 msgid "Text only:" msgstr "सिर्फ पाठ:" +#. i18n: ectx: property (toolTip), widget (KPushButton, pushButton) +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:142 +msgid "This is a normal, text only button" +msgstr "" + +#. i18n: ectx: property (toolTip), widget (KPushButton, pushButton_2) +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:152 +msgid "This is a normal, text only button with menu" +msgstr "" + #. i18n: ectx: property (toolTip), widget (KComboBox, kcombobox) -#: demo/ui/oxygenbuttondemowidget.ui:142 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:162 msgid "This is a normal, text only combo box" msgstr "" #. i18n: ectx: property (text), item, widget (KComboBox, kcombobox) -#: demo/ui/oxygenbuttondemowidget.ui:149 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:169 msgid "Small" msgstr "छोटा" #. i18n: ectx: property (text), item, widget (KComboBox, kcombobox) -#: demo/ui/oxygenbuttondemowidget.ui:159 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:179 msgid "Large" msgstr "बड़ा" #. i18n: ectx: property (text), widget (QLabel, label_8) -#: demo/ui/oxygenbuttondemowidget.ui:180 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:200 msgid "Text and icon:" msgstr "पाठ और प्रतीक:" +#. i18n: ectx: property (toolTip), widget (KPushButton, pushButton_3) +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:210 +msgid "This is a normal, text and icon button" +msgstr "" + +#. i18n: ectx: property (toolTip), widget (KPushButton, pushButton_4) +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:220 +msgid "This is a normal, text and icon button with menu" +msgstr "" + #. i18n: ectx: property (text), widget (QCheckBox, flatButtonCheckBox) -#: demo/ui/oxygenbuttondemowidget.ui:190 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:230 msgid "Use flat buttons" msgstr "चपटे बटन उपयोग करें" #. i18n: ectx: property (toolTip), widget (KComboBox, kcombobox_2) -#: demo/ui/oxygenbuttondemowidget.ui:197 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:237 msgid "This is a normal, text and icon combo box" msgstr "" #. i18n: ectx: property (toolTip), widget (QToolButton, toolButton) -#: demo/ui/oxygenbuttondemowidget.ui:204 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:244 msgid "This is a normal, text only tool button" msgstr "" #. i18n: ectx: property (toolTip), widget (QToolButton, toolButton_2) -#: demo/ui/oxygenbuttondemowidget.ui:214 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:254 msgid "This is a normal, text and icon tool button" msgstr "" -#. i18n: ectx: property (toolTip), widget (QPushButton, pushButton) -#: demo/ui/oxygenbuttondemowidget.ui:224 -msgid "This is a normal, text only button" -msgstr "" - -#. i18n: ectx: property (toolTip), widget (QPushButton, pushButton_2) -#: demo/ui/oxygenbuttondemowidget.ui:234 -msgid "This is a normal, text only button with menu" -msgstr "" - -#. i18n: ectx: property (toolTip), widget (QPushButton, pushButton_3) -#: demo/ui/oxygenbuttondemowidget.ui:244 -msgid "This is a normal, text and icon button" -msgstr "" - -#. i18n: ectx: property (toolTip), widget (QPushButton, pushButton_4) -#: demo/ui/oxygenbuttondemowidget.ui:254 -msgid "This is a normal, text and icon button with menu" -msgstr "" - #. i18n: ectx: property (title), widget (QGroupBox, groupBox_2) -#: demo/ui/oxygenbuttondemowidget.ui:267 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:267 #, fuzzy #| msgid "Two buttons" msgid "Toolbuttons" @@ -771,482 +786,469 @@ #. i18n: ectx: property (text), widget (QToolButton, toolButton_6) #. i18n: ectx: property (text), widget (QToolButton, toolButton_7) #. i18n: ectx: property (text), widget (QToolButton, toolButton_8) -#: demo/ui/oxygenbuttondemowidget.ui:335 demo/ui/oxygenbuttondemowidget.ui:348 -#: demo/ui/oxygenbuttondemowidget.ui:361 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:335 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:348 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:361 msgid "Flat" msgstr "समतल" #. i18n: ectx: property (text), widget (QToolButton, toolButton_9) -#: demo/ui/oxygenbuttondemowidget.ui:374 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:374 msgid "Up Arrow" msgstr "ऊपर तीर" #. i18n: ectx: property (text), widget (QToolButton, toolButton_10) -#: demo/ui/oxygenbuttondemowidget.ui:384 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:384 msgid "Down Arrow" msgstr "नीचे तीर" #. i18n: ectx: property (text), widget (QToolButton, toolButton_11) -#: demo/ui/oxygenbuttondemowidget.ui:397 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:397 msgid "Left Arrow" msgstr "बायाँ तीर" #. i18n: ectx: property (text), widget (QToolButton, toolButton_12) -#: demo/ui/oxygenbuttondemowidget.ui:407 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:407 msgid "Right Arrow" msgstr "दायाँ तीर" #. i18n: ectx: property (text), widget (QLabel, label_2) #. i18n: ectx: property (text), widget (QLabel, label_11) -#: demo/ui/oxygenbuttondemowidget.ui:420 demo/ui/oxygentabdemowidget.ui:69 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:420 +#: oxygen/demo/ui/oxygentabdemowidget.ui:69 #, fuzzy msgid "Text position:" msgstr "पाठ:" #. i18n: ectx: property (text), item, widget (KComboBox, textPositionComboBox) #. i18n: ectx: property (text), item, widget (KComboBox, textPosition) -#: demo/ui/oxygenbuttondemowidget.ui:434 demo/ui/oxygentabdemowidget.ui:83 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:434 +#: oxygen/demo/ui/oxygentabdemowidget.ui:83 msgid "Icons Only" msgstr "सिर्फ प्रतीक" #. i18n: ectx: property (text), item, widget (KComboBox, textPositionComboBox) #. i18n: ectx: property (text), item, widget (KComboBox, textPosition) -#: demo/ui/oxygenbuttondemowidget.ui:439 demo/ui/oxygentabdemowidget.ui:88 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:439 +#: oxygen/demo/ui/oxygentabdemowidget.ui:88 msgid "Text Only" msgstr "सिर्फ पाठ" #. i18n: ectx: property (text), item, widget (KComboBox, textPositionComboBox) #. i18n: ectx: property (text), item, widget (KComboBox, textPosition) -#: demo/ui/oxygenbuttondemowidget.ui:444 demo/ui/oxygentabdemowidget.ui:93 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:444 +#: oxygen/demo/ui/oxygentabdemowidget.ui:93 msgid "Text Alongside Icons" msgstr "प्रतीकों के बाज़ू में पाठ" #. i18n: ectx: property (text), item, widget (KComboBox, textPosition) -#: demo/ui/oxygenbuttondemowidget.ui:449 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:449 msgid "Text Under Icons" msgstr "प्रतीकों के नीचे पाठ" #. i18n: ectx: property (text), widget (QLabel, label_12) -#: demo/ui/oxygenbuttondemowidget.ui:470 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:470 msgid "Icon size:" msgstr "प्रतीक आकार :" #. i18n: ectx: property (text), item, widget (KComboBox, iconSize) -#: demo/ui/oxygenbuttondemowidget.ui:484 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:484 msgid "Small (16x16)" msgstr "छोटा (16x16)" #. i18n: ectx: property (text), item, widget (KComboBox, iconSize) -#: demo/ui/oxygenbuttondemowidget.ui:489 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:489 msgid "Medium (22x22)" msgstr "मध्यम (22x22)" #. i18n: ectx: property (text), item, widget (KComboBox, iconSize) -#: demo/ui/oxygenbuttondemowidget.ui:494 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:494 msgid "Large (32x32)" msgstr "बड़ा (32x32)" #. i18n: ectx: property (text), item, widget (KComboBox, iconSize) -#: demo/ui/oxygenbuttondemowidget.ui:499 +#: oxygen/demo/ui/oxygenbuttondemowidget.ui:499 msgid "Huge (48x48)" msgstr "बहुत बड़ा (48x48)" #. i18n: ectx: property (text), widget (QLabel, label) -#: demo/ui/oxygenframedemowidget.ui:19 +#: oxygen/demo/ui/oxygenframedemowidget.ui:19 #, fuzzy #| msgid "Layout Direction:" msgid "Layout direction:" msgstr "ले-आउट दिशा:" #. i18n: ectx: property (text), item, widget (KComboBox, directionComboBox) -#: demo/ui/oxygenframedemowidget.ui:33 +#: oxygen/demo/ui/oxygenframedemowidget.ui:33 msgid "Left to Right" msgstr "बांयें से दाहिने" #. i18n: ectx: property (text), item, widget (KComboBox, directionComboBox) -#: demo/ui/oxygenframedemowidget.ui:38 +#: oxygen/demo/ui/oxygenframedemowidget.ui:38 msgid "Right to Left" msgstr "दाहिने से बांयें" #. i18n: ectx: property (text), item, widget (KComboBox, directionComboBox) -#: demo/ui/oxygenframedemowidget.ui:43 +#: oxygen/demo/ui/oxygenframedemowidget.ui:43 msgid "Top to Bottom" msgstr "ऊपर से नीचे" #. i18n: ectx: property (text), item, widget (KComboBox, directionComboBox) -#: demo/ui/oxygenframedemowidget.ui:48 +#: oxygen/demo/ui/oxygenframedemowidget.ui:48 msgid "Bottom to Top" msgstr "नीचे से ऊपर" #. i18n: ectx: property (title), widget (QGroupBox, groupBox) -#: demo/ui/oxygenframedemowidget.ui:73 +#: oxygen/demo/ui/oxygenframedemowidget.ui:73 msgid "GroupBox" msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, flatGroupBoxCheckBox) -#: demo/ui/oxygenframedemowidget.ui:79 +#: oxygen/demo/ui/oxygenframedemowidget.ui:79 msgctxt "Flat group box. No frame is actually drawn" msgid "Flat" msgstr "समतल" #. i18n: ectx: property (text), widget (QRadioButton, raisedFrameRadioButton) -#: demo/ui/oxygenframedemowidget.ui:121 +#: oxygen/demo/ui/oxygenframedemowidget.ui:121 msgid "Raised" msgstr "" #. i18n: ectx: property (text), widget (QRadioButton, plainFrameRadioButton) -#: demo/ui/oxygenframedemowidget.ui:134 +#: oxygen/demo/ui/oxygenframedemowidget.ui:134 msgctxt "Flat frame. No frame is actually drawn." msgid "Flat" msgstr "समतल" #. i18n: ectx: property (text), widget (QRadioButton, sunkenFrameRadioButton) -#: demo/ui/oxygenframedemowidget.ui:141 +#: oxygen/demo/ui/oxygenframedemowidget.ui:141 msgid "Sunken" msgstr "" #. i18n: ectx: attribute (title), widget (QWidget, tab) -#: demo/ui/oxygenframedemowidget.ui:168 +#: oxygen/demo/ui/oxygenframedemowidget.ui:168 msgid "Tab Widget" msgstr "टैब विजेट" #. i18n: ectx: property (text), widget (QLabel, label) -#: demo/ui/oxygeninputdemowidget.ui:20 +#: oxygen/demo/ui/oxygeninputdemowidget.ui:20 msgid "Single line text editor:" msgstr "एकल लकीर पाठ संपादक:" #. i18n: ectx: property (text), widget (QLabel, label_2) -#: demo/ui/oxygeninputdemowidget.ui:56 +#: oxygen/demo/ui/oxygeninputdemowidget.ui:56 msgid "Password editor:" msgstr "पासवर्ड संपादक:" #. i18n: ectx: property (text), widget (QLabel, label_3) -#: demo/ui/oxygeninputdemowidget.ui:79 +#: oxygen/demo/ui/oxygeninputdemowidget.ui:79 msgid "Editable combobox" msgstr "संशोधनीय कॉम्बोबॉक्स" #. i18n: ectx: property (text), item, widget (KComboBox, kcombobox) -#: demo/ui/oxygeninputdemowidget.ui:96 +#: oxygen/demo/ui/oxygeninputdemowidget.ui:96 msgid "First item" msgstr "पहला मद" #. i18n: ectx: property (text), item, widget (KComboBox, kcombobox) -#: demo/ui/oxygeninputdemowidget.ui:101 +#: oxygen/demo/ui/oxygeninputdemowidget.ui:101 msgid "Second item" msgstr "दूसरा मद" #. i18n: ectx: property (text), item, widget (KComboBox, kcombobox) -#: demo/ui/oxygeninputdemowidget.ui:106 +#: oxygen/demo/ui/oxygeninputdemowidget.ui:106 msgid "Third item" msgstr "तीसरा मद" #. i18n: ectx: property (text), widget (QLabel, label_4) -#: demo/ui/oxygeninputdemowidget.ui:114 +#: oxygen/demo/ui/oxygeninputdemowidget.ui:114 msgid "Spinbox:" msgstr "" #. i18n: ectx: property (text), widget (QLabel, label_5) -#: demo/ui/oxygeninputdemowidget.ui:137 +#: oxygen/demo/ui/oxygeninputdemowidget.ui:140 #, fuzzy msgid "Multi-line text editor:" msgstr "लकीर पाठ:" #. i18n: ectx: property (text), widget (QCheckBox, wrapCheckBox) -#: demo/ui/oxygeninputdemowidget.ui:144 +#: oxygen/demo/ui/oxygeninputdemowidget.ui:150 msgid "Wrap words" msgstr "शब्द व्रैप" #. i18n: ectx: property (text), widget (QCheckBox, flatCheckBox) -#: demo/ui/oxygeninputdemowidget.ui:151 +#: oxygen/demo/ui/oxygeninputdemowidget.ui:157 #, fuzzy msgid "Use flat widgets" msgstr "उपयोग" #. i18n: ectx: property (text), item, widget (QListWidget, listWidget) #. i18n: ectx: property (text), item, widget (QTreeWidget, treeWidget) -#: demo/ui/oxygenlistdemowidget.ui:25 demo/ui/oxygenlistdemowidget.ui:95 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:25 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:95 #, fuzzy msgid "First Item" msgstr "प्रथम वस्तु" #. i18n: ectx: property (text), item, widget (QListWidget, listWidget) #. i18n: ectx: property (text), item, widget (QTreeWidget, treeWidget) -#: demo/ui/oxygenlistdemowidget.ui:30 demo/ui/oxygenlistdemowidget.ui:71 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:30 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:71 msgid "Second Item" msgstr "दूसरी वस्तु" #. i18n: ectx: property (text), item, widget (QListWidget, listWidget) #. i18n: ectx: property (text), item, widget (QTreeWidget, treeWidget) -#: demo/ui/oxygenlistdemowidget.ui:35 demo/ui/oxygenlistdemowidget.ui:55 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:35 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:55 msgid "Third Item" msgstr "तीसरी वस्तु" #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) -#: demo/ui/oxygenlistdemowidget.ui:45 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:45 msgid "Title" msgstr "शीर्षक" #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) -#: demo/ui/oxygenlistdemowidget.ui:50 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:50 msgid "Description" msgstr "वर्णन" #. i18n: ectx: property (text), item, widget (QTreeWidget, treeWidget) -#: demo/ui/oxygenlistdemowidget.ui:58 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:58 msgid "Third Description" msgstr "तीसरा वर्णन" #. i18n: ectx: property (text), item, widget (QTreeWidget, treeWidget) -#: demo/ui/oxygenlistdemowidget.ui:62 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:62 #, fuzzy #| msgid "Third item" msgid "Third Subitem" msgstr "तीसरा मद" #. i18n: ectx: property (text), item, widget (QTreeWidget, treeWidget) -#: demo/ui/oxygenlistdemowidget.ui:65 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:65 #, fuzzy msgid "Third Subitem Description" msgstr "वर्णन" #. i18n: ectx: property (text), item, widget (QTreeWidget, treeWidget) -#: demo/ui/oxygenlistdemowidget.ui:74 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:74 msgid "Second Description" msgstr "दूसरा वर्णन" #. i18n: ectx: property (text), item, widget (QTreeWidget, treeWidget) -#: demo/ui/oxygenlistdemowidget.ui:78 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:78 #, fuzzy msgid "Second Subitem" msgstr "सेकण्ड" #. i18n: ectx: property (text), item, widget (QTreeWidget, treeWidget) -#: demo/ui/oxygenlistdemowidget.ui:81 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:81 #, fuzzy msgid "Second Subitem Description" msgstr "सेकण्ड वर्णन" #. i18n: ectx: property (text), item, widget (QTreeWidget, treeWidget) -#: demo/ui/oxygenlistdemowidget.ui:86 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:86 #, fuzzy msgid "First Subitem" msgstr "प्रथम" #. i18n: ectx: property (text), item, widget (QTreeWidget, treeWidget) -#: demo/ui/oxygenlistdemowidget.ui:89 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:89 #, fuzzy msgid "First Subitem Description" msgstr "प्रथम वर्णन" #. i18n: ectx: property (text), item, widget (QTreeWidget, treeWidget) -#: demo/ui/oxygenlistdemowidget.ui:98 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:98 msgid "First Description" msgstr "पहला वर्णन" #. i18n: ectx: property (text), widget (QTableWidget, tableWidget) -#: demo/ui/oxygenlistdemowidget.ui:108 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:108 msgid "New Row" msgstr "नयी पंक्ति" #. i18n: ectx: property (text), widget (QTableWidget, tableWidget) -#: demo/ui/oxygenlistdemowidget.ui:113 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:113 msgid "First Row" msgstr "पहली पंक्ति" #. i18n: ectx: property (text), widget (QTableWidget, tableWidget) -#: demo/ui/oxygenlistdemowidget.ui:118 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:118 msgid "Third Row" msgstr "तीसरी पंक्ति" #. i18n: ectx: property (text), widget (QTableWidget, tableWidget) -#: demo/ui/oxygenlistdemowidget.ui:123 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:123 msgid "First Column" msgstr "पहला स्तम्भ" #. i18n: ectx: property (text), widget (QTableWidget, tableWidget) -#: demo/ui/oxygenlistdemowidget.ui:128 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:128 msgid "Second Column" msgstr " ्ड स्तम्भ" #. i18n: ectx: property (text), widget (QTableWidget, tableWidget) -#: demo/ui/oxygenlistdemowidget.ui:133 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:133 msgid "Third Column" msgstr "तीसरा स्तम्भ" #. i18n: ectx: property (text), item, widget (QTableWidget, tableWidget) -#: demo/ui/oxygenlistdemowidget.ui:138 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:138 msgid "Top-left" msgstr "ऊपर बायाँ" #. i18n: ectx: property (text), item, widget (QTableWidget, tableWidget) -#: demo/ui/oxygenlistdemowidget.ui:143 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:143 msgid "Top" msgstr "ऊपर" #. i18n: ectx: property (text), item, widget (QTableWidget, tableWidget) -#: demo/ui/oxygenlistdemowidget.ui:148 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:148 msgid "Top-right" msgstr "ऊपर दायाँ" #. i18n: ectx: property (text), item, widget (QTableWidget, tableWidget) -#: demo/ui/oxygenlistdemowidget.ui:153 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:153 msgid "Left " msgstr "बायाँ " #. i18n: ectx: property (text), item, widget (QTableWidget, tableWidget) -#: demo/ui/oxygenlistdemowidget.ui:158 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:158 msgid "Center" msgstr "बीच में" #. i18n: ectx: property (text), item, widget (QTableWidget, tableWidget) -#: demo/ui/oxygenlistdemowidget.ui:163 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:163 msgid "Right" msgstr "दायाँ" #. i18n: ectx: property (text), item, widget (QTableWidget, tableWidget) -#: demo/ui/oxygenlistdemowidget.ui:168 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:168 msgid "Bottom-left" msgstr "नीचे बायाँ" #. i18n: ectx: property (text), item, widget (QTableWidget, tableWidget) -#: demo/ui/oxygenlistdemowidget.ui:173 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:173 msgid "Bottom" msgstr "नीचे" #. i18n: ectx: property (text), item, widget (QTableWidget, tableWidget) -#: demo/ui/oxygenlistdemowidget.ui:178 +#: oxygen/demo/ui/oxygenlistdemowidget.ui:178 msgid "Bottom-right" msgstr "नीचे दायाँ" #. i18n: ectx: property (windowTitle), widget (QWidget, Editors) -#: demo/ui/oxygenmdidemowidget.ui:33 +#: oxygen/demo/ui/oxygenmdidemowidget.ui:33 msgid "Editors" msgstr "संपादक" #. i18n: ectx: property (text), widget (QLabel, label) -#: demo/ui/oxygenmdidemowidget.ui:39 +#: oxygen/demo/ui/oxygenmdidemowidget.ui:39 msgid "Title:" msgstr "शीर्षक:" #. i18n: ectx: property (windowTitle), widget (QWidget, Toolbox) -#: demo/ui/oxygenmdidemowidget.ui:66 +#: oxygen/demo/ui/oxygenmdidemowidget.ui:66 msgid "Toolbox" msgstr "" #. i18n: ectx: attribute (label), widget (QWidget, page) -#: demo/ui/oxygenmdidemowidget.ui:84 +#: oxygen/demo/ui/oxygenmdidemowidget.ui:84 msgid "First Page" msgstr "प्रथम पृष्ठ" #. i18n: ectx: attribute (label), widget (QWidget, page_2) -#: demo/ui/oxygenmdidemowidget.ui:98 +#: oxygen/demo/ui/oxygenmdidemowidget.ui:98 msgid "Second Page" msgstr "द्वितीय पृष्ठ" #. i18n: ectx: property (text), widget (QLabel, label_2) -#: demo/ui/oxygenmdidemowidget.ui:104 +#: oxygen/demo/ui/oxygenmdidemowidget.ui:104 #, fuzzy #| msgid "First Page" msgid "First Label" msgstr "प्रथम पृष्ठ" #. i18n: ectx: property (text), widget (QLabel, label_3) -#: demo/ui/oxygenmdidemowidget.ui:111 +#: oxygen/demo/ui/oxygenmdidemowidget.ui:111 #, fuzzy #| msgid "Second Page" msgid "Second Label" msgstr "द्वितीय पृष्ठ" #. i18n: ectx: attribute (label), widget (QWidget, page_3) -#: demo/ui/oxygenmdidemowidget.ui:140 +#: oxygen/demo/ui/oxygenmdidemowidget.ui:140 msgid "Third Page" msgstr "तृतीय पृष्ठ" #. i18n: ectx: property (title), widget (QGroupBox, groupBox) -#: demo/ui/oxygensliderdemowidget.ui:20 +#: oxygen/demo/ui/oxygensliderdemowidget.ui:20 msgid "Horizontal" msgstr "समतल" #. i18n: ectx: property (text), widget (QCheckBox, checkBox) #. i18n: ectx: property (text), widget (QCheckBox, checkBox_2) -#: demo/ui/oxygensliderdemowidget.ui:49 demo/ui/oxygensliderdemowidget.ui:66 +#: oxygen/demo/ui/oxygensliderdemowidget.ui:49 +#: oxygen/demo/ui/oxygensliderdemowidget.ui:66 msgid "Busy" msgstr "" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_2) -#: demo/ui/oxygensliderdemowidget.ui:121 +#: oxygen/demo/ui/oxygensliderdemowidget.ui:121 msgid "Vertical" msgstr "लम्ब" #. i18n: ectx: property (text), widget (QLabel, label) -#: demo/ui/oxygentabdemowidget.ui:19 +#: oxygen/demo/ui/oxygentabdemowidget.ui:19 #, fuzzy msgid "Tab position:" msgstr "टैब:" #. i18n: ectx: property (text), item, widget (KComboBox, tabPositionComboBox) -#: demo/ui/oxygentabdemowidget.ui:33 +#: oxygen/demo/ui/oxygentabdemowidget.ui:33 msgid "North" msgstr "उत्तर" #. i18n: ectx: property (text), item, widget (KComboBox, tabPositionComboBox) -#: demo/ui/oxygentabdemowidget.ui:38 +#: oxygen/demo/ui/oxygentabdemowidget.ui:38 msgid "South" msgstr "दक्षिण" #. i18n: ectx: property (text), item, widget (KComboBox, tabPositionComboBox) -#: demo/ui/oxygentabdemowidget.ui:43 +#: oxygen/demo/ui/oxygentabdemowidget.ui:43 msgid "West" msgstr "पश्चिम" #. i18n: ectx: property (text), item, widget (KComboBox, tabPositionComboBox) -#: demo/ui/oxygentabdemowidget.ui:48 +#: oxygen/demo/ui/oxygentabdemowidget.ui:48 msgid "East" msgstr "पूर्व" #. i18n: ectx: property (text), widget (QCheckBox, documentModeCheckBox) -#: demo/ui/oxygentabdemowidget.ui:103 +#: oxygen/demo/ui/oxygentabdemowidget.ui:103 msgid "Document mode" msgstr "दस्तावेज़ मोड" #. i18n: ectx: property (text), widget (QCheckBox, cornerWidgetsCheckBox) -#: demo/ui/oxygentabdemowidget.ui:110 +#: oxygen/demo/ui/oxygentabdemowidget.ui:110 #, fuzzy msgid "Show Corner Buttons" msgstr "दिखाएँ बटन्स" #. i18n: ectx: property (text), widget (QCheckBox, tabBarVisibilityCheckBox) -#: demo/ui/oxygentabdemowidget.ui:117 +#: oxygen/demo/ui/oxygentabdemowidget.ui:117 msgid "Hide tabbar" msgstr "टेबपट्टी छुपाएँ" #. i18n: ectx: property (title), widget (QGroupBox, groupBox) -#: demo/ui/oxygentabdemowidget.ui:124 +#: oxygen/demo/ui/oxygentabdemowidget.ui:124 msgid "Preview" msgstr "पूर्वावलोकन" -#~ msgctxt "NAME OF TRANSLATORS" -#~ msgid "Your names" -#~ msgstr "G Karunakar" - -#~ msgctxt "EMAIL OF TRANSLATORS" -#~ msgid "Your emails" -#~ msgstr "karunakar@indlinux.org" - -#, fuzzy -#~ msgid "Oxygen expert configuration tool" -#~ msgstr "आक्सीजन" - -#~ msgid "(c) 2010, Hugo Pereira Da Costa" -#~ msgstr "(c) 2010, हुगो परेरा दा कोस्टा" - -#~ msgid "Hugo Pereira Da Costa" -#~ msgstr "हुगो परेरा दा कोस्टा" - -#, fuzzy -#~ msgid "Oxygen style demonstration" -#~ msgstr "आक्सीजन" - #, fuzzy #~| msgid "Draw toolbar item separators" #~ msgid "Draw keyboard accelerators" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/ksysguardlsofwidgets.po kde-l10n-hi-4.13.0/messages/kde-workspace/ksysguardlsofwidgets.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/ksysguardlsofwidgets.po 2013-02-11 21:49:05.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/ksysguardlsofwidgets.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: ksysguardlsofwidgets\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2012-08-20 05:33+0200\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-12-09 01:55+0530\n" "Last-Translator: G Karunakar\n" "Language-Team: Hindi <en@li.org>\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/ksysguard.po kde-l10n-hi-4.13.0/messages/kde-workspace/ksysguard.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/ksysguard.po 2014-01-16 03:23:46.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/ksysguard.po 2014-01-16 06:16:13.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: ksysguard\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-01-16 01:35+0000\n" +"POT-Creation-Date: 2014-01-16 05:18+0000\n" "PO-Revision-Date: 2007-10-31 14:02+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -18,6 +18,14 @@ "X-Generator: KBabel 1.11.4\n" "Plural-Forms: nplurals=2; plural=(n!=1);\n" +msgctxt "NAME OF TRANSLATORS" +msgid "Your names" +msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर" + +msgctxt "EMAIL OF TRANSLATORS" +msgid "Your emails" +msgstr "raviratlami@aol.in" + #: HostConnector.cpp:44 msgid "Connect Host" msgstr "होस्ट जोड़ें" @@ -98,59 +106,59 @@ msgid "e.g. ssh -l root remote.host.org ksysguardd" msgstr "उदाहरण- ssh -l root remote.host.org ksysguardd" -#: ksysguard.cpp:69 +#: ksysguard.cpp:70 msgid "KDE System Monitor" msgstr "केडीई तंत्र मॉनीटर" -#: ksysguard.cpp:157 ksysguard.cpp:528 +#: ksysguard.cpp:158 ksysguard.cpp:529 msgid "System Monitor" msgstr "तंत्र मॉनीटर" -#: ksysguard.cpp:158 +#: ksysguard.cpp:159 msgid "&Refresh Tab" msgstr "" -#: ksysguard.cpp:159 +#: ksysguard.cpp:160 msgid "&New Tab..." msgstr "" -#: ksysguard.cpp:160 +#: ksysguard.cpp:161 msgid "Import Tab Fr&om File..." msgstr "" -#: ksysguard.cpp:161 +#: ksysguard.cpp:162 msgid "Save Tab &As..." msgstr "" -#: ksysguard.cpp:162 +#: ksysguard.cpp:163 msgid "&Close Tab" msgstr "" -#: ksysguard.cpp:163 +#: ksysguard.cpp:164 #, fuzzy #| msgid "Monitor remote machine..." msgid "Monitor &Remote Machine..." msgstr "रिमोट मशीन मॉनीटर करें..." -#: ksysguard.cpp:164 +#: ksysguard.cpp:165 #, fuzzy #| msgid "&New Worksheet..." msgid "&Download New Tabs..." msgstr "नया वर्कशीट... (&N)" -#: ksysguard.cpp:165 +#: ksysguard.cpp:166 #, fuzzy #| msgid "&New Worksheet..." msgid "&Upload Current Tab..." msgstr "नया वर्कशीट... (&N)" -#: ksysguard.cpp:167 +#: ksysguard.cpp:168 #, fuzzy #| msgid "&Properties" msgid "Tab &Properties" msgstr "गुण (&P)" -#: ksysguard.cpp:362 +#: ksysguard.cpp:363 #, fuzzy, kde-format #| msgid " %1 processes " msgid "1 processœ1" @@ -158,84 +166,84 @@ msgstr[0] " %1 प्रक्रियाएँ" msgstr[1] " %1 प्रक्रियाएँ" -#: ksysguard.cpp:441 +#: ksysguard.cpp:442 #, fuzzy, kde-format #| msgid " CPU: %1% " msgid "CPU: %1%œ%1%" msgstr "सीपीयू: %1% " -#: ksysguard.cpp:456 +#: ksysguard.cpp:457 #, kde-format msgctxt "Arguments are formatted byte sizes (used/total)" msgid "Memory: %1 / %2œMem: %1 / %2œMem: %1œ%1" msgstr "" -#: ksysguard.cpp:483 +#: ksysguard.cpp:484 msgid " No swap space available " msgstr "कोई स्वेप जगह उपलब्ध नहीं" -#: ksysguard.cpp:485 +#: ksysguard.cpp:486 #, fuzzy, kde-format #| msgid " Swap: %1 / %2 " msgctxt "Arguments are formatted byte sizes (used/total)" msgid "Swap: %1 / %2œSwap: %1œ%1" msgstr "स्वेप: %1 / %2 " -#: ksysguard.cpp:530 +#: ksysguard.cpp:531 #, fuzzy #| msgid "(c) 1996-2006 The KDE System Monitor Developers" msgid "(c) 1996-2008 The KDE System Monitor Developers" msgstr "(c) 1996-2006 केडीई तंत्र मॉनीटर डेवलपर्स" -#: ksysguard.cpp:531 +#: ksysguard.cpp:532 msgid "John Tapsell" msgstr "जॉन टापसेल" -#: ksysguard.cpp:531 +#: ksysguard.cpp:532 msgid "Current Maintainer" msgstr "वर्तमान मेंटेनर" -#: ksysguard.cpp:532 +#: ksysguard.cpp:533 msgid "Chris Schlaeger" msgstr "क्रिस श्लेगर" -#: ksysguard.cpp:532 +#: ksysguard.cpp:533 msgid "Previous Maintainer" msgstr "पूर्व मेंटेनर" -#: ksysguard.cpp:533 +#: ksysguard.cpp:534 msgid "Greg Martyn" msgstr "ग्रेग मार्टिन" -#: ksysguard.cpp:534 +#: ksysguard.cpp:535 msgid "Tobias Koenig" msgstr "टॉबियस कोएनिग" -#: ksysguard.cpp:535 +#: ksysguard.cpp:536 msgid "Nicolas Leclercq" msgstr "निकोलस लेकलर" -#: ksysguard.cpp:536 +#: ksysguard.cpp:537 msgid "Alex Sanda" msgstr "एलेक्स सांदा" -#: ksysguard.cpp:537 +#: ksysguard.cpp:538 msgid "Bernd Johannes Wuebben" msgstr "बर्नड जॉन्स वुएबेन" -#: ksysguard.cpp:538 +#: ksysguard.cpp:539 msgid "Ralf Mueller" msgstr "राल्फ मुलर" -#: ksysguard.cpp:539 +#: ksysguard.cpp:540 msgid "Hamish Rodda" msgstr "हामिश रोदा" -#: ksysguard.cpp:540 +#: ksysguard.cpp:541 msgid "Torsten Kasch" msgstr "टॉर्सटन कैस" -#: ksysguard.cpp:540 +#: ksysguard.cpp:541 msgid "" "Solaris Support\n" "Parts derived (by permission) from the sunos5\n" @@ -245,7 +253,7 @@ "कुछ भागों को सन ओएस 5 के \n" " विलियम लेफ़ेब्व्रे के \"टॉप\" यूटिलिटी से (अनुमति से) लिया गया है." -#: ksysguard.cpp:549 +#: ksysguard.cpp:550 msgid "Optional worksheet files to load" msgstr "लोड करने के लिए वैकल्पिक वर्कशीट फ़ाइलें" @@ -298,12 +306,12 @@ "on to the display to add more sensors." msgstr "" -#: SensorDisplayLib/DancingBars.cpp:96 SensorDisplayLib/FancyPlotter.cpp:283 +#: SensorDisplayLib/DancingBars.cpp:96 SensorDisplayLib/FancyPlotter.cpp:282 msgid "OK" msgstr "ठीक" -#: SensorDisplayLib/DancingBars.cpp:96 SensorDisplayLib/FancyPlotter.cpp:283 -#: SensorDisplayLib/FancyPlotter.cpp:524 SensorDisplayLib/FancyPlotter.cpp:602 +#: SensorDisplayLib/DancingBars.cpp:96 SensorDisplayLib/FancyPlotter.cpp:282 +#: SensorDisplayLib/FancyPlotter.cpp:518 SensorDisplayLib/FancyPlotter.cpp:596 msgid "Error" msgstr "त्रुटि" @@ -316,29 +324,29 @@ msgstr "सीमा" #. i18n: ectx: property (title), widget (QGroupBox, titleFrame) -#: SensorDisplayLib/DancingBarsSettings.cpp:56 +#: SensorDisplayLib/DancingBarsSettings.cpp:57 #: SensorDisplayLib/ListViewSettingsWidget.ui:16 #: SensorDisplayLib/SensorLoggerSettingsWidget.ui:16 WorkSheetSettings.cpp:50 msgid "Title" msgstr "शीर्षक" #. i18n: ectx: property (whatsThis), widget (KLineEdit, m_title) -#: SensorDisplayLib/DancingBarsSettings.cpp:61 -#: SensorDisplayLib/FancyPlotterSettings.cpp:75 +#: SensorDisplayLib/DancingBarsSettings.cpp:62 +#: SensorDisplayLib/FancyPlotterSettings.cpp:73 #: SensorDisplayLib/MultiMeterSettingsWidget.ui:35 msgid "Enter the title of the display here." msgstr "प्रदर्शक का शीर्षक यहाँ भरें." -#: SensorDisplayLib/DancingBarsSettings.cpp:66 +#: SensorDisplayLib/DancingBarsSettings.cpp:67 msgid "Display Range" msgstr "प्रदर्शक सीमा" -#: SensorDisplayLib/DancingBarsSettings.cpp:71 +#: SensorDisplayLib/DancingBarsSettings.cpp:72 #: SensorDisplayLib/FancyPlotterSettings.cpp:101 msgid "Minimum value:" msgstr "न्यूनतम मानः" -#: SensorDisplayLib/DancingBarsSettings.cpp:79 +#: SensorDisplayLib/DancingBarsSettings.cpp:80 msgid "" "Enter the minimum value for the display here. If both values are 0, " "automatic range detection is enabled." @@ -346,12 +354,12 @@ "यहाँ पर प्रदर्शक के लिए न्यूनतम मान प्रविष्ट करें. यदि दोनों मूल्य 0 हों तो सीमा का पता " "लगाना स्वचलित सक्षम होगा." -#: SensorDisplayLib/DancingBarsSettings.cpp:83 +#: SensorDisplayLib/DancingBarsSettings.cpp:84 #: SensorDisplayLib/FancyPlotterSettings.cpp:112 msgid "Maximum value:" msgstr "अधिकतम मानः" -#: SensorDisplayLib/DancingBarsSettings.cpp:91 +#: SensorDisplayLib/DancingBarsSettings.cpp:92 msgid "" "Enter the maximum value for the display here. If both values are 0, " "automatic range detection is enabled." @@ -359,119 +367,119 @@ "यहाँ पर प्रदर्शक के लिए अधिकतम मान प्रविष्ट करें. यदि दोनों मूल्य 0 हों तो सीमा का पता " "लगाना स्वचलित सक्षम होगा." -#: SensorDisplayLib/DancingBarsSettings.cpp:101 +#: SensorDisplayLib/DancingBarsSettings.cpp:102 msgid "Alarms" msgstr "अलार्म्स" #. i18n: ectx: property (title), widget (QGroupBox, GroupBox1) -#: SensorDisplayLib/DancingBarsSettings.cpp:105 +#: SensorDisplayLib/DancingBarsSettings.cpp:107 #: SensorDisplayLib/SensorLoggerDlgWidget.ui:59 msgid "Alarm for Minimum Value" msgstr "न्यूनतम मान के लिए अलार्म" -#: SensorDisplayLib/DancingBarsSettings.cpp:110 -#: SensorDisplayLib/DancingBarsSettings.cpp:133 +#: SensorDisplayLib/DancingBarsSettings.cpp:112 +#: SensorDisplayLib/DancingBarsSettings.cpp:135 msgid "Enable alarm" msgstr "अलार्म सक्षम करें" #. i18n: ectx: property (whatsThis), widget (QCheckBox, m_lowerLimitActive) -#: SensorDisplayLib/DancingBarsSettings.cpp:111 +#: SensorDisplayLib/DancingBarsSettings.cpp:113 #: SensorDisplayLib/MultiMeterSettingsWidget.ui:56 #: SensorDisplayLib/SensorLoggerDlgWidget.ui:71 msgid "Enable the minimum value alarm." msgstr "न्यूनतम मान अलार्म सक्षम करें" #. i18n: ectx: property (text), widget (QLabel, m_lblLowerLimit) -#: SensorDisplayLib/DancingBarsSettings.cpp:114 +#: SensorDisplayLib/DancingBarsSettings.cpp:116 #: SensorDisplayLib/SensorLoggerDlgWidget.ui:97 msgid "Lower limit:" msgstr "निचली सीमाः" #. i18n: ectx: property (title), widget (QGroupBox, GroupBox1_2) -#: SensorDisplayLib/DancingBarsSettings.cpp:128 +#: SensorDisplayLib/DancingBarsSettings.cpp:130 #: SensorDisplayLib/SensorLoggerDlgWidget.ui:123 msgid "Alarm for Maximum Value" msgstr "अधिकतम मान के लिए अलार्म" #. i18n: ectx: property (whatsThis), widget (QCheckBox, m_upperLimitActive) -#: SensorDisplayLib/DancingBarsSettings.cpp:134 +#: SensorDisplayLib/DancingBarsSettings.cpp:136 #: SensorDisplayLib/MultiMeterSettingsWidget.ui:115 #: SensorDisplayLib/SensorLoggerDlgWidget.ui:135 msgid "Enable the maximum value alarm." msgstr "अधिकतम मान अलार्म सक्षम करें" #. i18n: ectx: property (text), widget (QLabel, m_lblUpperLimit) -#: SensorDisplayLib/DancingBarsSettings.cpp:137 +#: SensorDisplayLib/DancingBarsSettings.cpp:139 #: SensorDisplayLib/SensorLoggerDlgWidget.ui:161 msgid "Upper limit:" msgstr "ऊपरी सीमाः" -#: SensorDisplayLib/DancingBarsSettings.cpp:154 +#: SensorDisplayLib/DancingBarsSettings.cpp:156 #, fuzzy #| msgid "Look" msgctxt "@title:tab Appearance of the bar graph" msgid "Look" msgstr "रूप" -#: SensorDisplayLib/DancingBarsSettings.cpp:158 +#: SensorDisplayLib/DancingBarsSettings.cpp:161 msgid "Normal bar color:" msgstr "सामान्य पट्टी रंगः" -#: SensorDisplayLib/DancingBarsSettings.cpp:165 +#: SensorDisplayLib/DancingBarsSettings.cpp:168 msgid "Out-of-range color:" msgstr "सीमा से बाहर रंग" #. i18n: ectx: property (text), widget (QLabel, textLabel3) #. i18n: ectx: property (text), widget (QLabel, textLabel2) #. i18n: ectx: property (text), widget (QLabel, textLabel3_2) -#: SensorDisplayLib/DancingBarsSettings.cpp:172 +#: SensorDisplayLib/DancingBarsSettings.cpp:175 #: SensorDisplayLib/ListViewSettingsWidget.ui:77 -#: SensorDisplayLib/LogFile.cpp:102 SensorDisplayLib/LogFileSettings.ui:67 +#: SensorDisplayLib/LogFile.cpp:100 SensorDisplayLib/LogFileSettings.ui:67 #: SensorDisplayLib/MultiMeterSettingsWidget.ui:228 #: SensorDisplayLib/SensorLoggerSettingsWidget.ui:64 msgid "Background color:" msgstr "पृष्ठभूमि का रंगः" -#: SensorDisplayLib/DancingBarsSettings.cpp:179 -#: SensorDisplayLib/FancyPlotterSettings.cpp:180 +#: SensorDisplayLib/DancingBarsSettings.cpp:182 +#: SensorDisplayLib/FancyPlotterSettings.cpp:183 msgid "Font size:" msgstr "फ़ॉन्ट आकारः" -#: SensorDisplayLib/DancingBarsSettings.cpp:183 +#: SensorDisplayLib/DancingBarsSettings.cpp:186 msgid "" "This determines the size of the font used to print a label underneath the " "bars. Bars are automatically suppressed if text becomes too large, so it is " "advisable to use a small font size here." msgstr "" -#: SensorDisplayLib/DancingBarsSettings.cpp:191 -#: SensorDisplayLib/FancyPlotterSettings.cpp:195 +#: SensorDisplayLib/DancingBarsSettings.cpp:194 +#: SensorDisplayLib/FancyPlotterSettings.cpp:198 msgid "Sensors" msgstr "सेंसर्स " -#: SensorDisplayLib/DancingBarsSettings.cpp:203 +#: SensorDisplayLib/DancingBarsSettings.cpp:207 msgid "Edit..." msgstr "संपादन..." -#: SensorDisplayLib/DancingBarsSettings.cpp:204 +#: SensorDisplayLib/DancingBarsSettings.cpp:208 msgid "Push this button to configure the label." msgstr "लेबल कॉन्फ़िगर करने के लिए इस बटन को दबाएँ" -#: SensorDisplayLib/DancingBarsSettings.cpp:207 -#: SensorDisplayLib/FancyPlotterSettings.cpp:227 +#: SensorDisplayLib/DancingBarsSettings.cpp:211 +#: SensorDisplayLib/FancyPlotterSettings.cpp:231 msgid "Delete" msgstr "मिटाएँ" -#: SensorDisplayLib/DancingBarsSettings.cpp:208 -#: SensorDisplayLib/FancyPlotterSettings.cpp:228 +#: SensorDisplayLib/DancingBarsSettings.cpp:212 +#: SensorDisplayLib/FancyPlotterSettings.cpp:232 msgid "Push this button to delete the sensor." msgstr "सेंसर मिटाने के लिए इस बटन को दबाएँ" -#: SensorDisplayLib/DancingBarsSettings.cpp:362 +#: SensorDisplayLib/DancingBarsSettings.cpp:366 msgid "Label of Bar Graph" msgstr "बार ग्राफ का लेबल" -#: SensorDisplayLib/DancingBarsSettings.cpp:363 +#: SensorDisplayLib/DancingBarsSettings.cpp:367 msgid "Enter new label:" msgstr "नया लेबल भरें:" @@ -486,78 +494,78 @@ "the values of the sensor over time." msgstr "" -#: SensorDisplayLib/FancyPlotter.cpp:179 +#: SensorDisplayLib/FancyPlotter.cpp:178 msgctxt "Largest axis title" msgid "99999 XXXX" msgstr "" -#: SensorDisplayLib/FancyPlotter.cpp:520 SensorDisplayLib/FancyPlotter.cpp:591 -#: SensorDisplayLib/FancyPlotter.cpp:654 +#: SensorDisplayLib/FancyPlotter.cpp:514 SensorDisplayLib/FancyPlotter.cpp:585 +#: SensorDisplayLib/FancyPlotter.cpp:648 #, kde-format msgctxt "units" msgid "%1%" msgstr "" -#: SensorDisplayLib/FancyPlotter.cpp:528 +#: SensorDisplayLib/FancyPlotter.cpp:522 #, kde-format msgctxt "%1 is what is being shown statistics for, like 'Memory', 'Swap', etc." msgid "<p><b>%1:</b><br>" msgstr "" -#: SensorDisplayLib/FancyPlotter.cpp:599 +#: SensorDisplayLib/FancyPlotter.cpp:593 #, kde-format msgid "%1 of %2œ%1" msgstr "" -#: SensorDisplayLib/FancyPlotter.cpp:627 +#: SensorDisplayLib/FancyPlotter.cpp:621 #, kde-format msgctxt "units" msgid "%1 TiB" msgstr "" -#: SensorDisplayLib/FancyPlotter.cpp:630 +#: SensorDisplayLib/FancyPlotter.cpp:624 #, kde-format msgctxt "units" msgid "%1 GiB" msgstr "" -#: SensorDisplayLib/FancyPlotter.cpp:633 +#: SensorDisplayLib/FancyPlotter.cpp:627 #, kde-format msgctxt "units" msgid "%1 MiB" msgstr "" -#: SensorDisplayLib/FancyPlotter.cpp:636 +#: SensorDisplayLib/FancyPlotter.cpp:630 #, kde-format msgctxt "units" msgid "%1 KiB" msgstr "" -#: SensorDisplayLib/FancyPlotter.cpp:641 +#: SensorDisplayLib/FancyPlotter.cpp:635 #, kde-format msgctxt "units" msgid "%1 TiB/s" msgstr "" -#: SensorDisplayLib/FancyPlotter.cpp:644 +#: SensorDisplayLib/FancyPlotter.cpp:638 #, kde-format msgctxt "units" msgid "%1 GiB/s" msgstr "" -#: SensorDisplayLib/FancyPlotter.cpp:647 +#: SensorDisplayLib/FancyPlotter.cpp:641 #, kde-format msgctxt "units" msgid "%1 MiB/s" msgstr "" -#: SensorDisplayLib/FancyPlotter.cpp:650 +#: SensorDisplayLib/FancyPlotter.cpp:644 #, kde-format msgctxt "units" msgid "%1 KiB/s" msgstr "" -#: SensorDisplayLib/FancyPlotter.cpp:656 +#: SensorDisplayLib/FancyPlotter.cpp:650 #, fuzzy, kde-format #| msgctxt "a percentage" #| msgid "%" @@ -571,30 +579,30 @@ msgid "Plotter Settings" msgstr "संकेत प्लाटर विन्यास" -#: SensorDisplayLib/FancyPlotterSettings.cpp:67 +#: SensorDisplayLib/FancyPlotterSettings.cpp:64 msgid "General" msgstr "सामान्य" -#: SensorDisplayLib/FancyPlotterSettings.cpp:71 +#: SensorDisplayLib/FancyPlotterSettings.cpp:69 msgid "Title:" msgstr "शीर्षक:" -#: SensorDisplayLib/FancyPlotterSettings.cpp:79 +#: SensorDisplayLib/FancyPlotterSettings.cpp:77 msgid "Stack the beams on top of each other" msgstr "बीम को एक दूसरे के ऊपर जमाएँ" -#: SensorDisplayLib/FancyPlotterSettings.cpp:80 +#: SensorDisplayLib/FancyPlotterSettings.cpp:78 msgid "" "The beams are stacked on top of each other, and the area is drawn filled in. " "So if one beam has a value of 2 and another beam has a value of 3, the first " "beam will be drawn at value 2 and the other beam drawn at 2+3=5." msgstr "" -#: SensorDisplayLib/FancyPlotterSettings.cpp:87 +#: SensorDisplayLib/FancyPlotterSettings.cpp:85 msgid "Scales" msgstr "स्केल्स" -#: SensorDisplayLib/FancyPlotterSettings.cpp:91 +#: SensorDisplayLib/FancyPlotterSettings.cpp:90 #, fuzzy #| msgid "Vertical Scale" msgid "Vertical scale" @@ -640,65 +648,65 @@ msgid "Grid" msgstr "ग्रिड" -#: SensorDisplayLib/FancyPlotterSettings.cpp:143 +#: SensorDisplayLib/FancyPlotterSettings.cpp:144 msgid "Lines" msgstr "पंक्तियाँ" -#: SensorDisplayLib/FancyPlotterSettings.cpp:148 +#: SensorDisplayLib/FancyPlotterSettings.cpp:150 msgid "Vertical lines" msgstr "खड़ी पंक्तियाँ" -#: SensorDisplayLib/FancyPlotterSettings.cpp:149 +#: SensorDisplayLib/FancyPlotterSettings.cpp:151 msgid "Check this to activate the vertical lines if display is large enough." msgstr "खड़ी पंक्तियों को सक्रिय करने के लिए इसे चेक करें यदि प्रदर्शक काफी बड़ा हो." -#: SensorDisplayLib/FancyPlotterSettings.cpp:152 +#: SensorDisplayLib/FancyPlotterSettings.cpp:154 msgid "Distance:" msgstr "दूरीः" -#: SensorDisplayLib/FancyPlotterSettings.cpp:158 +#: SensorDisplayLib/FancyPlotterSettings.cpp:160 msgid "Enter the distance between two vertical lines here." msgstr "दो खड़ी पंक्तियों के बीच की दूरी यहाँ भरें." -#: SensorDisplayLib/FancyPlotterSettings.cpp:162 +#: SensorDisplayLib/FancyPlotterSettings.cpp:164 msgid "Vertical lines scroll" msgstr "खड़ी पंक्तियाँ स्क्रॉल" -#: SensorDisplayLib/FancyPlotterSettings.cpp:165 +#: SensorDisplayLib/FancyPlotterSettings.cpp:167 msgid "Horizontal lines" msgstr "आड़ी पंक्तियाँ" -#: SensorDisplayLib/FancyPlotterSettings.cpp:166 +#: SensorDisplayLib/FancyPlotterSettings.cpp:168 msgid "Check this to enable horizontal lines if display is large enough." msgstr "आड़ी पंक्तियों को सक्षम करने के लिए इसे चेक करें यदि प्रदर्शक काफी बड़ा हो." -#: SensorDisplayLib/FancyPlotterSettings.cpp:171 +#: SensorDisplayLib/FancyPlotterSettings.cpp:173 msgid "Text" msgstr "पाठ" -#: SensorDisplayLib/FancyPlotterSettings.cpp:176 +#: SensorDisplayLib/FancyPlotterSettings.cpp:179 msgid "Show axis labels" msgstr "" -#: SensorDisplayLib/FancyPlotterSettings.cpp:177 +#: SensorDisplayLib/FancyPlotterSettings.cpp:180 msgid "" "Check this box if horizontal lines should be decorated with the values they " "mark." msgstr "इस बक्से को चेक करे यदि आड़ी लकीरों को चिह्नित की गई मूल्यों से सजाया जाना हो." -#: SensorDisplayLib/FancyPlotterSettings.cpp:219 +#: SensorDisplayLib/FancyPlotterSettings.cpp:223 msgid "Set Color..." msgstr "रंग नियत करें..." -#: SensorDisplayLib/FancyPlotterSettings.cpp:220 +#: SensorDisplayLib/FancyPlotterSettings.cpp:224 msgid "Push this button to configure the color of the sensor in the diagram." msgstr "आकृति के संवेदक में रंगों को कॉन्फ़िगर करने के लिए इस बटन को दबाएँ." -#: SensorDisplayLib/FancyPlotterSettings.cpp:232 +#: SensorDisplayLib/FancyPlotterSettings.cpp:236 msgid "Move Up" msgstr "ऊपर जाएँ" -#: SensorDisplayLib/FancyPlotterSettings.cpp:237 +#: SensorDisplayLib/FancyPlotterSettings.cpp:241 msgid "Move Down" msgstr "नीचे जाएँ" @@ -786,12 +794,12 @@ msgid "Grid color:" msgstr "ग्रिड रंग:" -#: SensorDisplayLib/LogFile.cpp:94 +#: SensorDisplayLib/LogFile.cpp:92 msgid "File logging settings" msgstr "फ़ाइल लॉग विन्यास" #. i18n: ectx: property (text), widget (QLabel, textLabel1) -#: SensorDisplayLib/LogFile.cpp:100 SensorDisplayLib/LogFileSettings.ui:54 +#: SensorDisplayLib/LogFile.cpp:98 SensorDisplayLib/LogFileSettings.ui:54 msgid "Foreground color:" msgstr "अग्रभूमि का रंगः" @@ -884,17 +892,17 @@ msgid "Alarm digit color:" msgstr "अलार्म अक्षर रंगः" -#: SensorDisplayLib/SensorDisplay.cpp:117 +#: SensorDisplayLib/SensorDisplay.cpp:118 #: SensorDisplayLib/SensorLogger.cpp:598 msgid "&Properties" msgstr "गुण (&P)" -#: SensorDisplayLib/SensorDisplay.cpp:122 +#: SensorDisplayLib/SensorDisplay.cpp:123 #: SensorDisplayLib/SensorLogger.cpp:603 msgid "&Remove Display" msgstr "प्रदर्शक मिटाएँ (&R)" -#: SensorDisplayLib/SensorDisplay.cpp:189 +#: SensorDisplayLib/SensorDisplay.cpp:190 #, kde-format msgid "" "<qt><p>This is a sensor display. To customize a sensor display click the " @@ -1166,12 +1174,12 @@ msgid "Enter the title of the worksheet here." msgstr "वर्कशीट का शीर्षक यहाँ भरें." -#: Workspace.cpp:115 +#: Workspace.cpp:113 #, kde-format msgid "Sheet %1" msgstr "शीट %1" -#: Workspace.cpp:174 +#: Workspace.cpp:172 #, fuzzy, kde-format #| msgid "" #| "The worksheet '%1' contains unsaved data.\n" @@ -1183,33 +1191,33 @@ "वर्कशीट %1' में बिना सहेजा डाटा रखा है.\n" "क्या आप वर्कशीट सहेजना चाहेंगे?" -#: Workspace.cpp:189 +#: Workspace.cpp:187 #, fuzzy #| msgid "*.sgrd|Sensor Files" msgid "*.sgrd|Sensor Files (*.sgrd)" msgstr "*.sgrd|सेंसर फ़ाइलें" -#: Workspace.cpp:189 +#: Workspace.cpp:187 msgid "Select Tab File to Import" msgstr "" -#: Workspace.cpp:217 Workspace.cpp:238 +#: Workspace.cpp:215 Workspace.cpp:236 #, fuzzy #| msgid "You do not have a worksheet that could be saved." msgid "You do not have a tab that could be saved." msgstr "आपके पास कोई वर्कशीट नहीं है जिसे सहेजा जा सके." -#: Workspace.cpp:245 +#: Workspace.cpp:243 msgid "Export Tab" msgstr "" -#: Workspace.cpp:263 +#: Workspace.cpp:261 #, fuzzy #| msgid "There are no worksheets that could be deleted." msgid "There are no tabs that could be deleted." msgstr "वहाँ कोई वर्कशीट नहीं है जिसे मिटाया जा सके." -#: Workspace.cpp:303 +#: Workspace.cpp:301 #, kde-format msgid "" "<qt>To propose the current custom tab as a new System Monitor tab, email " @@ -1218,20 +1226,12 @@ "qt>" msgstr "" -#: Workspace.cpp:303 +#: Workspace.cpp:301 #, fuzzy #| msgid "System Monitor" msgid "Upload custom System Monitor tab" msgstr "तंत्र मॉनीटर" -#~ msgctxt "NAME OF TRANSLATORS" -#~ msgid "Your names" -#~ msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर" - -#~ msgctxt "EMAIL OF TRANSLATORS" -#~ msgid "Your emails" -#~ msgstr "raviratlami@aol.in," - #, fuzzy #~| msgid "" #~| "Message from %1:\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/ksystraycmd.po kde-l10n-hi-4.13.0/messages/kde-workspace/ksystraycmd.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/ksystraycmd.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/ksystraycmd.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,134 @@ +# translation of ksystraycmd.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007. +msgid "" +msgstr "" +"Project-Id-Version: ksystraycmd\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2007-10-31 14:45+0530\n" +"Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" + +msgctxt "NAME OF TRANSLATORS" +msgid "Your names" +msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर" + +msgctxt "EMAIL OF TRANSLATORS" +msgid "Your emails" +msgstr "raviratlami@aol.in" + +#: ksystraycmd.cpp:80 +#, kde-format +msgid "No window matching pattern '%1' and no command specified.\n" +msgstr "कोई मेल खाता पैटर्न '%1' विंडो तथा कमांड उल्लेखित नहीं.\n" + +#: ksystraycmd.cpp:87 +msgid "KSysTrayCmd: K3ShellProcess cannot find a shell." +msgstr "KSysTrayCmd: K3ShellProcess को कोई शैल नहीं मिला." + +#: ksystraycmd.cpp:248 main.cpp:26 +msgid "KSysTrayCmd" +msgstr "के-सिस-ट्रे-सीएमडी" + +#: ksystraycmd.cpp:249 +msgid "&Hide" +msgstr "छुपाएँ (&H)" + +#: ksystraycmd.cpp:249 +msgid "&Restore" +msgstr "बहाल करें (&R)" + +#: ksystraycmd.cpp:250 +msgid "&Undock" +msgstr "अनडॉक (&U)" + +#: ksystraycmd.cpp:251 +msgid "&Quit" +msgstr "बाहर जाएँ (&Q)" + +#: main.cpp:28 +msgid "Allows any application to be kept in the system tray" +msgstr "तंत्र तश्तरी में किसी भी क़िस्म के अनुप्रयोग को रखने की अनुमति दें" + +#: main.cpp:30 +msgid "(C) 2001-2002 Richard Moore (rich@kde.org)" +msgstr "(C) 2001-2002 रिचर्ड मूर (rich@kde.org)" + +#: main.cpp:31 +msgid "Richard Moore" +msgstr "रिचर्ड मूर" + +#: main.cpp:36 +msgid "Command to execute" +msgstr "चलाने के लिए कमांड " + +#: main.cpp:38 +msgid "" +"A regular expression matching the window title\n" +"If you do not specify one, then the very first window\n" +"to appear will be taken - not recommended." +msgstr "" + +#: main.cpp:41 +msgid "" +"The window id of the target window\n" +"Specifies the id of the window to use. If the id starts with 0x\n" +"it is assumed to be in hex." +msgstr "" +"लक्ष्य विंडो का विंडो आईडी\n" +"इस्तेमाल किए जाने वाले विंडो का आईडी निर्दिष्ट करता है. यदि आईडी 0x से प्रारंभ होता है " +"तो\n" +"यह माना जाना चाहिए की यह हैक्स में है." + +#: main.cpp:44 +msgid "Hide the window to the tray on startup" +msgstr "विंडो को प्रारंभ में तश्तरी में छुपाएँ" + +#: main.cpp:45 +msgid "" +"Wait until we are told to show the window before\n" +"executing the command" +msgstr "" +"कमांड चलाने से पहले इंतजार करें जब तक \n" +"कि विंडो दिखाने के लिए कहा जाए" + +#: main.cpp:47 +msgid "Sets the initial tooltip for the tray icon" +msgstr "तश्तरी प्रतीक के लिए प्रारंभिक औज़ार-नुस्ख़ा नियत करता है" + +#: main.cpp:48 +msgid "" +"Keep the tray icon even if the client exits. This option\n" +"has no effect unless startonshow is specified." +msgstr "" +"तश्तरी प्रतीक को रखे रहें तब भी जब क्लाएंट बाहर हो जाता है. इस विकल्प का कोई प्रभाव " +"नहीं होता है जब तक कि 'स्टार्टआनशो' निर्दिष्ट नहीं किया जाता." + +#: main.cpp:50 +msgid "" +"Use ksystraycmd's icon instead of the window's icon in the systray\n" +"(should be used with --icon to specify ksystraycmd icon)" +msgstr "" + +#: main.cpp:52 +msgid "Try to keep the window above other windows" +msgstr "विंडो को अन्य विंडो के ऊपर रखने की कोशिश करें" + +#: main.cpp:53 +msgid "" +"Quit the client when we are told to hide the window.\n" +"This has no effect unless startonshow is specified and implies keeprunning." +msgstr "" + +#: main.cpp:91 +msgid "No command or window specified" +msgstr "कोई कमांड या विंडो उल्लेखित नहीं" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kwin_clients.po kde-l10n-hi-4.13.0/messages/kde-workspace/kwin_clients.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kwin_clients.po 2014-03-25 04:40:13.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kwin_clients.po 2013-12-18 06:14:22.000000000 +0000 @@ -8,7 +8,7 @@ msgstr "" "Project-Id-Version: kwin_clients\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-25 01:54+0000\n" +"POT-Creation-Date: 2013-12-18 05:19+0000\n" "PO-Revision-Date: 2010-01-31 20:50+0530\n" "Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -20,6 +20,14 @@ "Plural-Forms: nplurals=2; plural=(n!=1);\n" "\n" +msgctxt "NAME OF TRANSLATORS" +msgid "Your names" +msgstr "राजेश रंजन" + +msgctxt "EMAIL OF TRANSLATORS" +msgid "Your emails" +msgstr "rajesh672@gmail.com" + #. i18n: ectx: property (windowTitle), widget (QWidget, PlastikConfigDialog) #: aurorae/themes/plastik/package/contents/ui/config.ui:14 msgid "Config Dialog" @@ -30,18 +38,24 @@ msgid "Title &Alignment" msgstr "शीर्षक पंक्तिबद्धता (&A)" +#. i18n: ectx: property (text), item, widget (KComboBox, titleAlignment) #. i18n: ectx: property (text), widget (QRadioButton, kcfg_titleAlignLeft) #: aurorae/themes/plastik/package/contents/ui/config.ui:29 +#: oxygen/config/ui/oxygenconfigurationui.ui:115 msgid "Left" msgstr "बायाँ" +#. i18n: ectx: property (text), item, widget (KComboBox, titleAlignment) #. i18n: ectx: property (text), widget (QRadioButton, kcfg_titleAlignCenter) #: aurorae/themes/plastik/package/contents/ui/config.ui:36 +#: oxygen/config/ui/oxygenconfigurationui.ui:120 msgid "Center" msgstr "बीच में" +#. i18n: ectx: property (text), item, widget (KComboBox, titleAlignment) #. i18n: ectx: property (text), widget (QRadioButton, kcfg_titleAlignRight) #: aurorae/themes/plastik/package/contents/ui/config.ui:43 +#: oxygen/config/ui/oxygenconfigurationui.ui:130 msgid "Right" msgstr "दायाँ" @@ -89,364 +103,659 @@ msgid "Animate buttons" msgstr "बटनों को एनिमेट करें" -#, fuzzy -#~| msgid "Decoration Options" -#~ msgid "Hide Advanced Configuration Options" -#~ msgstr "सजावट विकल्प" - -#, fuzzy -#~| msgid "Decoration Options" -#~ msgid "Show Advanced Configuration Options" -#~ msgstr "सजावट विकल्प" - -#, fuzzy -#~| msgid "Animate buttons" -#~ msgid "Animations" -#~ msgstr "बटनों को एनिमेट करें" - -#, fuzzy -#~| msgid "Actions Settings" -#~ msgid "Question - Oxygen Settings" -#~ msgstr "क्रिया विन्यास" - -#~ msgid "Regular Expression" -#~ msgstr "नियमित (रेगुलर) एक्सप्रेशन." - -#~ msgid "Window Title" -#~ msgstr "विंडो का शीर्षक" - -#~ msgid "General" -#~ msgstr "साधारण" - -#, fuzzy -#~| msgid "Border size:" -#~ msgid "Border si&ze:" -#~ msgstr "किनारा आकार:" - -#, fuzzy -#~| msgid "No Border" -#~ msgctxt "@item:inlistbox Border size:" -#~ msgid "No Border" -#~ msgstr "सीमारेखा नहीं" +#: b2/b2client.cpp:403 +msgid "Menu" +msgstr "मेन्यू" + +#: b2/b2client.cpp:405 b2/b2client.cpp:890 +msgid "Not on all desktops" +msgstr "सभी डेस्कटॉप पर नहीं" + +#: b2/b2client.cpp:405 b2/b2client.cpp:890 +msgid "On all desktops" +msgstr "सभी डेस्कटॉप पर" + +#: b2/b2client.cpp:406 oxygen/oxygenclient.cpp:226 +msgid "Minimize" +msgstr "न्यूनतम " + +#: b2/b2client.cpp:406 b2/b2client.cpp:901 oxygen/oxygenclient.cpp:229 +msgid "Maximize" +msgstr "अधिकतम" + +#: b2/b2client.cpp:407 oxygen/oxygenclient.cpp:223 +msgid "Help" +msgstr "मदद" + +#: b2/b2client.cpp:407 oxygen/oxygenclient.cpp:232 +msgid "Close" +msgstr "बंद करें" + +#: b2/b2client.cpp:408 b2/b2client.cpp:933 +msgid "Unshade" +msgstr "छाया हटाएँ" + +#: b2/b2client.cpp:408 b2/b2client.cpp:933 +msgid "Shade" +msgstr "छाया" + +#: b2/b2client.cpp:409 +msgid "Resize" +msgstr "आकार बदलें" + +#: b2/b2client.cpp:453 +msgid "<b><center>B II preview</center></b>" +msgstr "<b><center>बी II पूर्वावलोकन</center></b>" + +#: b2/b2client.cpp:901 +msgid "Restore" +msgstr "पुरानी स्तिथी में लाऐं" + +#: b2/b2client.cpp:1143 +msgctxt "Help button label, one character" +msgid "?" +msgstr "?" + +#: b2/config/config.cpp:60 +msgid "Draw window frames using &titlebar colors" +msgstr "शीर्षक पट्टी रंगों के उपयोग से विंडो फ्रेम बनाएँ (&t)" -#, fuzzy -#~| msgid "No Side Border" -#~ msgctxt "@item:inlistbox Border size:" -#~ msgid "No Side Borders" -#~ msgstr "बाजू सीमारेखा नहीं" +#: b2/config/config.cpp:62 +msgid "" +"When selected, the window borders are drawn using the titlebar colors; " +"otherwise, they are drawn using normal border colors." +msgstr "" +"जब चुना जाता है, विंडो सजावटी किनारे शीर्षक पट्टी रंगों से बनाए जाते हैं. अन्यथा वे सामान्य " +"किनारा रंगों के उपयोग से बनाए जाते हैं." -#, fuzzy -#~| msgid "Tiny" -#~ msgctxt "@item:inlistbox Border size:" -#~ msgid "Tiny" -#~ msgstr "नन्हा" +#: b2/config/config.cpp:68 +msgid "Draw &resize handle" +msgstr "रिसाइज हैंडल बनाएँ (&r)" -#, fuzzy -#~| msgid "Normal" -#~ msgctxt "@item:inlistbox Border size:" -#~ msgid "Normal" -#~ msgstr "सामान्य" +#: b2/config/config.cpp:70 +msgid "" +"When selected, decorations are drawn with a \"grab handle\" in the bottom " +"right corner of the windows; otherwise, no grab handle is drawn." +msgstr "" +"जब चुना जाता है तो सजावटों को \"ग्रेब हैंडल\" के साथ बनाया जाता है जो कि विंडो के नीचे " +"दाएँ कोने में होता है; अन्यथा, कोई ग्रेब हैंडल नहीं बनाया जाता." -#, fuzzy -#~| msgid "Large" -#~ msgctxt "@item:inlistbox Border size:" -#~ msgid "Large" -#~ msgstr "बड़ा" +#: b2/config/config.cpp:76 +msgid "Auto-move titlebar" +msgstr "" +#: b2/config/config.cpp:78 #, fuzzy -#~| msgid "Very Large" -#~ msgctxt "@item:inlistbox Border size:" -#~ msgid "Very Large" -#~ msgstr "बहुत बड़ा" +#| msgid "" +#| "When selected, active titlebars are drawn with a stipple (dotted) effect; " +#| "otherwise, they are drawn without the stipple." +msgid "" +"When selected, titlebars are automatically relocated to visible positions; " +"otherwise, they are only moved manually using shift+drag." +msgstr "" +"जब चयनित होता है, क्रियाशील शीर्षक पट्टी स्टिपल (बिंदुओं से) प्रभाव से बनाया जाता है. " +"अन्यथा वे बिना स्टिपल के बनाए जाते हैं." -#, fuzzy -#~| msgid "Huge" -#~ msgctxt "@item:inlistbox Border size:" -#~ msgid "Huge" -#~ msgstr "बहुत बड़ा" +#: b2/config/config.cpp:83 +msgid "Actions Settings" +msgstr "क्रिया विन्यास" + +#: b2/config/config.cpp:86 +msgid "Double click on menu button:" +msgstr "मेन्यू बटन में दोहरा-क्लिक करने पर क्रिया:" + +#: b2/config/config.cpp:88 +msgid "Do Nothing" +msgstr "कुछ नहीं करें" + +#: b2/config/config.cpp:89 +msgid "Minimize Window" +msgstr "विंडो न्यूनतम करें" + +#: b2/config/config.cpp:90 +msgid "Shade Window" +msgstr "विंडो में छाया भरें" + +#: b2/config/config.cpp:91 +msgid "Close Window" +msgstr "विंडो बंद करें" -#, fuzzy -#~| msgid "Very Huge" -#~ msgctxt "@item:inlistbox Border size:" -#~ msgid "Very Huge" -#~ msgstr "अत्यंत विशाल" +#: b2/config/config.cpp:94 +msgid "" +"An action can be associated to a double click of the menu button. Leave it " +"to none if in doubt." +msgstr "" +"मेन्यू बटन के दोहरे क्लिक पर कोई क्रिया सम्बद्ध की जा सकती है. यदि कोई असमंजस हो तो इसे " +"वैसा ही रहने दें." -#, fuzzy -#~| msgid "Oversized" -#~ msgctxt "@item:inlistbox Border size:" -#~ msgid "Oversized" -#~ msgstr "बडा आकार" +#: laptop/laptopclient.cpp:376 +msgid "Laptop" +msgstr "लैपटॉप" -#, fuzzy -#~| msgid "Title alignment:" -#~ msgid "Tit&le alignment:" -#~ msgstr "शीर्षक पंक्तिबद्धता:" +#: oxygen/config/oxygenanimationconfigwidget.cpp:48 +msgid "Button mouseover transition" +msgstr "" -#, fuzzy -#~| msgid "Button size:" -#~ msgid "B&utton size:" -#~ msgstr "बटन आकार:" +#: oxygen/config/oxygenanimationconfigwidget.cpp:49 +msgid "Configure window buttons' mouseover highlight animation" +msgstr "" -#, fuzzy -#~| msgid "Small" -#~ msgctxt "@item:inlistbox Button size:" -#~ msgid "Small" -#~ msgstr "छोटा" +#: oxygen/config/oxygenanimationconfigwidget.cpp:52 +msgid "Title transitions" +msgstr "" -#, fuzzy -#~| msgid "Normal" -#~ msgctxt "@item:inlistbox Button size:" -#~ msgid "Normal" -#~ msgstr "सामान्य" +#: oxygen/config/oxygenanimationconfigwidget.cpp:53 +msgid "Configure fading transitions when window title is changed" +msgstr "" -#, fuzzy -#~| msgid "Large" -#~ msgctxt "@item:inlistbox Button size:" -#~ msgid "Large" -#~ msgstr "बड़ा" +#: oxygen/config/oxygenanimationconfigwidget.cpp:56 +msgid "Window active state change transitions" +msgstr "" -#, fuzzy -#~| msgid "Very Large" -#~ msgctxt "@item:inlistbox Button size:" -#~ msgid "Very Large" -#~ msgstr "बहुत बड़ा" +#: oxygen/config/oxygenanimationconfigwidget.cpp:57 +msgid "" +"Configure fading between window shadow and glow when window's active state " +"is changed" +msgstr "" -#, fuzzy -#~| msgid "Huge" -#~ msgctxt "@item:inlistbox Button size:" -#~ msgid "Huge" -#~ msgstr "बहुत बड़ा" +#: oxygen/config/oxygenanimationconfigwidget.cpp:60 +msgid "Window grouping animations" +msgstr "" -#~ msgid "Close windows by double clicking the menu button" -#~ msgstr "मेन्यू बटन को डबल क्लिक कर विंडो बन्द करें" +#: oxygen/config/oxygenanimationconfigwidget.cpp:61 +msgid "Configure window titlebar animations when windows are grouped/ungrouped" +msgstr "" +#: oxygen/config/oxygenconfigwidget.cpp:158 #, fuzzy -#~| msgid "Minimize Window" -#~ msgid "Outline active window title" -#~ msgstr "विंडो न्यूनतम करें" - -#~ msgid "Shadows" -#~ msgstr "छायाएँ" +#| msgid "Decoration Options" +msgid "Hide Advanced Configuration Options" +msgstr "सजावट विकल्प" +#: oxygen/config/oxygenconfigwidget.cpp:158 #, fuzzy -#~| msgid "Minimize Window" -#~ msgid "Active Window Glow" -#~ msgstr "विंडो न्यूनतम करें" +#| msgid "Decoration Options" +msgid "Show Advanced Configuration Options" +msgstr "सजावट विकल्प" +#: oxygen/config/oxygenconfigwidget.cpp:175 #, fuzzy -#~| msgid "Config Dialog" -#~ msgid "Dialog" -#~ msgstr "कॉन्फ़िग संवाद " +#| msgid "Animate buttons" +msgid "Animations" +msgstr "बटनों को एनिमेट करें" -#~ msgid "Information about Selected Window" -#~ msgstr "चयनित विंडो के बारे में जानकारी" +#: oxygen/config/oxygenexceptionlistwidget.cpp:190 +msgid "Remove selected exception?" +msgstr "" -#~ msgid "Class: " -#~ msgstr "श्रेणी: " +#: oxygen/config/oxygenexceptionlistwidget.cpp:331 +msgid "Regular Expression syntax is incorrect" +msgstr "" -#~ msgid "Title: " -#~ msgstr "शीर्षक: " +#: oxygen/config/oxygenexceptionmodel.cpp:35 +msgid "Exception Type" +msgstr "" -#~ msgid "Window Property Selection" -#~ msgstr "विंडो गुण चयन" +#: oxygen/config/oxygenexceptionmodel.cpp:36 +msgid "Regular Expression" +msgstr "नियमित (रेगुलर) एक्सप्रेशन." + +#. i18n: ectx: property (text), item, widget (KComboBox, exceptionType) +#: oxygen/config/oxygenexceptionmodel.cpp:61 +#: oxygen/config/ui/oxygenexceptiondialog.ui:69 +msgid "Window Title" +msgstr "विंडो का शीर्षक" + +#. i18n: ectx: property (text), item, widget (KComboBox, exceptionType) +#: oxygen/config/oxygenexceptionmodel.cpp:65 +#: oxygen/config/ui/oxygenexceptiondialog.ui:64 +msgid "Window Class Name" +msgstr "" -#~ msgid "Use window class (whole application)" -#~ msgstr "विंडो श्रेणी उपयोग करें (पूरा अनुप्रयोग)" +#: oxygen/config/oxygenexceptionmodel.cpp:81 +msgid "Enable/disable this exception" +msgstr "" -#~ msgid "Use window title" -#~ msgstr "विंडो शीर्षक उपयोग करें" +#. i18n: ectx: attribute (title), widget (QWidget, tab) +#: oxygen/config/ui/oxygenconfigurationui.ui:33 +msgid "General" +msgstr "साधारण" + +#. i18n: ectx: property (text), widget (QCheckBox, frameBorderCheckBox) +#. i18n: ectx: property (text), widget (QLabel, label) +#: oxygen/config/ui/oxygenconfigurationui.ui:39 +#: oxygen/config/ui/oxygenexceptiondialog.ui:169 +msgid "Border size:" +msgstr "किनारा आकार:" + +#. i18n: ectx: property (text), item, widget (KComboBox, frameBorderComboBox) +#. i18n: ectx: property (text), item, widget (KComboBox, frameBorder) +#: oxygen/config/ui/oxygenconfigurationui.ui:53 +#: oxygen/config/ui/oxygenexceptiondialog.ui:121 +#, fuzzy +#| msgid "No Border" +msgctxt "@item:inlistbox Border size:" +msgid "No Border" +msgstr "सीमारेखा नहीं" + +#. i18n: ectx: property (text), item, widget (KComboBox, frameBorderComboBox) +#. i18n: ectx: property (text), item, widget (KComboBox, frameBorder) +#: oxygen/config/ui/oxygenconfigurationui.ui:58 +#: oxygen/config/ui/oxygenexceptiondialog.ui:126 +#, fuzzy +#| msgid "No Side Border" +msgctxt "@item:inlistbox Border size:" +msgid "No Side Borders" +msgstr "बाजू सीमारेखा नहीं" + +#. i18n: ectx: property (text), item, widget (KComboBox, frameBorderComboBox) +#. i18n: ectx: property (text), item, widget (KComboBox, frameBorder) +#: oxygen/config/ui/oxygenconfigurationui.ui:63 +#: oxygen/config/ui/oxygenexceptiondialog.ui:131 +#, fuzzy +#| msgid "Tiny" +msgctxt "@item:inlistbox Border size:" +msgid "Tiny" +msgstr "नन्हा" + +#. i18n: ectx: property (text), item, widget (KComboBox, frameBorderComboBox) +#. i18n: ectx: property (text), item, widget (KComboBox, frameBorder) +#: oxygen/config/ui/oxygenconfigurationui.ui:68 +#: oxygen/config/ui/oxygenexceptiondialog.ui:136 +#, fuzzy +#| msgid "Normal" +msgctxt "@item:inlistbox Border size:" +msgid "Normal" +msgstr "सामान्य" + +#. i18n: ectx: property (text), item, widget (KComboBox, frameBorderComboBox) +#. i18n: ectx: property (text), item, widget (KComboBox, frameBorder) +#: oxygen/config/ui/oxygenconfigurationui.ui:73 +#: oxygen/config/ui/oxygenexceptiondialog.ui:141 +#, fuzzy +#| msgid "Large" +msgctxt "@item:inlistbox Border size:" +msgid "Large" +msgstr "बड़ा" + +#. i18n: ectx: property (text), item, widget (KComboBox, frameBorderComboBox) +#. i18n: ectx: property (text), item, widget (KComboBox, frameBorder) +#: oxygen/config/ui/oxygenconfigurationui.ui:78 +#: oxygen/config/ui/oxygenexceptiondialog.ui:146 +#, fuzzy +#| msgid "Very Large" +msgctxt "@item:inlistbox Border size:" +msgid "Very Large" +msgstr "बहुत बड़ा" + +#. i18n: ectx: property (text), item, widget (KComboBox, frameBorderComboBox) +#. i18n: ectx: property (text), item, widget (KComboBox, frameBorder) +#: oxygen/config/ui/oxygenconfigurationui.ui:83 +#: oxygen/config/ui/oxygenexceptiondialog.ui:151 +#, fuzzy +#| msgid "Huge" +msgctxt "@item:inlistbox Border size:" +msgid "Huge" +msgstr "बहुत बड़ा" + +#. i18n: ectx: property (text), item, widget (KComboBox, frameBorderComboBox) +#. i18n: ectx: property (text), item, widget (KComboBox, frameBorder) +#: oxygen/config/ui/oxygenconfigurationui.ui:88 +#: oxygen/config/ui/oxygenexceptiondialog.ui:156 +#, fuzzy +#| msgid "Very Huge" +msgctxt "@item:inlistbox Border size:" +msgid "Very Huge" +msgstr "अत्यंत विशाल" + +#. i18n: ectx: property (text), item, widget (KComboBox, frameBorderComboBox) +#. i18n: ectx: property (text), item, widget (KComboBox, frameBorder) +#: oxygen/config/ui/oxygenconfigurationui.ui:93 +#: oxygen/config/ui/oxygenexceptiondialog.ui:161 +#, fuzzy +#| msgid "Oversized" +msgctxt "@item:inlistbox Border size:" +msgid "Oversized" +msgstr "बडा आकार" + +#. i18n: ectx: property (text), widget (QLabel, label_2) +#: oxygen/config/ui/oxygenconfigurationui.ui:101 +msgid "Title alignment:" +msgstr "शीर्षक पंक्तिबद्धता:" + +#. i18n: ectx: property (text), item, widget (KComboBox, titleAlignment) +#: oxygen/config/ui/oxygenconfigurationui.ui:125 +msgid "Center (Full Width)" +msgstr "" -#~ msgid "Matching window property: " -#~ msgstr "मेल खाता विंडो गुण" +#. i18n: ectx: property (text), widget (QLabel, label_3) +#: oxygen/config/ui/oxygenconfigurationui.ui:138 +msgid "Button size:" +msgstr "बटन आकार:" + +#. i18n: ectx: property (text), item, widget (KComboBox, buttonSize) +#: oxygen/config/ui/oxygenconfigurationui.ui:152 +#, fuzzy +#| msgid "Small" +msgctxt "@item:inlistbox Button size:" +msgid "Small" +msgstr "छोटा" + +#. i18n: ectx: property (text), item, widget (KComboBox, buttonSize) +#: oxygen/config/ui/oxygenconfigurationui.ui:157 +#, fuzzy +#| msgid "Normal" +msgctxt "@item:inlistbox Button size:" +msgid "Normal" +msgstr "सामान्य" + +#. i18n: ectx: property (text), item, widget (KComboBox, buttonSize) +#: oxygen/config/ui/oxygenconfigurationui.ui:162 +#, fuzzy +#| msgid "Large" +msgctxt "@item:inlistbox Button size:" +msgid "Large" +msgstr "बड़ा" + +#. i18n: ectx: property (text), item, widget (KComboBox, buttonSize) +#: oxygen/config/ui/oxygenconfigurationui.ui:167 +#, fuzzy +#| msgid "Very Large" +msgctxt "@item:inlistbox Button size:" +msgid "Very Large" +msgstr "बहुत बड़ा" + +#. i18n: ectx: property (text), item, widget (KComboBox, buttonSize) +#: oxygen/config/ui/oxygenconfigurationui.ui:172 +#, fuzzy +#| msgid "Huge" +msgctxt "@item:inlistbox Button size:" +msgid "Huge" +msgstr "बहुत बड़ा" + +#. i18n: ectx: property (text), widget (QCheckBox, animationsEnabled) +#: oxygen/config/ui/oxygenconfigurationui.ui:193 +msgid "Enable animations" +msgstr "" -#~ msgid "Detect Window Properties" -#~ msgstr "विंडो गुण जानें" +#. i18n: ectx: attribute (title), widget (QWidget, tab_2) +#: oxygen/config/ui/oxygenconfigurationui.ui:214 +msgid "Fine Tuning" +msgstr "" -#~ msgid "Decoration Options" -#~ msgstr "सजावट विकल्प" +#. i18n: ectx: property (text), item, widget (KComboBox, separatorComboBox) +#. i18n: ectx: property (text), item, widget (KComboBox, separatorMode) +#: oxygen/config/ui/oxygenconfigurationui.ui:237 +#: oxygen/config/ui/oxygenexceptiondialog.ui:221 +msgid "Never Draw Separator" +msgstr "" -#~ msgctxt "outline window title" -#~ msgid "Disabled" -#~ msgstr "अक्षम" +#. i18n: ectx: property (text), item, widget (KComboBox, separatorComboBox) +#. i18n: ectx: property (text), item, widget (KComboBox, separatorMode) +#: oxygen/config/ui/oxygenconfigurationui.ui:242 +#: oxygen/config/ui/oxygenexceptiondialog.ui:226 +msgid "Draw Separator When Window is Active" +msgstr "" -#~ msgctxt "outline window title" -#~ msgid "Enabled" -#~ msgstr "सक्षम" +#. i18n: ectx: property (text), item, widget (KComboBox, separatorComboBox) +#. i18n: ectx: property (text), item, widget (KComboBox, separatorMode) +#: oxygen/config/ui/oxygenconfigurationui.ui:247 +#: oxygen/config/ui/oxygenexceptiondialog.ui:231 +msgid "Always Draw Separator" +msgstr "" -#~ msgid "Border size:" -#~ msgstr "किनारा आकार:" +#. i18n: ectx: property (text), widget (QCheckBox, separatorCheckBox) +#. i18n: ectx: property (text), widget (QLabel, label_5) +#: oxygen/config/ui/oxygenconfigurationui.ui:255 +#: oxygen/config/ui/oxygenexceptiondialog.ui:93 +msgid "Separator display:" +msgstr "" +#. i18n: ectx: property (text), widget (QCheckBox, titleOutline) +#: oxygen/config/ui/oxygenconfigurationui.ui:268 #, fuzzy -#~| msgid "Minimize Window" -#~ msgid "Outline active window title:" -#~ msgstr "विंडो न्यूनतम करें" +#| msgid "Minimize Window" +msgid "Outline active window title" +msgstr "विंडो न्यूनतम करें" + +#. i18n: ectx: property (text), widget (QCheckBox, narrowButtonSpacing) +#: oxygen/config/ui/oxygenconfigurationui.ui:275 +msgid "Use narrow space between decoration buttons" +msgstr "" -#~ msgid "Hide window title bar" -#~ msgstr "विंडो शीर्षक पट्टी छुपाएँ" +#. i18n: ectx: property (text), widget (QCheckBox, sizeGripCheckBox) +#. i18n: ectx: property (text), widget (QCheckBox, drawSizeGrip) +#: oxygen/config/ui/oxygenconfigurationui.ui:282 +#: oxygen/config/ui/oxygenexceptiondialog.ui:176 +msgid "Add handle to resize windows with no border" +msgstr "" -#, fuzzy -#~| msgctxt "outline window title" -#~| msgid "Disabled" -#~ msgctxt "Add handle to resize windows with no border" -#~ msgid "Disabled" -#~ msgstr "अक्षम" +#. i18n: ectx: property (text), widget (QCheckBox, closeFromMenuButton) +#: oxygen/config/ui/oxygenconfigurationui.ui:289 +msgid "Close windows by double clicking the menu button" +msgstr "मेन्यू बटन को डबल क्लिक कर विंडो बन्द करें" + +#. i18n: ectx: attribute (title), widget (QWidget, tab_3) +#: oxygen/config/ui/oxygenconfigurationui.ui:310 +msgid "Shadows" +msgstr "छायाएँ" + +#. i18n: ectx: property (title), widget (Oxygen::ShadowConfigWidget, inactiveShadowConfiguration) +#: oxygen/config/ui/oxygenconfigurationui.ui:318 +msgid "Window Drop-Down Shadow" +msgstr "" +#. i18n: ectx: property (title), widget (Oxygen::ShadowConfigWidget, activeShadowConfiguration) +#: oxygen/config/ui/oxygenconfigurationui.ui:328 #, fuzzy -#~| msgctxt "outline window title" -#~| msgid "Enabled" -#~ msgctxt "Add handle to resize windows with no border" -#~ msgid "Enabled" -#~ msgstr "सक्षम" +#| msgid "Minimize Window" +msgid "Active Window Glow" +msgstr "विंडो न्यूनतम करें" + +#. i18n: ectx: attribute (title), widget (QWidget, tab_4) +#: oxygen/config/ui/oxygenconfigurationui.ui:354 +msgid "Window-Specific Overrides" +msgstr "" -#~ msgid "Move Up" -#~ msgstr "ऊपर जाएँ" +#. i18n: ectx: property (title), widget (QGroupBox, groupBox) +#: oxygen/config/ui/oxygendetectwidget.ui:17 +msgid "Information about Selected Window" +msgstr "चयनित विंडो के बारे में जानकारी" + +#. i18n: ectx: property (text), widget (QLabel, label) +#: oxygen/config/ui/oxygendetectwidget.ui:23 +msgid "Class: " +msgstr "श्रेणी: " + +#. i18n: ectx: property (text), widget (QLabel, label_2) +#: oxygen/config/ui/oxygendetectwidget.ui:40 +msgid "Title: " +msgstr "शीर्षक: " + +#. i18n: ectx: property (title), widget (QGroupBox, groupBox_2) +#: oxygen/config/ui/oxygendetectwidget.ui:60 +msgid "Window Property Selection" +msgstr "विंडो गुण चयन" + +#. i18n: ectx: property (text), widget (QRadioButton, windowClassCheckBox) +#: oxygen/config/ui/oxygendetectwidget.ui:66 +msgid "Use window class (whole application)" +msgstr "विंडो श्रेणी उपयोग करें (पूरा अनुप्रयोग)" + +#. i18n: ectx: property (text), widget (QRadioButton, windowTitleCheckBox) +#: oxygen/config/ui/oxygendetectwidget.ui:76 +msgid "Use window title" +msgstr "विंडो शीर्षक उपयोग करें" + +#. i18n: ectx: property (title), widget (QGroupBox, groupBox) +#: oxygen/config/ui/oxygenexceptiondialog.ui:17 +msgid "Window Identification" +msgstr "" -#~ msgid "Move Down" -#~ msgstr "नीचे जाएँ" +#. i18n: ectx: property (text), widget (QLabel, label) +#: oxygen/config/ui/oxygenexceptiondialog.ui:23 +msgid "Matching window property: " +msgstr "मेल खाता विंडो गुण" + +#. i18n: ectx: property (text), widget (QLabel, label_2) +#: oxygen/config/ui/oxygenexceptiondialog.ui:36 +msgid "Regular expression to match: " +msgstr "" -#~ msgid "Add" -#~ msgstr "जोड़ें" +#. i18n: ectx: property (text), widget (QPushButton, detectDialogButton) +#: oxygen/config/ui/oxygenexceptiondialog.ui:49 +msgid "Detect Window Properties" +msgstr "विंडो गुण जानें" + +#. i18n: ectx: property (title), widget (QGroupBox, groupBox_2) +#: oxygen/config/ui/oxygenexceptiondialog.ui:80 +msgid "Decoration Options" +msgstr "सजावट विकल्प" + +#. i18n: ectx: property (text), widget (QCheckBox, titleOutlineCheckBox) +#: oxygen/config/ui/oxygenexceptiondialog.ui:86 +#, fuzzy +#| msgid "Minimize Window" +msgid "Outline active window title:" +msgstr "विंडो न्यूनतम करें" + +#. i18n: ectx: property (text), widget (QCheckBox, hideTitleBar) +#: oxygen/config/ui/oxygenexceptiondialog.ui:100 +msgid "Hide window title bar" +msgstr "विंडो शीर्षक पट्टी छुपाएँ" + +#. i18n: ectx: property (text), item, widget (KComboBox, sizeGripComboBox) +#: oxygen/config/ui/oxygenexceptiondialog.ui:187 +#, fuzzy +#| msgctxt "outline window title" +#| msgid "Disabled" +msgctxt "Add handle to resize windows with no border" +msgid "Disabled" +msgstr "अक्षम" + +#. i18n: ectx: property (text), item, widget (KComboBox, sizeGripComboBox) +#: oxygen/config/ui/oxygenexceptiondialog.ui:192 +#, fuzzy +#| msgctxt "outline window title" +#| msgid "Enabled" +msgctxt "Add handle to resize windows with no border" +msgid "Enabled" +msgstr "सक्षम" + +#. i18n: ectx: property (text), item, widget (KComboBox, titleOutlineComboBox) +#: oxygen/config/ui/oxygenexceptiondialog.ui:204 +msgctxt "outline window title" +msgid "Disabled" +msgstr "अक्षम" + +#. i18n: ectx: property (text), item, widget (KComboBox, titleOutlineComboBox) +#: oxygen/config/ui/oxygenexceptiondialog.ui:209 +msgctxt "outline window title" +msgid "Enabled" +msgstr "सक्षम" + +#. i18n: ectx: property (text), widget (KPushButton, moveUpButton) +#: oxygen/config/ui/oxygenexceptionlistwidget.ui:29 +msgid "Move Up" +msgstr "ऊपर जाएँ" + +#. i18n: ectx: property (text), widget (KPushButton, moveDownButton) +#: oxygen/config/ui/oxygenexceptionlistwidget.ui:36 +msgid "Move Down" +msgstr "नीचे जाएँ" + +#. i18n: ectx: property (text), widget (KPushButton, addButton) +#: oxygen/config/ui/oxygenexceptionlistwidget.ui:43 +msgid "Add" +msgstr "जोड़ें" + +#. i18n: ectx: property (text), widget (KPushButton, removeButton) +#: oxygen/config/ui/oxygenexceptionlistwidget.ui:50 +#, fuzzy +#| msgid "Restore" +msgid "Remove" +msgstr "पुरानी स्तिथी में लाऐं" + +#. i18n: ectx: property (text), widget (KPushButton, editButton) +#: oxygen/config/ui/oxygenexceptionlistwidget.ui:57 +msgid "Edit" +msgstr "संपादन" -#, fuzzy -#~| msgid "Restore" -#~ msgid "Remove" -#~ msgstr "पुरानी स्तिथी में लाऐं" +#: oxygen/demo/main.cpp:42 oxygen/demo/oxygenshadowdemodialog.cpp:46 +msgid "Oxygen Shadow Demo" +msgstr "" -#~ msgid "Edit" -#~ msgstr "संपादन" +#: oxygen/demo/main.cpp:44 +msgid "Oxygen decoration shadows demonstration" +msgstr "" -#, fuzzy -#~| msgid "Enable window grouping" -#~ msgid "Draw window background" -#~ msgstr "विंडो समूहीकरण सक्षम" +#: oxygen/demo/main.cpp:46 +msgid "(c) 2011, Hugo Pereira Da Costa" +msgstr "" -#, fuzzy -#~| msgid "Minimize Window" -#~ msgid "Inactive Windows" -#~ msgstr "विंडो न्यूनतम करें" +#: oxygen/demo/main.cpp:48 +msgid "Hugo Pereira Da Costa" +msgstr "" +#: oxygen/demo/oxygenshadowdemodialog.cpp:49 #, fuzzy -#~| msgid "Minimize Window" -#~ msgid "Active Windows" -#~ msgstr "विंडो न्यूनतम करें" - -#~ msgid "Oxygen" -#~ msgstr "आक्सीजन" - -#~ msgid "Help" -#~ msgstr "मदद" - -#~ msgid "Minimize" -#~ msgstr "न्यूनतम " - -#~ msgid "Maximize" -#~ msgstr "अधिकतम" - -#~ msgid "Close" -#~ msgstr "बंद करें" +#| msgid "Shade" +msgid "Save" +msgstr "छाया" -#~ msgid "Keep Above Others" -#~ msgstr "अन्यों के ऊपर रखें" - -#~ msgid "Keep Below Others" -#~ msgstr "अन्यों के नीचे रखें" - -#~ msgid "On All Desktops" -#~ msgstr "सभी डेस्कटॉप पर" - -#~ msgid "Shade Button" -#~ msgstr "छाया बटन" - -#~ msgid "Menu" -#~ msgstr "मेन्यू" - -#~ msgid "Not on all desktops" -#~ msgstr "सभी डेस्कटॉप पर नहीं" - -#~ msgid "On all desktops" -#~ msgstr "सभी डेस्कटॉप पर" - -#~ msgid "Unshade" -#~ msgstr "छाया हटाएँ" - -#~ msgid "Shade" -#~ msgstr "छाया" - -#~ msgid "Resize" -#~ msgstr "आकार बदलें" - -#~ msgid "<b><center>B II preview</center></b>" -#~ msgstr "<b><center>बी II पूर्वावलोकन</center></b>" - -#~ msgid "Restore" -#~ msgstr "पुरानी स्तिथी में लाऐं" - -#~ msgctxt "Help button label, one character" -#~ msgid "?" -#~ msgstr "?" - -#~ msgid "Draw window frames using &titlebar colors" -#~ msgstr "शीर्षक पट्टी रंगों के उपयोग से विंडो फ्रेम बनाएँ (&t)" - -#~ msgid "" -#~ "When selected, the window borders are drawn using the titlebar colors; " -#~ "otherwise, they are drawn using normal border colors." -#~ msgstr "" -#~ "जब चुना जाता है, विंडो सजावटी किनारे शीर्षक पट्टी रंगों से बनाए जाते हैं. अन्यथा वे " -#~ "सामान्य किनारा रंगों के उपयोग से बनाए जाते हैं." - -#~ msgid "Draw &resize handle" -#~ msgstr "रिसाइज हैंडल बनाएँ (&r)" - -#~ msgid "" -#~ "When selected, decorations are drawn with a \"grab handle\" in the bottom " -#~ "right corner of the windows; otherwise, no grab handle is drawn." -#~ msgstr "" -#~ "जब चुना जाता है तो सजावटों को \"ग्रेब हैंडल\" के साथ बनाया जाता है जो कि विंडो के " -#~ "नीचे दाएँ कोने में होता है; अन्यथा, कोई ग्रेब हैंडल नहीं बनाया जाता." +#: oxygen/demo/oxygenshadowdemodialog.cpp:51 +msgid "Save shadows as pixmaps in provided directory" +msgstr "" +#: oxygen/demo/oxygenshadowdemodialog.cpp:71 #, fuzzy -#~| msgid "" -#~| "When selected, active titlebars are drawn with a stipple (dotted) " -#~| "effect; otherwise, they are drawn without the stipple." -#~ msgid "" -#~ "When selected, titlebars are automatically relocated to visible " -#~ "positions; otherwise, they are only moved manually using shift+drag." -#~ msgstr "" -#~ "जब चयनित होता है, क्रियाशील शीर्षक पट्टी स्टिपल (बिंदुओं से) प्रभाव से बनाया जाता है. " -#~ "अन्यथा वे बिना स्टिपल के बनाए जाते हैं." - -#~ msgid "Actions Settings" -#~ msgstr "क्रिया विन्यास" +#| msgid "Enable window grouping" +msgid "Draw window background" +msgstr "विंडो समूहीकरण सक्षम" -#~ msgid "Double click on menu button:" -#~ msgstr "मेन्यू बटन में दोहरा-क्लिक करने पर क्रिया:" - -#~ msgid "Do Nothing" -#~ msgstr "कुछ नहीं करें" +#. i18n: ectx: property (text), widget (QLabel, label) +#: oxygen/demo/ui/oxygenshadowdemo.ui:17 +#, fuzzy +#| msgid "Minimize Window" +msgid "Inactive Windows" +msgstr "विंडो न्यूनतम करें" -#~ msgid "Minimize Window" -#~ msgstr "विंडो न्यूनतम करें" +#. i18n: ectx: property (text), widget (QLabel, label_2) +#: oxygen/demo/ui/oxygenshadowdemo.ui:27 +#, fuzzy +#| msgid "Minimize Window" +msgid "Active Windows" +msgstr "विंडो न्यूनतम करें" -#~ msgid "Shade Window" -#~ msgstr "विंडो में छाया भरें" +#: oxygen/oxygenclient.cpp:82 +msgid "Oxygen" +msgstr "आक्सीजन" -#~ msgid "Close Window" -#~ msgstr "विंडो बंद करें" +#: oxygen/oxygenclient.cpp:217 +msgid "Window Actions Menu" +msgstr "" -#~ msgid "" -#~ "An action can be associated to a double click of the menu button. Leave " -#~ "it to none if in doubt." -#~ msgstr "" -#~ "मेन्यू बटन के दोहरे क्लिक पर कोई क्रिया सम्बद्ध की जा सकती है. यदि कोई असमंजस हो तो " -#~ "इसे वैसा ही रहने दें." +#: oxygen/oxygenclient.cpp:220 +msgid "Application Menu" +msgstr "" -#~ msgid "Laptop" -#~ msgstr "लैपटॉप" +#: oxygen/oxygenclient.cpp:235 +msgid "Keep Above Others" +msgstr "अन्यों के ऊपर रखें" + +#: oxygen/oxygenclient.cpp:238 +msgid "Keep Below Others" +msgstr "अन्यों के नीचे रखें" + +#: oxygen/oxygenclient.cpp:241 +msgid "On All Desktops" +msgstr "सभी डेस्कटॉप पर" + +#: oxygen/oxygenclient.cpp:244 +msgid "Shade Button" +msgstr "छाया बटन" -#, fuzzy -#~| msgid "Background style: " -#~ msgid "Bac&kground style: " +#~ msgid "Background style: " #~ msgstr "पार्श्व शैली" #~ msgid "Solid Color" @@ -458,19 +767,6 @@ #~ msgid "Background style:" #~ msgstr "पार्श्व शैली" -#~ msgctxt "NAME OF TRANSLATORS" -#~ msgid "Your names" -#~ msgstr "राजेश रंजन" - -#~ msgctxt "EMAIL OF TRANSLATORS" -#~ msgid "Your emails" -#~ msgstr "rajesh672@gmail.com" - -#, fuzzy -#~| msgid "Shade" -#~ msgid "Save" -#~ msgstr "छाया" - #~ msgid "Large" #~ msgstr "बड़ा" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kwin_effects.po kde-l10n-hi-4.13.0/messages/kde-workspace/kwin_effects.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kwin_effects.po 2014-03-26 03:45:43.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kwin_effects.po 2014-02-25 08:11:17.000000000 +0000 @@ -9,7 +9,7 @@ msgstr "" "Project-Id-Version: kwin_effects\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-26 01:53+0000\n" +"POT-Creation-Date: 2014-02-25 06:28+0000\n" "PO-Revision-Date: 2010-01-31 20:51+0530\n" "Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -21,14 +21,6 @@ "Plural-Forms: nplurals=2; plural=(n!=1);\n" "\n" -msgctxt "NAME OF TRANSLATORS" -msgid "Your names" -msgstr "" - -msgctxt "EMAIL OF TRANSLATORS" -msgid "Your emails" -msgstr "" - #. i18n: ectx: property (text), widget (QLabel, label) #: blur/blur_config.ui:17 msgid "Strength of the effect:" @@ -53,7 +45,7 @@ msgid "Save intermediate rendering results." msgstr "" -#: coverswitch/coverswitch.cpp:954 flipswitch/flipswitch.cpp:931 +#: coverswitch/coverswitch.cpp:1012 flipswitch/flipswitch.cpp:952 #, fuzzy #| msgid "Show desktop" msgctxt "Special entry in alt+tab list for minimizing all windows" @@ -63,13 +55,13 @@ #. i18n: ectx: property (text), widget (QCheckBox, kcfg_DrawWindowCaptions) #. i18n: ectx: property (text), widget (QCheckBox, kcfg_WindowTitle) #: coverswitch/coverswitch_config.ui:17 flipswitch/flipswitch_config.ui:191 -#: presentwindows/presentwindows_config.ui:396 +#: presentwindows/presentwindows_config.ui:393 msgid "Display window &titles" msgstr "" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_2) #. i18n: ectx: property (text), widget (QLabel, label_4) -#: coverswitch/coverswitch_config.ui:29 cube/cube_config.ui:344 +#: coverswitch/coverswitch_config.ui:29 cube/cube_config.ui:341 msgid "Zoom" msgstr "बडा करें" @@ -79,12 +71,12 @@ msgstr "" #. i18n: ectx: property (text), widget (QLabel, label_8) -#: coverswitch/coverswitch_config.ui:66 cube/cube_config.ui:350 +#: coverswitch/coverswitch_config.ui:66 cube/cube_config.ui:347 msgid "Near" msgstr "पास" #. i18n: ectx: property (text), widget (QLabel, label_9) -#: coverswitch/coverswitch_config.ui:86 cube/cube_config.ui:357 +#: coverswitch/coverswitch_config.ui:86 cube/cube_config.ui:354 msgid "Far" msgstr "दूर" @@ -123,16 +115,16 @@ msgid "Animation duration:" msgstr "एनीमेशन अवधिः (&A)" -#. i18n: ectx: property (specialValueText), widget (QSpinBox, kcfg_RotationDuration) +#. i18n: ectx: property (specialValueText), widget (KIntSpinBox, kcfg_RotationDuration) #. i18n: ectx: property (specialValueText), widget (QSpinBox, kcfg_AnimationDuration) -#. i18n: ectx: property (specialValueText), widget (QSpinBox, kcfg_Duration) -#: coverswitch/coverswitch_config.ui:158 cube/cube_config.ui:149 +#. i18n: ectx: property (specialValueText), widget (KIntSpinBox, kcfg_Duration) +#: coverswitch/coverswitch_config.ui:158 cube/cube_config.ui:146 #: cube/cubeslide_config.ui:49 magiclamp/magiclamp_config.ui:36 msgctxt "Duration of rotation" msgid "Default" msgstr "तयशुदा" -#. i18n: ectx: property (suffix), widget (QSpinBox, kcfg_Duration) +#. i18n: ectx: property (suffix), widget (KIntSpinBox, kcfg_Duration) #: coverswitch/coverswitch_config.ui:161 #, fuzzy #| msgid " millisecond" @@ -162,28 +154,28 @@ msgid "Front color" msgstr "छाया का रंगः" -#: cube/cube.cpp:201 cube/cube_config.cpp:69 +#: cube/cube.cpp:205 cube/cube_config.cpp:63 msgid "Desktop Cube" msgstr "डेस्कटॉप घन" -#: cube/cube.cpp:209 cube/cube_config.cpp:74 +#: cube/cube.cpp:209 cube/cube_config.cpp:67 #, fuzzy #| msgid "Show Desktop Grid" msgid "Desktop Cylinder" msgstr "डेस्कटॉप ग्रिड दिखाएँ" -#: cube/cube.cpp:215 cube/cube_config.cpp:78 +#: cube/cube.cpp:213 cube/cube_config.cpp:71 #, fuzzy #| msgid "Nowhere" msgid "Desktop Sphere" msgstr "कहीं नहीं" -#: cube/cube_config.cpp:59 +#: cube/cube_config.cpp:53 msgctxt "@title:tab Basic Settings" msgid "Basic" msgstr "मूलभूत" -#: cube/cube_config.cpp:60 +#: cube/cube_config.cpp:54 msgctxt "@title:tab Advanced Settings" msgid "Advanced" msgstr "विस्तृत" @@ -220,41 +212,41 @@ #. i18n: ectx: property (title), widget (QGroupBox, groupBox_7) #. i18n: ectx: property (title), widget (QGroupBox, groupBox) -#: cube/cube_config.ui:104 desktopgrid/desktopgrid_config.ui:17 +#: cube/cube_config.ui:101 desktopgrid/desktopgrid_config.ui:17 #: flipswitch/flipswitch_config.ui:17 mousemark/mousemark_config.ui:17 -#: presentwindows/presentwindows_config.ui:377 +#: presentwindows/presentwindows_config.ui:374 #: thumbnailaside/thumbnailaside_config.ui:17 msgid "Appearance" msgstr "रूप" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_DisplayDesktopName) -#: cube/cube_config.ui:110 +#: cube/cube_config.ui:107 msgid "Display desktop name" msgstr "डेस्कटॉप नाम दिखाएँ" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_Reflection) -#: cube/cube_config.ui:117 +#: cube/cube_config.ui:114 msgid "Reflection" msgstr "प्रतिबिंब (&R)" #. i18n: ectx: property (text), widget (QLabel, label) -#: cube/cube_config.ui:124 cube/cubeslide_config.ui:72 +#: cube/cube_config.ui:121 cube/cubeslide_config.ui:72 msgid "Rotation duration:" msgstr "घूर्ण अवधि:" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_ZOrdering) -#: cube/cube_config.ui:175 +#: cube/cube_config.ui:172 msgid "Windows hover above cube" msgstr "घन पर मंडराते विंडो" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_4) -#: cube/cube_config.ui:185 +#: cube/cube_config.ui:182 msgid "Opacity" msgstr "अपारदर्शिता" -#. i18n: ectx: property (suffix), widget (QSpinBox, kcfg_OpacitySpin) -#. i18n: ectx: property (suffix), widget (QSpinBox, kcfg_Opacity) -#: cube/cube_config.ui:225 thumbnailaside/thumbnailaside_config.ui:87 +#. i18n: ectx: property (suffix), widget (KIntSpinBox, kcfg_OpacitySpin) +#. i18n: ectx: property (suffix), widget (KIntSpinBox, kcfg_Opacity) +#: cube/cube_config.ui:222 thumbnailaside/thumbnailaside_config.ui:87 #, no-c-format msgid " %" msgstr " %" @@ -262,7 +254,7 @@ #. i18n: ectx: property (text), widget (QLabel, label_4) #. i18n: ectx: property (text), widget (QLabel, label_2) #. i18n: ectx: property (text), widget (QLabel, label_6) -#: cube/cube_config.ui:238 translucency/package/contents/ui/config.ui:260 +#: cube/cube_config.ui:235 translucency/package/contents/ui/config.ui:260 #: translucency/package/contents/ui/config.ui:456 msgid "Transparent" msgstr "पारदर्शिता" @@ -270,53 +262,53 @@ #. i18n: ectx: property (text), widget (QLabel, label_5) #. i18n: ectx: property (text), widget (QLabel, label_3) #. i18n: ectx: property (text), widget (QLabel, label_7) -#: cube/cube_config.ui:245 translucency/package/contents/ui/config.ui:273 +#: cube/cube_config.ui:242 translucency/package/contents/ui/config.ui:273 #: translucency/package/contents/ui/config.ui:469 msgid "Opaque" msgstr "अपारदर्शी" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_OpacityDesktopOnly) -#: cube/cube_config.ui:255 +#: cube/cube_config.ui:252 msgid "Do not change opacity of windows" msgstr "विंडो की अपारदर्शिता नहीं बदलें" #. i18n: ectx: attribute (title), widget (QWidget, tab_2) -#: cube/cube_config.ui:279 +#: cube/cube_config.ui:276 msgid "Tab 2" msgstr "टैब 2" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_3) -#: cube/cube_config.ui:285 +#: cube/cube_config.ui:282 msgid "Caps" msgstr "कैप्स" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_Caps) -#: cube/cube_config.ui:291 +#: cube/cube_config.ui:288 msgid "Show caps" msgstr "कैप्स दिखाएँ" #. i18n: ectx: property (text), widget (QLabel, capColorLabel) -#: cube/cube_config.ui:298 +#: cube/cube_config.ui:295 msgid "Cap color:" msgstr "कैप रंग:" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_TexturedCaps) -#: cube/cube_config.ui:321 +#: cube/cube_config.ui:318 msgid "Display image on caps" msgstr "कैप्स पर छवि दिखाएँ" #. i18n: ectx: property (toolTip), widget (QSlider, kcfg_ZPosition) -#: cube/cube_config.ui:367 +#: cube/cube_config.ui:364 msgid "Define how far away the object should appear" msgstr "" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_9) -#: cube/cube_config.ui:408 +#: cube/cube_config.ui:405 msgid "Additional Options" msgstr "अधिक विकल्प" #. i18n: ectx: property (toolTip), widget (QCheckBox, kcfg_CloseOnMouseRelease) -#: cube/cube_config.ui:415 +#: cube/cube_config.ui:412 msgid "" "If enabled the effect will be deactivated after rotating the cube with the " "mouse,\n" @@ -324,41 +316,41 @@ msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_CloseOnMouseRelease) -#: cube/cube_config.ui:418 +#: cube/cube_config.ui:415 msgid "Close after mouse dragging" msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_TabBox) -#: cube/cube_config.ui:425 +#: cube/cube_config.ui:422 msgid "Use this effect for walking through the desktops" msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_InvertKeys) -#: cube/cube_config.ui:432 +#: cube/cube_config.ui:429 msgid "Invert cursor keys" msgstr "उलट कर्सर कुंजी" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_InvertMouse) -#: cube/cube_config.ui:439 +#: cube/cube_config.ui:436 msgid "Invert mouse" msgstr "" #. i18n: ectx: property (title), widget (QGroupBox, capDeformationGroupBox) -#: cube/cube_config.ui:449 +#: cube/cube_config.ui:446 #, fuzzy #| msgid "Decorations:" msgid "Sphere Cap Deformation" msgstr "सजावट:" #. i18n: ectx: property (text), widget (QLabel, capDeformationSphereLabel) -#: cube/cube_config.ui:471 +#: cube/cube_config.ui:468 #, fuzzy #| msgid "Nowhere" msgid "Sphere" msgstr "कहीं नहीं" #. i18n: ectx: property (text), widget (QLabel, capDeformationPlaneLabel) -#: cube/cube_config.ui:478 +#: cube/cube_config.ui:475 msgid "Plane" msgstr "समतल" @@ -369,8 +361,8 @@ msgid "Do not animate windows on all desktops" msgstr "सभी डेस्कटॉप में विंडोज के लिए:" -#. i18n: ectx: property (suffix), widget (QSpinBox, kcfg_RotationDuration) -#. i18n: ectx: property (suffix), widget (QSpinBox, kcfg_RingLife) +#. i18n: ectx: property (suffix), widget (KIntSpinBox, kcfg_RotationDuration) +#. i18n: ectx: property (suffix), widget (KIntSpinBox, kcfg_RingLife) #: cube/cubeslide_config.ui:52 mouseclick/mouseclick_config.ui:132 msgid " msec" msgstr "मि.से." @@ -450,58 +442,58 @@ msgid "Apply blur effect to background" msgstr "प्रभावों को समूहों में लागू करें (&g)" -#: desktopgrid/desktopgrid.cpp:69 desktopgrid/desktopgrid_config.cpp:66 +#: desktopgrid/desktopgrid.cpp:75 desktopgrid/desktopgrid_config.cpp:60 msgid "Show Desktop Grid" msgstr "डेस्कटॉप ग्रिड दिखाएँ" -#: desktopgrid/desktopgrid_config.cpp:74 +#: desktopgrid/desktopgrid_config.cpp:66 msgctxt "Desktop name alignment:" msgid "Disabled" msgstr "अक्षम" #. i18n: ectx: property (text), widget (QLabel, label_7) -#: desktopgrid/desktopgrid_config.cpp:75 flipswitch/flipswitch_config.ui:160 +#: desktopgrid/desktopgrid_config.cpp:67 flipswitch/flipswitch_config.ui:160 msgid "Top" msgstr "ऊपर" -#: desktopgrid/desktopgrid_config.cpp:76 +#: desktopgrid/desktopgrid_config.cpp:68 #, fuzzy #| msgid "Top-right" msgid "Top-Right" msgstr "ऊपरी दायां" #. i18n: ectx: property (text), widget (QLabel, label_5) -#: desktopgrid/desktopgrid_config.cpp:77 flipswitch/flipswitch_config.ui:125 -#: mouseclick/mouseclick.cpp:60 +#: desktopgrid/desktopgrid_config.cpp:69 flipswitch/flipswitch_config.ui:125 +#: mouseclick/mouseclick.cpp:56 msgid "Right" msgstr "दायाँ" -#: desktopgrid/desktopgrid_config.cpp:78 +#: desktopgrid/desktopgrid_config.cpp:70 #, fuzzy #| msgid "Bottom-right" msgid "Bottom-Right" msgstr "निचला दायाँ " #. i18n: ectx: property (text), widget (QLabel, label_8) -#: desktopgrid/desktopgrid_config.cpp:79 flipswitch/flipswitch_config.ui:180 +#: desktopgrid/desktopgrid_config.cpp:71 flipswitch/flipswitch_config.ui:180 msgid "Bottom" msgstr "नीचे" -#: desktopgrid/desktopgrid_config.cpp:80 +#: desktopgrid/desktopgrid_config.cpp:72 msgid "Bottom-Left" msgstr "निचला बायाँ " #. i18n: ectx: property (text), widget (QLabel, label_4) -#: desktopgrid/desktopgrid_config.cpp:81 flipswitch/flipswitch_config.ui:105 -#: mouseclick/mouseclick.cpp:58 +#: desktopgrid/desktopgrid_config.cpp:73 flipswitch/flipswitch_config.ui:105 +#: mouseclick/mouseclick.cpp:54 msgid "Left" msgstr "बायाँ" -#: desktopgrid/desktopgrid_config.cpp:82 +#: desktopgrid/desktopgrid_config.cpp:74 msgid "Top-Left" msgstr "ऊपरी बांया" -#: desktopgrid/desktopgrid_config.cpp:83 +#: desktopgrid/desktopgrid_config.cpp:75 msgid "Center" msgstr "बीच में" @@ -512,7 +504,7 @@ msgid "Zoom &duration:" msgstr "एनीमेशन अवधिः (&A)" -#. i18n: ectx: property (specialValueText), widget (QSpinBox, kcfg_ZoomDuration) +#. i18n: ectx: property (specialValueText), widget (KIntSpinBox, kcfg_ZoomDuration) #: desktopgrid/desktopgrid_config.ui:42 #, fuzzy #| msgid "Decorations:" @@ -589,13 +581,13 @@ msgid "&Strength:" msgstr "सामर्थ्य (&S):" -#: flipswitch/flipswitch.cpp:58 flipswitch/flipswitch_config.cpp:60 +#: flipswitch/flipswitch.cpp:62 flipswitch/flipswitch_config.cpp:54 #, fuzzy #| msgid "for windows on current desktop: " msgid "Toggle Flip Switch (Current desktop)" msgstr "वर्तमान डेस्कटॉप में विंडोज के लिए:" -#: flipswitch/flipswitch.cpp:65 flipswitch/flipswitch_config.cpp:63 +#: flipswitch/flipswitch.cpp:68 flipswitch/flipswitch_config.cpp:57 #, fuzzy #| msgid "for windows on all desktops: " msgid "Toggle Flip Switch (All desktops)" @@ -608,7 +600,7 @@ msgid "Flip animation duration:" msgstr "एनीमेशन अवधि पलटें: (&l)" -#. i18n: ectx: property (specialValueText), widget (QSpinBox, kcfg_Duration) +#. i18n: ectx: property (specialValueText), widget (KIntSpinBox, kcfg_Duration) #: flipswitch/flipswitch_config.ui:42 #, fuzzy #| msgid "Decorations:" @@ -621,7 +613,7 @@ msgid "Angle:" msgstr "कोणः" -#. i18n: ectx: property (suffix), widget (QSpinBox, kcfg_Angle) +#. i18n: ectx: property (suffix), widget (KIntSpinBox, kcfg_Angle) #: flipswitch/flipswitch_config.ui:71 msgid " °" msgstr " °" @@ -668,11 +660,11 @@ msgid "90" msgstr "" -#: invert/invert.cpp:44 invert/invert_config.cpp:51 +#: invert/invert.cpp:50 invert/invert_config.cpp:47 msgid "Toggle Invert Effect" msgstr "इनवर्ट प्रभाव टॉगल करें" -#: invert/invert.cpp:52 invert/invert_config.cpp:57 +#: invert/invert.cpp:55 invert/invert_config.cpp:52 #, fuzzy #| msgid "Toggle Invert Effect" msgid "Toggle Invert Effect on Window" @@ -684,7 +676,7 @@ msgstr "" #. i18n: ectx: property (text), widget (QLabel, label) -#: lookingglass/lookingglass_config.ui:24 +#: lookingglass/lookingglass_config.ui:20 msgid "&Radius:" msgstr "त्रिज्या: (&R)" @@ -706,8 +698,8 @@ msgid "&Width:" msgstr "चौड़ाईः (&W)" -#. i18n: ectx: property (suffix), widget (QSpinBox, kcfg_Width) -#. i18n: ectx: property (suffix), widget (QSpinBox, kcfg_Height) +#. i18n: ectx: property (suffix), widget (KIntSpinBox, kcfg_Width) +#. i18n: ectx: property (suffix), widget (KIntSpinBox, kcfg_Height) #: magnifier/magnifier_config.ui:42 magnifier/magnifier_config.ui:74 msgid " px" msgstr "px" @@ -717,13 +709,13 @@ msgid "&Height:" msgstr "ऊंचाईः (&H)" -#: mouseclick/mouseclick.cpp:50 mouseclick/mouseclick_config.cpp:62 +#: mouseclick/mouseclick.cpp:49 mouseclick/mouseclick_config.cpp:57 #, fuzzy #| msgid "Toggle Invert Effect" msgid "Toggle Effect" msgstr "इनवर्ट प्रभाव टॉगल करें" -#: mouseclick/mouseclick.cpp:59 +#: mouseclick/mouseclick.cpp:55 #, fuzzy #| msgid "Middle button:" msgid "Middle" @@ -774,10 +766,10 @@ msgid "Line Width:" msgstr "चौड़ाईः (&W)" -#. i18n: ectx: property (suffix), widget (QDoubleSpinBox, kcfg_LineWidth) -#. i18n: ectx: property (suffix), widget (QSpinBox, kcfg_RingSize) +#. i18n: ectx: property (suffix), widget (KDoubleNumInput, kcfg_LineWidth) +#. i18n: ectx: property (suffix), widget (KIntSpinBox, kcfg_RingSize) #: mouseclick/mouseclick_config.ui:119 mouseclick/mouseclick_config.ui:171 -#: mousemark/mousemark_config.cpp:55 +#: mousemark/mousemark_config.cpp:51 msgid " pixel" msgid_plural " pixels" msgstr[0] "पिक्सेल" @@ -820,15 +812,15 @@ msgid "Show Text:" msgstr "डेस्कटॉप दिखाएँ" -#: mousemark/mousemark.cpp:50 +#: mousemark/mousemark.cpp:53 msgid "Clear All Mouse Marks" msgstr "सभी माउस चिह्न साफ करें" -#: mousemark/mousemark.cpp:57 mousemark/mousemark_config.cpp:73 +#: mousemark/mousemark.cpp:57 mousemark/mousemark_config.cpp:68 msgid "Clear Last Mouse Mark" msgstr "आखिरी माउस चिह्न साफ करें" -#: mousemark/mousemark_config.cpp:67 +#: mousemark/mousemark_config.cpp:63 msgid "Clear Mouse Marks" msgstr "माउस चिह्न साफ करें" @@ -838,32 +830,32 @@ msgstr "रंग: (&C)" #. i18n: ectx: property (text), widget (QLabel, label_3) -#: mousemark/mousemark_config.ui:88 +#: mousemark/mousemark_config.ui:84 msgid "Draw with the mouse by holding Shift+Meta keys and moving the mouse." msgstr "शिफ्ट + मेटा कुंजी को दबाए रख कर तथा माउस को खिसकाकर आप ड्राइंग कर सकते हैं" -#: presentwindows/presentwindows.cpp:70 -#: presentwindows/presentwindows_config.cpp:71 +#: presentwindows/presentwindows.cpp:80 +#: presentwindows/presentwindows_config.cpp:64 #, fuzzy #| msgid "for windows on current desktop: " msgid "Toggle Present Windows (Current desktop)" msgstr "वर्तमान डेस्कटॉप में विंडोज के लिए:" -#: presentwindows/presentwindows.cpp:78 -#: presentwindows/presentwindows_config.cpp:65 +#: presentwindows/presentwindows.cpp:86 +#: presentwindows/presentwindows_config.cpp:59 #, fuzzy #| msgid "for windows on all desktops: " msgid "Toggle Present Windows (All desktops)" msgstr "सभी डेस्कटॉप में विंडोज के लिए:" -#: presentwindows/presentwindows.cpp:86 -#: presentwindows/presentwindows_config.cpp:77 +#: presentwindows/presentwindows.cpp:92 +#: presentwindows/presentwindows_config.cpp:69 #, fuzzy #| msgid "for windows on all desktops: " msgid "Toggle Present Windows (Window class)" msgstr "सभी डेस्कटॉप में विंडोज के लिए:" -#: presentwindows/presentwindows.cpp:1551 +#: presentwindows/presentwindows.cpp:1627 #, kde-format msgid "" "Filter:\n" @@ -873,34 +865,34 @@ "%1" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_3) -#: presentwindows/presentwindows_config.ui:39 +#: presentwindows/presentwindows_config.ui:36 msgid "Natural Layout Settings" msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_FillGaps) -#: presentwindows/presentwindows_config.ui:45 +#: presentwindows/presentwindows_config.ui:42 msgid "Fill &gaps" msgstr "जगह भरें (&g)" #. i18n: ectx: property (text), widget (QLabel, label_6) -#: presentwindows/presentwindows_config.ui:65 +#: presentwindows/presentwindows_config.ui:62 msgid "Faster" msgstr "ओर तेजी से" #. i18n: ectx: property (text), widget (QLabel, label_5) -#: presentwindows/presentwindows_config.ui:112 +#: presentwindows/presentwindows_config.ui:109 msgid "Nicer" msgstr "" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_4) -#: presentwindows/presentwindows_config.ui:122 +#: presentwindows/presentwindows_config.ui:119 msgid "Windows" msgstr "विंडोज़" #. i18n: ectx: property (text), widget (QLabel, label_2) #. i18n: ectx: property (text), widget (QLabel, label_8) -#: presentwindows/presentwindows_config.ui:128 -#: presentwindows/presentwindows_config.ui:272 +#: presentwindows/presentwindows_config.ui:125 +#: presentwindows/presentwindows_config.ui:269 msgid "Left button:" msgstr "बायाँ बटनः" @@ -910,12 +902,12 @@ #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_LeftButtonDesktop) #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_MiddleButtonDesktop) #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_RightButtonDesktop) -#: presentwindows/presentwindows_config.ui:139 -#: presentwindows/presentwindows_config.ui:183 -#: presentwindows/presentwindows_config.ui:227 -#: presentwindows/presentwindows_config.ui:283 -#: presentwindows/presentwindows_config.ui:317 -#: presentwindows/presentwindows_config.ui:351 +#: presentwindows/presentwindows_config.ui:136 +#: presentwindows/presentwindows_config.ui:180 +#: presentwindows/presentwindows_config.ui:224 +#: presentwindows/presentwindows_config.ui:280 +#: presentwindows/presentwindows_config.ui:314 +#: presentwindows/presentwindows_config.ui:348 msgid "No action" msgstr "कोई क्रिया नहीं" @@ -925,12 +917,12 @@ #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_LeftButtonDesktop) #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_MiddleButtonDesktop) #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_RightButtonDesktop) -#: presentwindows/presentwindows_config.ui:144 -#: presentwindows/presentwindows_config.ui:188 -#: presentwindows/presentwindows_config.ui:232 -#: presentwindows/presentwindows_config.ui:288 -#: presentwindows/presentwindows_config.ui:322 -#: presentwindows/presentwindows_config.ui:356 +#: presentwindows/presentwindows_config.ui:141 +#: presentwindows/presentwindows_config.ui:185 +#: presentwindows/presentwindows_config.ui:229 +#: presentwindows/presentwindows_config.ui:285 +#: presentwindows/presentwindows_config.ui:319 +#: presentwindows/presentwindows_config.ui:353 msgid "Activate window" msgstr "विंडो सक्रिय करें" @@ -940,58 +932,58 @@ #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_LeftButtonDesktop) #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_MiddleButtonDesktop) #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_RightButtonDesktop) -#: presentwindows/presentwindows_config.ui:149 -#: presentwindows/presentwindows_config.ui:193 -#: presentwindows/presentwindows_config.ui:237 -#: presentwindows/presentwindows_config.ui:293 -#: presentwindows/presentwindows_config.ui:327 -#: presentwindows/presentwindows_config.ui:361 +#: presentwindows/presentwindows_config.ui:146 +#: presentwindows/presentwindows_config.ui:190 +#: presentwindows/presentwindows_config.ui:234 +#: presentwindows/presentwindows_config.ui:290 +#: presentwindows/presentwindows_config.ui:324 +#: presentwindows/presentwindows_config.ui:358 msgid "End effect" msgstr "" #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_LeftButtonWindow) #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_MiddleButtonWindow) #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_RightButtonWindow) -#: presentwindows/presentwindows_config.ui:154 -#: presentwindows/presentwindows_config.ui:198 -#: presentwindows/presentwindows_config.ui:242 +#: presentwindows/presentwindows_config.ui:151 +#: presentwindows/presentwindows_config.ui:195 +#: presentwindows/presentwindows_config.ui:239 msgid "Bring window to current desktop" msgstr "विंडो को वर्तमान डेस्कटॉप में लाएँ" #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_LeftButtonWindow) #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_MiddleButtonWindow) #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_RightButtonWindow) -#: presentwindows/presentwindows_config.ui:159 -#: presentwindows/presentwindows_config.ui:203 -#: presentwindows/presentwindows_config.ui:247 +#: presentwindows/presentwindows_config.ui:156 +#: presentwindows/presentwindows_config.ui:200 +#: presentwindows/presentwindows_config.ui:244 msgid "Send window to all desktops" msgstr "विंडो को सभी डेस्कटॉप में ले जाएँ" #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_LeftButtonWindow) #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_MiddleButtonWindow) #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_RightButtonWindow) -#: presentwindows/presentwindows_config.ui:164 -#: presentwindows/presentwindows_config.ui:208 -#: presentwindows/presentwindows_config.ui:252 +#: presentwindows/presentwindows_config.ui:161 +#: presentwindows/presentwindows_config.ui:205 +#: presentwindows/presentwindows_config.ui:249 msgid "(Un-)Minimize window" msgstr "" #. i18n: ectx: property (text), widget (QLabel, label_4) #. i18n: ectx: property (text), widget (QLabel, label_9) -#: presentwindows/presentwindows_config.ui:172 -#: presentwindows/presentwindows_config.ui:306 +#: presentwindows/presentwindows_config.ui:169 +#: presentwindows/presentwindows_config.ui:303 msgid "Middle button:" msgstr "मध्य बटनः" #. i18n: ectx: property (text), widget (QLabel, label_7) #. i18n: ectx: property (text), widget (QLabel, label_10) -#: presentwindows/presentwindows_config.ui:216 -#: presentwindows/presentwindows_config.ui:340 +#: presentwindows/presentwindows_config.ui:213 +#: presentwindows/presentwindows_config.ui:337 msgid "Right button:" msgstr "दायाँ बटनः" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_5) -#: presentwindows/presentwindows_config.ui:263 +#: presentwindows/presentwindows_config.ui:260 msgctxt "@title:group actions when clicking on desktop" msgid "Desktop" msgstr "डेस्कटॉप" @@ -999,49 +991,49 @@ #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_LeftButtonDesktop) #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_MiddleButtonDesktop) #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_RightButtonDesktop) -#: presentwindows/presentwindows_config.ui:298 -#: presentwindows/presentwindows_config.ui:332 -#: presentwindows/presentwindows_config.ui:366 +#: presentwindows/presentwindows_config.ui:295 +#: presentwindows/presentwindows_config.ui:329 +#: presentwindows/presentwindows_config.ui:363 msgid "Show desktop" msgstr "डेस्कटॉप दिखाएँ" #. i18n: ectx: property (text), widget (QLabel, label_3) -#: presentwindows/presentwindows_config.ui:383 +#: presentwindows/presentwindows_config.ui:380 msgid "Layout mode:" msgstr "खाका मोड:" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_DrawWindowIcons) -#: presentwindows/presentwindows_config.ui:403 +#: presentwindows/presentwindows_config.ui:400 msgid "Display window &icons" msgstr "विंडो संप्रतीक दिखाएँ (&i)" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_IgnoreMinimized) -#: presentwindows/presentwindows_config.ui:410 +#: presentwindows/presentwindows_config.ui:407 msgid "Ignore &minimized windows" msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_ShowPanel) -#: presentwindows/presentwindows_config.ui:417 +#: presentwindows/presentwindows_config.ui:414 msgid "Show &panels" msgstr "पटल दिखाएँ (&p)" #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_LayoutMode) -#: presentwindows/presentwindows_config.ui:431 +#: presentwindows/presentwindows_config.ui:428 msgid "Natural" msgstr "प्राकृतिक" #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_LayoutMode) -#: presentwindows/presentwindows_config.ui:436 +#: presentwindows/presentwindows_config.ui:433 msgid "Regular Grid" msgstr "" #. i18n: ectx: property (text), item, widget (KComboBox, kcfg_LayoutMode) -#: presentwindows/presentwindows_config.ui:441 +#: presentwindows/presentwindows_config.ui:438 msgid "Flexible Grid" msgstr "" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_AllowClosingWindows) -#: presentwindows/presentwindows_config.ui:449 +#: presentwindows/presentwindows_config.ui:446 msgid "Provide buttons to close the windows" msgstr "" @@ -1057,7 +1049,7 @@ msgid "Show outline" msgstr "" -#: showfps/showfps.cpp:61 +#: showfps/showfps.cpp:63 msgid "This effect is not a benchmark" msgstr "" @@ -1111,8 +1103,8 @@ msgid "Text alpha:" msgstr "पाठ अल्फा:" -#: thumbnailaside/thumbnailaside.cpp:37 -#: thumbnailaside/thumbnailaside_config.cpp:70 +#: thumbnailaside/thumbnailaside.cpp:39 +#: thumbnailaside/thumbnailaside_config.cpp:67 msgid "Toggle Thumbnail for Current Window" msgstr "मौज़ूदा विंडो के लिए लघुछवि टॉगल करें" @@ -1126,7 +1118,7 @@ msgid "&Spacing:" msgstr "जगह: (&S)" -#. i18n: ectx: property (suffix), widget (QSpinBox, kcfg_Spacing) +#. i18n: ectx: property (suffix), widget (KIntSpinBox, kcfg_Spacing) #. i18n: ectx: property (suffix), widget (QSpinBox, kcfg_MaxWidth) #: thumbnailaside/thumbnailaside_config.ui:55 #: thumbnailaside/thumbnailaside_config.ui:106 @@ -1141,7 +1133,7 @@ msgid "&Opacity:" msgstr "अपारदर्शिता: (&O)" -#: trackmouse/trackmouse.cpp:60 trackmouse/trackmouse_config.cpp:66 +#: trackmouse/trackmouse.cpp:65 trackmouse/trackmouse_config.cpp:63 msgid "Track mouse" msgstr "" @@ -1246,11 +1238,11 @@ msgid "Torn-off menus:" msgstr "टॉर्न-ऑफ मेन्यू:" -#: windowgeometry/windowgeometry.cpp:62 +#: windowgeometry/windowgeometry.cpp:65 msgid "Toggle window geometry display (effect only)" msgstr "" -#: windowgeometry/windowgeometry_config.cpp:55 +#: windowgeometry/windowgeometry_config.cpp:49 msgid "Toggle KWin composited geometry display" msgstr "" @@ -1318,47 +1310,47 @@ msgid "More" msgstr "अधिक" -#: zoom/zoom.cpp:86 +#: zoom/zoom.cpp:79 msgid "Move Zoomed Area to Left" msgstr "" -#: zoom/zoom.cpp:94 +#: zoom/zoom.cpp:84 msgid "Move Zoomed Area to Right" msgstr "" -#: zoom/zoom.cpp:102 +#: zoom/zoom.cpp:89 msgid "Move Zoomed Area Upwards" msgstr "" -#: zoom/zoom.cpp:110 +#: zoom/zoom.cpp:94 msgid "Move Zoomed Area Downwards" msgstr "" -#: zoom/zoom.cpp:119 zoom/zoom_config.cpp:112 +#: zoom/zoom.cpp:100 zoom/zoom_config.cpp:102 msgid "Move Mouse to Focus" msgstr "" -#: zoom/zoom.cpp:127 zoom/zoom_config.cpp:119 +#: zoom/zoom.cpp:105 zoom/zoom_config.cpp:108 msgid "Move Mouse to Center" msgstr "" -#: zoom/zoom_config.cpp:84 +#: zoom/zoom_config.cpp:78 #, fuzzy #| msgid "Top Left" msgid "Move Left" msgstr "ऊपरी बायाँ " -#: zoom/zoom_config.cpp:91 +#: zoom/zoom_config.cpp:84 #, fuzzy #| msgid "Top Right" msgid "Move Right" msgstr "ऊपरी दायाँ " -#: zoom/zoom_config.cpp:98 +#: zoom/zoom_config.cpp:90 msgid "Move Up" msgstr "" -#: zoom/zoom_config.cpp:105 +#: zoom/zoom_config.cpp:96 msgid "Move Down" msgstr "" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kwin.po kde-l10n-hi-4.13.0/messages/kde-workspace/kwin.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kwin.po 2014-03-26 03:45:43.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kwin.po 2014-01-29 06:32:35.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kwin\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-26 01:53+0000\n" +"POT-Creation-Date: 2014-01-29 05:38+0000\n" "PO-Revision-Date: 2007-10-31 15:34+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -24,16 +24,16 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" -#: composite.cpp:451 +#: composite.cpp:450 #, kde-format msgid "" "Desktop effects have been suspended by another application.<br/>You can " "resume using the '%1' shortcut." msgstr "" -#: compositingprefs.cpp:98 +#: compositingprefs.cpp:96 msgid "" "<b>OpenGL compositing (the default) has crashed KWin in the past.</" "b><br>This was most likely due to a driver bug.<p>If you think that you have " @@ -42,19 +42,19 @@ "p><p>Alternatively, you might want to use the XRender backend instead.</p>" msgstr "" -#: compositingprefs.cpp:105 +#: compositingprefs.cpp:103 msgid "Required X extensions (XComposite and XDamage) are not available." msgstr "" -#: compositingprefs.cpp:109 +#: compositingprefs.cpp:107 msgid "GLX/OpenGL are not available and only OpenGL support is compiled." msgstr "" -#: compositingprefs.cpp:113 +#: compositingprefs.cpp:111 msgid "GLX/OpenGL and XRender/XFixes are not available." msgstr "" -#: decorations.cpp:62 +#: decorations.cpp:59 msgid "KWin: " msgstr "के-विनः" @@ -64,81 +64,57 @@ msgid "Window Manager" msgstr "केडीई विंडो प्रबंधक" -#: killer/killer.cpp:48 +#: killer/killer.cpp:44 +msgid "KWin helper utility" +msgstr "के-विन मदद यूटिलिटी" + +#: killer/killer.cpp:47 #, fuzzy #| msgid "PID of the application to terminate." msgid "PID of the application to terminate" msgstr "जिस अनुप्रयोग को बन्द करना है उसका पीआईडी." #: killer/killer.cpp:48 -msgid "pid" -msgstr "" - -#: killer/killer.cpp:50 #, fuzzy #| msgid "Hostname on which the application is running." msgid "Hostname on which the application is running" msgstr "होस्टनाम जहाँ अनुप्रयोग चल रहा है." -#: killer/killer.cpp:50 -msgid "hostname" -msgstr "" - -#: killer/killer.cpp:52 +#: killer/killer.cpp:49 #, fuzzy #| msgid "Caption of the window to be terminated." msgid "Caption of the window to be terminated" msgstr "जिस अनुप्रयोग को बन्द करना चाहते हैं उसका शीर्षक." -#: killer/killer.cpp:52 -msgid "caption" -msgstr "" - -#: killer/killer.cpp:54 +#: killer/killer.cpp:50 #, fuzzy #| msgid "Name of the application to be terminated." msgid "Name of the application to be terminated" msgstr "जिस अनुप्रयोग को बन्द करना चाहते हैं उसका नाम." -#: killer/killer.cpp:54 -msgid "name" -msgstr "" - -#: killer/killer.cpp:56 +#: killer/killer.cpp:51 #, fuzzy #| msgid "ID of resource belonging to the application." msgid "ID of resource belonging to the application" msgstr "अनुप्रयोग से संबंधित साधन का आईडी." -#: killer/killer.cpp:56 -msgid "id" -msgstr "" - -#: killer/killer.cpp:58 +#: killer/killer.cpp:52 #, fuzzy #| msgid "Time of user action causing killing." msgid "Time of user action causing termination" msgstr "उपयोक्ता क्रिया का समय जो बन्द करने का कारण बने." -#: killer/killer.cpp:58 -msgid "time" -msgstr "" - -#: killer/killer.cpp:60 -msgid "KWin helper utility" -msgstr "के-विन मदद यूटिलिटी" - -#: killer/killer.cpp:84 +#: killer/killer.cpp:69 msgid "This helper utility is not supposed to be called directly." msgstr "यह मदद यूटिलिटी सीधे ही बुलाया नहीं जा सकता." -#: killer/killer.cpp:94 +#: killer/killer.cpp:79 #, kde-format msgctxt "@info" msgid "<b>Application \"%1\" is not responding</b>" msgstr "" -#: killer/killer.cpp:96 +#: killer/killer.cpp:81 #, kde-format msgctxt "@info" msgid "" @@ -146,7 +122,7 @@ "%3) but the application is not responding.</para>" msgstr "" -#: killer/killer.cpp:98 +#: killer/killer.cpp:83 #, kde-format msgctxt "@info" msgid "" @@ -154,7 +130,7 @@ "%3), running on host \"%4\", but the application is not responding.</para>" msgstr "" -#: killer/killer.cpp:101 +#: killer/killer.cpp:86 msgctxt "@info" msgid "" "<para>Do you want to terminate this application?</" @@ -162,288 +138,316 @@ "windows. Any unsaved data will be lost.</warning></para>" msgstr "" -#: killer/killer.cpp:105 +#: killer/killer.cpp:90 #, kde-format msgid "&Terminate Application %1" msgstr "" -#: killer/killer.cpp:106 +#: killer/killer.cpp:91 msgid "Wait Longer" msgstr "" -#: kwinbindings.cpp:40 +#: kwinbindings.cpp:48 +msgid "System" +msgstr "तंत्र" + +#: kwinbindings.cpp:51 +msgid "Navigation" +msgstr "नेविगेशन" + +#: kwinbindings.cpp:52 #, fuzzy #| msgid "Walk Through Windows" msgid "Walk Through Window Tabs" msgstr "विंडोज़ के आरपार चलें" -#: kwinbindings.cpp:41 +#: kwinbindings.cpp:53 #, fuzzy #| msgid "Walk Through Windows (Reverse)" msgid "Walk Through Window Tabs (Reverse)" msgstr "विंडोज़ के आरपार चलें (उलटे)" -#: kwinbindings.cpp:42 +#: kwinbindings.cpp:54 msgid "Remove Window From Group" msgstr "" -#: kwinbindings.cpp:44 +#: kwinbindings.cpp:57 +msgid "Windows" +msgstr "विंडोज़" + +#: kwinbindings.cpp:58 msgid "Window Operations Menu" msgstr "विंडोज़ संचालन मेन्यू" -#: kwinbindings.cpp:46 +#: kwinbindings.cpp:60 msgid "Close Window" msgstr "विंडो बंद करें" -#: kwinbindings.cpp:48 +#: kwinbindings.cpp:62 msgid "Maximize Window" msgstr "विंडो अधिकतम करें" -#: kwinbindings.cpp:50 +#: kwinbindings.cpp:64 msgid "Maximize Window Vertically" msgstr "विंडो खड़े में अधिकतम करें" -#: kwinbindings.cpp:52 +#: kwinbindings.cpp:66 msgid "Maximize Window Horizontally" msgstr "विंडो आड़े में अधिकतम करें" -#: kwinbindings.cpp:54 +#: kwinbindings.cpp:68 msgid "Minimize Window" msgstr "विंडो न्यूनतम करें" -#: kwinbindings.cpp:56 +#: kwinbindings.cpp:70 msgid "Shade Window" msgstr "विंडो में छाया भरें" -#: kwinbindings.cpp:58 +#: kwinbindings.cpp:72 msgid "Move Window" msgstr "विंडो खिसकाएँ" -#: kwinbindings.cpp:60 +#: kwinbindings.cpp:74 msgid "Resize Window" msgstr "विंडो नया-आकार दें" -#: kwinbindings.cpp:62 +#: kwinbindings.cpp:76 msgid "Raise Window" msgstr "विंडो उठाएँ" -#: kwinbindings.cpp:64 +#: kwinbindings.cpp:78 msgid "Lower Window" msgstr "विंडो गिराएँ" -#: kwinbindings.cpp:66 +#: kwinbindings.cpp:80 msgid "Toggle Window Raise/Lower" msgstr "विंडो उठाना/गिराना टॉगल करें" -#: kwinbindings.cpp:68 +#: kwinbindings.cpp:82 msgid "Make Window Fullscreen" msgstr "विंडो फुल-स्क्रीन करें" -#: kwinbindings.cpp:70 +#: kwinbindings.cpp:84 msgid "Hide Window Border" msgstr "विंडो किनारा छुपाएँ" -#: kwinbindings.cpp:72 +#: kwinbindings.cpp:86 msgid "Keep Window Above Others" msgstr "विंडो अन्यों के ऊपर रखें" -#: kwinbindings.cpp:74 +#: kwinbindings.cpp:88 msgid "Keep Window Below Others" msgstr "विंडो अन्यों के नीचे रखें" -#: kwinbindings.cpp:76 +#: kwinbindings.cpp:90 msgid "Activate Window Demanding Attention" msgstr "विंडो जो ध्यान चाहते हैं, उन्हें सक्रिय करें" -#: kwinbindings.cpp:78 +#: kwinbindings.cpp:92 msgid "Setup Window Shortcut" msgstr "विंडो शॉर्टकट सेटअप करें" -#: kwinbindings.cpp:80 +#: kwinbindings.cpp:94 msgid "Pack Window to the Right" msgstr "विंडो दाएँ की तरफ पैक करें" -#: kwinbindings.cpp:82 +#: kwinbindings.cpp:96 msgid "Pack Window to the Left" msgstr "विंडो बाएँ की तरफ पैक करें" -#: kwinbindings.cpp:84 +#: kwinbindings.cpp:98 msgid "Pack Window Up" msgstr "विंडो ऊपर की तरफ पैक करें" -#: kwinbindings.cpp:86 +#: kwinbindings.cpp:100 msgid "Pack Window Down" msgstr "विंडो नीचे की तरफ पैक करें" -#: kwinbindings.cpp:88 +#: kwinbindings.cpp:102 msgid "Pack Grow Window Horizontally" msgstr "विंडो आड़े में पैक ग्रो करें" -#: kwinbindings.cpp:90 +#: kwinbindings.cpp:104 msgid "Pack Grow Window Vertically" msgstr "विंडो खड़े में पैक ग्रो करें" -#: kwinbindings.cpp:92 +#: kwinbindings.cpp:106 msgid "Pack Shrink Window Horizontally" msgstr "विंडो आड़े में पैक श्रिंक करें" -#: kwinbindings.cpp:94 +#: kwinbindings.cpp:108 msgid "Pack Shrink Window Vertically" msgstr "विंडो खड़े में पैक श्रिंक करें" -#: kwinbindings.cpp:96 +#: kwinbindings.cpp:110 #, fuzzy #| msgid "Pack Window to the Left" msgid "Quick Tile Window to the Left" msgstr "विंडो बाएँ की तरफ पैक करें" -#: kwinbindings.cpp:98 +#: kwinbindings.cpp:112 #, fuzzy #| msgid "Pack Window to the Right" msgid "Quick Tile Window to the Right" msgstr "विंडो दाएँ की तरफ पैक करें" -#: kwinbindings.cpp:100 +#: kwinbindings.cpp:114 #, fuzzy #| msgid "Pack Window to the Left" msgid "Quick Tile Window to the Top Left" msgstr "विंडो बाएँ की तरफ पैक करें" -#: kwinbindings.cpp:102 +#: kwinbindings.cpp:116 #, fuzzy #| msgid "Pack Window to the Left" msgid "Quick Tile Window to the Bottom Left" msgstr "विंडो बाएँ की तरफ पैक करें" -#: kwinbindings.cpp:104 +#: kwinbindings.cpp:118 #, fuzzy #| msgid "Pack Window to the Right" msgid "Quick Tile Window to the Top Right" msgstr "विंडो दाएँ की तरफ पैक करें" -#: kwinbindings.cpp:106 +#: kwinbindings.cpp:120 #, fuzzy #| msgid "Pack Window to the Right" msgid "Quick Tile Window to the Bottom Right" msgstr "विंडो दाएँ की तरफ पैक करें" -#: kwinbindings.cpp:108 +#: kwinbindings.cpp:122 #, fuzzy #| msgid "Switch to Screen 0" msgid "Switch to Window Above" msgstr "स्क्रीन 0 में स्विच करें" -#: kwinbindings.cpp:110 +#: kwinbindings.cpp:124 #, fuzzy #| msgid "Switch to Previous Desktop" msgid "Switch to Window Below" msgstr "पिछले डेस्कटॉप पर स्विच करें" -#: kwinbindings.cpp:112 +#: kwinbindings.cpp:126 #, fuzzy #| msgid "Pack Window to the Right" msgid "Switch to Window to the Right" msgstr "विंडो दाएँ की तरफ पैक करें" -#: kwinbindings.cpp:114 +#: kwinbindings.cpp:128 #, fuzzy #| msgid "Pack Window to the Left" msgid "Switch to Window to the Left" msgstr "विंडो बाएँ की तरफ पैक करें" -#: kwinbindings.cpp:116 +#: kwinbindings.cpp:130 msgid "Increase Opacity of Active Window by 5 %" msgstr "" -#: kwinbindings.cpp:118 +#: kwinbindings.cpp:132 msgid "Decrease Opacity of Active Window by 5 %" msgstr "" -#: kwinbindings.cpp:121 +#: kwinbindings.cpp:136 +msgid "Window & Desktop" +msgstr "विंडो व डेस्कटॉप" + +#: kwinbindings.cpp:137 msgid "Keep Window on All Desktops" msgstr "विंडो सभी डेस्कटॉप पर रखें" -#: kwinbindings.cpp:125 +#: kwinbindings.cpp:141 #, fuzzy, kde-format #| msgid "Window to Desktop 1" msgid "Window to Desktop %1" msgstr "विंडो डेस्कटॉप 1 पर" -#: kwinbindings.cpp:127 +#: kwinbindings.cpp:143 msgid "Window to Next Desktop" msgstr "विंडो अगले डेस्कटॉप पर" -#: kwinbindings.cpp:128 +#: kwinbindings.cpp:144 msgid "Window to Previous Desktop" msgstr "विंडो पिछले डेस्कटॉप पर" -#: kwinbindings.cpp:129 +#: kwinbindings.cpp:145 msgid "Window One Desktop to the Right" msgstr "विंडो एक डेस्कटॉप दाएँ पर" -#: kwinbindings.cpp:130 +#: kwinbindings.cpp:146 msgid "Window One Desktop to the Left" msgstr "विंडो एक डेस्कटॉप बाएँ पर" -#: kwinbindings.cpp:131 +#: kwinbindings.cpp:147 msgid "Window One Desktop Up" msgstr "विंडो एक डेस्कटॉप ऊपर" -#: kwinbindings.cpp:132 +#: kwinbindings.cpp:148 msgid "Window One Desktop Down" msgstr "विंडो एक डेस्कटॉप नीचे" -#: kwinbindings.cpp:135 +#: kwinbindings.cpp:151 #, fuzzy, kde-format #| msgid "Window to Screen 1" msgid "Window to Screen %1" msgstr "विंडो से स्क्रीन 1" -#: kwinbindings.cpp:137 +#: kwinbindings.cpp:153 msgid "Window to Next Screen" msgstr "विंडो से अगला स्क्रीन" -#: kwinbindings.cpp:138 +#: kwinbindings.cpp:154 #, fuzzy #| msgid "Window to Previous Desktop" msgid "Window to Previous Screen" msgstr "विंडो पिछले डेस्कटॉप पर" -#: kwinbindings.cpp:139 +#: kwinbindings.cpp:155 #, fuzzy #| msgid "Show Desktop Grid" msgid "Show Desktop" msgstr "डेस्कटॉप ग्रिड दिखाएँ" -#: kwinbindings.cpp:142 +#: kwinbindings.cpp:158 #, fuzzy, kde-format #| msgid "Switch to Screen 1" msgid "Switch to Screen %1" msgstr "स्क्रीन 1 में स्विच करें" -#: kwinbindings.cpp:145 +#: kwinbindings.cpp:161 msgid "Switch to Next Screen" msgstr "अगले स्क्रीन में स्विच करें" -#: kwinbindings.cpp:146 +#: kwinbindings.cpp:162 #, fuzzy #| msgid "Switch to Previous Desktop" msgid "Switch to Previous Screen" msgstr "पिछले डेस्कटॉप पर स्विच करें" -#: kwinbindings.cpp:148 +#: kwinbindings.cpp:165 +msgid "Miscellaneous" +msgstr "विविध" + +#: kwinbindings.cpp:166 msgid "Kill Window" msgstr "विंडो ख़त्म करें" -#: kwinbindings.cpp:149 +#: kwinbindings.cpp:167 msgid "Suspend Compositing" msgstr "" -#: kwinbindings.cpp:150 +#: kwinbindings.cpp:168 msgid "Invert Screen Colors" msgstr "" -#: main.cpp:144 +#: main.cpp:246 +msgid "" +"kwin: it looks like there's already a window manager running. kwin not " +"started.\n" +msgstr "" +"के-विन: ऐसा प्रतीत होता है कि वहाँ पहले से ही एक विंडो प्रबंधक चल रहा है. के-विन प्रारंभ " +"नहीं हुआ.\n" + +#: main.cpp:274 msgid "" "KWin is unstable.\n" "It seems to have crashed several times in a row.\n" @@ -453,7 +457,7 @@ "प्रतीत होता है कि यह बहुत बार लगातार क्रैश हो गया है.\n" "आप दूसरा विंडो प्रबंधक चुन सकते हैं:" -#: main.cpp:240 +#: main.cpp:331 msgid "" "kwin: unable to claim manager selection, another wm running? (try using --" "replace)\n" @@ -461,71 +465,61 @@ "के-विनः प्रबंधक सत्र क्लेम करने में अक्षम, अन्य विंडो प्रबंधक चल रहा है? (आजमाएँ --replace " "का उपयोग)\n" -#: main.cpp:260 -#, fuzzy -#| msgid "" -#| "kwin: unable to claim manager selection, another wm running? (try using --" -#| "replace)\n" -msgid "kwin: another window manager is running (try using --replace)\n" -msgstr "" -"के-विनः प्रबंधक सत्र क्लेम करने में अक्षम, अन्य विंडो प्रबंधक चल रहा है? (आजमाएँ --replace " -"का उपयोग)\n" - -#: main.cpp:396 main.cpp:508 +#: main.cpp:460 msgid "KDE window manager" msgstr "केडीई विंडो प्रबंधक" -#: main.cpp:487 main.cpp:491 +#: main.cpp:541 msgid "KWin" msgstr "के-विन" -#: main.cpp:495 +#: main.cpp:545 #, fuzzy #| msgid "(c) 1999-2005, The KDE Developers" -msgid "(c) 1999-2013, The KDE Developers" +msgid "(c) 1999-2008, The KDE Developers" msgstr "(c) 1999-2005, केडीई डेवलपर्स" -#: main.cpp:497 +#: main.cpp:546 msgid "Matthias Ettrich" msgstr "मेथियास एट्रिच" -#: main.cpp:498 +#: main.cpp:547 msgid "Cristian Tibirna" msgstr "क्रिश्चियन टिबरिना" -#: main.cpp:499 +#: main.cpp:548 msgid "Daniel M. Duley" msgstr "डेनियल एम. डुले" -#: main.cpp:500 +#: main.cpp:549 msgid "Luboš Luňák" msgstr "Luboš Luňák" -#: main.cpp:501 +#: main.cpp:550 msgid "Martin Gräßlin" msgstr "" -#: main.cpp:501 +#: main.cpp:550 msgid "Maintainer" msgstr "मेंटेनर" -#: main.cpp:503 +#: main.cpp:555 msgid "Disable configuration options" msgstr "कॉन्फ़िगरेशन विकल्प अक्षम करें" -#: main.cpp:504 +#: main.cpp:556 msgid "Replace already-running ICCCM2.0-compliant window manager" msgstr "पहले से ही चल रहे ICCCM2.0 कम्पलाएँट विंडो प्रबंधक को बदलें." -#: main.cpp:505 +#: main.cpp:557 msgid "Indicate that KWin has recently crashed n times" msgstr "इंगित करता है कि के-विन हाल ही में बहुत बार क्रैश हुआ है" -#: scene_opengl.cpp:348 +#: scene_opengl.cpp:358 msgid "Desktop effects were restarted due to a graphics reset" msgstr "" -#: scene_opengl.cpp:493 +#: scene_opengl.cpp:565 #, kde-format msgid "" "<h1>OpenGL desktop effects not possible</h1>Your system cannot perform " @@ -535,7 +529,7 @@ "%2 " msgstr "" -#: scene_opengl.cpp:500 +#: scene_opengl.cpp:572 msgid "" "The demanded resolution exceeds the GL_MAX_VIEWPORT_DIMS limitation of your " "GPU and is therefore not compatible with the OpenGL compositor.<br>XRender " @@ -543,7 +537,7 @@ "by the hardware limitations that restrict the OpenGL viewport size." msgstr "" -#: scene_opengl.cpp:525 +#: scene_opengl.cpp:597 #, kde-format msgid "" "<h1>OpenGL desktop effects might be unusable</h1>OpenGL Desktop Effects at " @@ -552,7 +546,7 @@ "compositing, switch to the XRender backend or lower the resolution to %1x%1." msgstr "" -#: scene_opengl.cpp:531 +#: scene_opengl.cpp:603 msgid "" "The demanded resolution exceeds the GL_MAX_TEXTURE_SIZE limitation of your " "GPU, thus windows of that size cannot be assigned to textures and will be " @@ -561,80 +555,74 @@ "software rendering in this case." msgstr "" -#: tabbox/tabbox.cpp:349 +#: tabbox/tabbox.cpp:354 #, fuzzy #| msgid "Show Desktop Grid" msgctxt "Special entry in alt+tab list for minimizing all windows" msgid "Show Desktop" msgstr "डेस्कटॉप ग्रिड दिखाएँ" -#: tabbox/tabbox.cpp:503 +#: tabbox/tabbox.cpp:509 msgid "Walk Through Windows" msgstr "विंडोज़ के आरपार चलें" -#: tabbox/tabbox.cpp:504 +#: tabbox/tabbox.cpp:510 msgid "Walk Through Windows (Reverse)" msgstr "विंडोज़ के आरपार चलें (उलटे)" -#: tabbox/tabbox.cpp:505 +#: tabbox/tabbox.cpp:511 #, fuzzy #| msgid "Walk Through Windows (Reverse)" msgid "Walk Through Windows Alternative" msgstr "विंडोज़ के आरपार चलें (उलटे)" -#: tabbox/tabbox.cpp:506 +#: tabbox/tabbox.cpp:512 #, fuzzy #| msgid "Walk Through Windows (Reverse)" msgid "Walk Through Windows Alternative (Reverse)" msgstr "विंडोज़ के आरपार चलें (उलटे)" -#: tabbox/tabbox.cpp:507 +#: tabbox/tabbox.cpp:513 #, fuzzy #| msgid "Walk Through Windows (Reverse)" msgid "Walk Through Windows of Current Application" msgstr "विंडोज़ के आरपार चलें (उलटे)" -#: tabbox/tabbox.cpp:508 +#: tabbox/tabbox.cpp:514 #, fuzzy #| msgid "Walk Through Windows (Reverse)" msgid "Walk Through Windows of Current Application (Reverse)" msgstr "विंडोज़ के आरपार चलें (उलटे)" -#: tabbox/tabbox.cpp:509 +#: tabbox/tabbox.cpp:515 #, fuzzy #| msgid "Walk Through Windows (Reverse)" msgid "Walk Through Windows of Current Application Alternative" msgstr "विंडोज़ के आरपार चलें (उलटे)" -#: tabbox/tabbox.cpp:510 +#: tabbox/tabbox.cpp:516 #, fuzzy #| msgid "Walk Through Windows (Reverse)" msgid "Walk Through Windows of Current Application Alternative (Reverse)" msgstr "विंडोज़ के आरपार चलें (उलटे)" -#: tabbox/tabbox.cpp:511 +#: tabbox/tabbox.cpp:517 msgid "Walk Through Desktops" msgstr "डेस्कटॉप के आरपार चलें" -#: tabbox/tabbox.cpp:512 +#: tabbox/tabbox.cpp:518 msgid "Walk Through Desktops (Reverse)" msgstr "डेस्कटॉप के आरपार चलें (उलटे)" -#: tabbox/tabbox.cpp:513 +#: tabbox/tabbox.cpp:519 msgid "Walk Through Desktop List" msgstr "डेस्कटॉप सूची के आरपार चलें" -#: tabbox/tabbox.cpp:514 +#: tabbox/tabbox.cpp:520 msgid "Walk Through Desktop List (Reverse)" msgstr "डेस्कटॉप सूची के आरपार चलें (उलटे)" -#: tabbox/tabboxhandler.cpp:275 -msgid "" -"The Window Switcher installation is broken, resources are missing.\n" -"Contact your distribution about this." -msgstr "" - -#: useractions.cpp:185 +#: useractions.cpp:196 #, kde-format msgid "" "You have selected to show a window without its border.\n" @@ -646,7 +634,7 @@ "बिना किनारा, आप फिर से माउस की मदद से बार्डर नहीं बना पाएंगे. इसके बजाए विंडो संचालन " "मेन्यू इस्तेमाल करें, जो %1 कुंजी शॉर्टकट से सक्रिय होता है." -#: useractions.cpp:193 +#: useractions.cpp:208 #, kde-format msgid "" "You have selected to show a window in fullscreen mode.\n" @@ -659,49 +647,49 @@ "मदद से इसे फिर से अक्षम करने में असमर्थ रहेंगे. इसके बजाए विंडो संचालन मेन्यू इस्तेमाल करें, जो " "%1 कुंजी शॉर्टकट से सक्रिय होता है." -#: useractions.cpp:265 +#: useractions.cpp:272 msgid "&Move" msgstr "खिसकाएँ (&M) " -#: useractions.cpp:270 +#: useractions.cpp:280 msgid "Re&size" msgstr "नया आकार (&s)" -#: useractions.cpp:274 +#: useractions.cpp:286 msgid "Keep &Above Others" msgstr "अन्यों के ऊपर रखें (&A)" -#: useractions.cpp:279 +#: useractions.cpp:294 msgid "Keep &Below Others" msgstr "अन्यों के नीचे रखें (&B)" -#: useractions.cpp:285 +#: useractions.cpp:302 msgid "&Fullscreen" msgstr "संपूर्ण स्क्रीन (&F)" -#: useractions.cpp:291 +#: useractions.cpp:310 msgid "Sh&ade" msgstr "छाया (&a)" -#: useractions.cpp:296 +#: useractions.cpp:317 msgid "&No Border" msgstr "किनारा बिना (&N)" -#: useractions.cpp:303 +#: useractions.cpp:326 msgid "Window &Shortcut..." msgstr "विंडो शॉर्टकट... (&S)" -#: useractions.cpp:308 +#: useractions.cpp:333 msgid "&Special Window Settings..." msgstr "विशिष्ट विंडो विन्यास...(&S)" -#: useractions.cpp:312 +#: useractions.cpp:337 #, fuzzy #| msgid "&Special Application Settings..." msgid "S&pecial Application Settings..." msgstr "विशिष्ट अनुप्रयोग विन्यास... (&S)" -#: useractions.cpp:319 +#: useractions.cpp:344 #, fuzzy #| msgid "&Special Window Settings..." msgctxt "" @@ -710,126 +698,130 @@ msgid "Window &Manager Settings..." msgstr "विशिष्ट विंडो विन्यास...(&S)" -#: useractions.cpp:324 +#: useractions.cpp:349 msgid "Mi&nimize" msgstr "न्यूनतम करें (&n)" -#: useractions.cpp:328 +#: useractions.cpp:355 msgid "Ma&ximize" msgstr "अधिकतम करें (&x)" -#: useractions.cpp:337 +#: useractions.cpp:366 msgid "&Untab" msgstr "" -#: useractions.cpp:341 +#: useractions.cpp:372 msgid "Close Entire &Group" msgstr "" -#: useractions.cpp:352 +#: useractions.cpp:385 msgid "&More Actions" msgstr "" -#: useractions.cpp:356 +#: useractions.cpp:389 msgid "&Close" msgstr "बंद करें (&C)" -#: useractions.cpp:432 +#: useractions.cpp:468 msgid "&Extensions" msgstr "" -#: useractions.cpp:485 +#: useractions.cpp:522 msgctxt "Switch to tab -> Previous" msgid "Previous" msgstr "" -#: useractions.cpp:486 +#: useractions.cpp:523 msgctxt "Switch to tab -> Next" msgid "Next" msgstr "" -#: useractions.cpp:524 +#: useractions.cpp:561 msgctxt "There's no window available to be attached as tab to this one" msgid "None available" msgstr "" -#: useractions.cpp:533 +#: useractions.cpp:570 #, fuzzy #| msgid "Switch to Screen 0" msgid "Switch to Tab" msgstr "स्क्रीन 0 में स्विच करें" -#: useractions.cpp:544 +#: useractions.cpp:582 msgid "&Attach as tab to" msgstr "" -#: useractions.cpp:566 +#: useractions.cpp:606 #, fuzzy #| msgid "To &Desktop" msgid "Move To &Desktop" msgstr "डेस्कटॉप पर (&D)" -#: useractions.cpp:582 +#: useractions.cpp:623 #, fuzzy #| msgid "To &Desktop" msgid "Move To &Screen" msgstr "डेस्कटॉप पर (&D)" -#: useractions.cpp:599 +#: useractions.cpp:641 msgid "Ac&tivities" msgstr "" -#: useractions.cpp:611 +#: useractions.cpp:652 msgid "&All Desktops" msgstr "सभी डेस्कटॉप (&A)" -#: useractions.cpp:637 +#: useractions.cpp:678 #, fuzzy #| msgid "Show Desktop Grid" msgctxt "Create a new desktop and move there the window" msgid "&New Desktop" msgstr "डेस्कटॉप ग्रिड दिखाएँ" -#: useractions.cpp:658 +#: useractions.cpp:698 #, fuzzy, kde-format #| msgid "Window to Screen 1" msgctxt "@item:inmenu List of all Screens to send a window to" msgid "Screen &%1" msgstr "विंडो से स्क्रीन 1" -#: useractions.cpp:676 +#: useractions.cpp:715 msgid "&All Activities" msgstr "" -#: useractions.cpp:863 +#: useractions.cpp:905 #, kde-format msgctxt "'%1' is a keyboard shortcut like 'ctrl+w'" msgid "<b>%1</b> is already in use" msgstr "" -#: useractions.cpp:865 +#: useractions.cpp:907 #, kde-format msgctxt "keyboard shortcut '%1' is used by action '%2' in application '%3'" msgid "<b>%1</b> is used by %2 in %3" msgstr "" -#: useractions.cpp:988 +#: useractions.cpp:1023 #, kde-format msgid "Activate Window (%1)" msgstr "" -#: useractions.cpp:1357 +#: useractions.cpp:1396 msgid "" "The window manager is configured to consider the screen with the mouse on it " "as active one.\n" "Therefore it is not possible to switch to a screen explicitly." msgstr "" -#: virtualdesktops.cpp:334 virtualdesktops.cpp:396 +#: virtualdesktops.cpp:332 virtualdesktops.cpp:394 #, kde-format msgid "Desktop %1" msgstr "डेस्कटॉप %1" +#: virtualdesktops.cpp:424 +msgid "Desktop Switching" +msgstr "डेस्कटॉप बदलना" + #: virtualdesktops.cpp:427 msgid "Switch to Next Desktop" msgstr "अगले डेस्कटॉप पर स्विच करें" @@ -854,13 +846,13 @@ msgid "Switch One Desktop Down" msgstr "एक डेस्कटॉप नीचे स्विच करें" -#: virtualdesktops.cpp:444 +#: virtualdesktops.cpp:438 #, fuzzy, kde-format #| msgid "Switch to Desktop 1" msgid "Switch to Desktop %1" msgstr "डेस्कटॉप 1 पर स्विच करें" -#: workspace.cpp:1334 +#: workspace.cpp:1373 msgctxt "Introductory text shown in the support information." msgid "" "KWin Support Information:\n" @@ -874,31 +866,6 @@ "like http://paste.kde.org instead of pasting into support threads.\n" msgstr "" -#~ msgid "System" -#~ msgstr "तंत्र" - -#~ msgid "Navigation" -#~ msgstr "नेविगेशन" - -#~ msgid "Windows" -#~ msgstr "विंडोज़" - -#~ msgid "Window & Desktop" -#~ msgstr "विंडो व डेस्कटॉप" - -#~ msgid "Miscellaneous" -#~ msgstr "विविध" - -#~ msgid "Desktop Switching" -#~ msgstr "डेस्कटॉप बदलना" - -#~ msgid "" -#~ "kwin: it looks like there's already a window manager running. kwin not " -#~ "started.\n" -#~ msgstr "" -#~ "के-विन: ऐसा प्रतीत होता है कि वहाँ पहले से ही एक विंडो प्रबंधक चल रहा है. के-विन " -#~ "प्रारंभ नहीं हुआ.\n" - #~ msgid "Block Global Shortcuts" #~ msgstr "वैश्विक शॉर्टकट्स पर रोक लगाएँ" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/kxkb.po kde-l10n-hi-4.13.0/messages/kde-workspace/kxkb.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/kxkb.po 2014-03-22 03:29:17.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/kxkb.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kxkb\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-22 01:48+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2007-11-02 15:11+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -28,7 +28,7 @@ msgid "KDE Keyboard Layout Switcher" msgstr "केडीई कुंजीपटल अभिन्यास परिवर्तक" -#: bindings.cpp:68 +#: bindings.cpp:67 #, fuzzy, kde-format #| msgid "Error changing keyboard layout to '%1'" msgid "Switch keyboard layout to %1" @@ -55,19 +55,19 @@ msgid "Default" msgstr "" -#: kcm_keyboard.cpp:52 +#: kcm_keyboard.cpp:53 #, fuzzy #| msgid "KDE Keyboard Layout Switcher" msgid "KDE Keyboard Control Module" msgstr "केडीई कुंजीपटल अभिन्यास परिवर्तक" -#: kcm_keyboard.cpp:54 +#: kcm_keyboard.cpp:55 #, fuzzy #| msgid "Copyright (C) 2006-2007 Andriy Rysin" msgid "(c) 2010 Andriy Rysin" msgstr "स्वत्वाधिकार (c) 2006-2007 आन्द्रेई राइसिन" -#: kcm_keyboard.cpp:57 +#: kcm_keyboard.cpp:58 msgid "" "<h1>Keyboard</h1> This control module can be used to configure keyboard " "parameters and layouts." diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/libkdecorations.po kde-l10n-hi-4.13.0/messages/kde-workspace/libkdecorations.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/libkdecorations.po 2014-03-19 06:15:59.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/libkdecorations.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kwin_lib\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-19 04:21+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2007-10-31 15:27+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -18,94 +18,103 @@ "X-Generator: KBabel 1.11.4\n" "Plural-Forms: nplurals=2; plural=(n!=1);\n" -#: kcommondecoration.cpp:316 +#: kcommondecoration.cpp:290 #, fuzzy, kde-format #| msgid "<center><b>%1 preview</b></center>" msgid "<center><b>%1</b></center>" msgstr "<center><b>%1 पूर्वावलोकन</b></center>" -#: kcommondecoration.cpp:408 +#: kcommondecoration.cpp:385 msgctxt "Button showing window actions menu" msgid "Window Menu" msgstr "" -#: kcommondecoration.cpp:423 +#: kcommondecoration.cpp:400 msgctxt "Button showing application menu" msgid "Application Menu" msgstr "" -#: kcommondecoration.cpp:445 kcommondecoration.cpp:668 +#: kcommondecoration.cpp:422 kcommondecoration.cpp:639 msgid "Not on all desktops" msgstr "सभी डेस्कटॉप पर नहीं" -#: kcommondecoration.cpp:445 kcommondecoration.cpp:669 +#: kcommondecoration.cpp:422 kcommondecoration.cpp:640 msgid "On all desktops" msgstr "सभी डेस्कटॉप पर" -#: kcommondecoration.cpp:460 +#: kcommondecoration.cpp:437 msgid "Help" msgstr "मदद" -#: kcommondecoration.cpp:473 +#: kcommondecoration.cpp:450 msgid "Minimize" msgstr "न्यूनतम " -#: kcommondecoration.cpp:488 kcommondecoration.cpp:656 +#: kcommondecoration.cpp:465 kcommondecoration.cpp:627 msgid "Restore" msgstr "पुरानी स्तिथी में लाऐं" -#: kcommondecoration.cpp:488 kcommondecoration.cpp:655 +#: kcommondecoration.cpp:465 kcommondecoration.cpp:626 msgid "Maximize" msgstr "अधिकतम" -#: kcommondecoration.cpp:503 +#: kcommondecoration.cpp:480 msgid "Close" msgstr "बंद करें" -#: kcommondecoration.cpp:517 kcommondecoration.cpp:709 +#: kcommondecoration.cpp:494 kcommondecoration.cpp:680 msgid "Do not keep above others" msgstr "अन्यों के ऊपर नहीं रखें" -#: kcommondecoration.cpp:517 kcommondecoration.cpp:709 -#: kcommondecoration.cpp:730 +#: kcommondecoration.cpp:494 kcommondecoration.cpp:680 +#: kcommondecoration.cpp:701 msgid "Keep above others" msgstr "अन्यों के ऊपर रखें" -#: kcommondecoration.cpp:533 kcommondecoration.cpp:724 +#: kcommondecoration.cpp:510 kcommondecoration.cpp:695 msgid "Do not keep below others" msgstr "अन्यों के नीचे नहीं रखें" -#: kcommondecoration.cpp:533 kcommondecoration.cpp:715 -#: kcommondecoration.cpp:724 +#: kcommondecoration.cpp:510 kcommondecoration.cpp:686 +#: kcommondecoration.cpp:695 msgid "Keep below others" msgstr "अन्यों के नीचे रखें" -#: kcommondecoration.cpp:549 kcommondecoration.cpp:680 +#: kcommondecoration.cpp:526 kcommondecoration.cpp:651 msgid "Unshade" msgstr "छाया हटाएँ" -#: kcommondecoration.cpp:549 kcommondecoration.cpp:681 +#: kcommondecoration.cpp:526 kcommondecoration.cpp:652 msgid "Shade" msgstr "छाया" -#: kdecoration_plugins_p.cpp:102 +#: kdecoration_plugins_p.cpp:124 #, fuzzy #| msgid "No window decoration plugin library was found." msgid "Loading of window decoration plugin library disabled in configuration." msgstr "कोई विंडो डेकोरेशन प्लगइल लाइब्रेरी नहीं मिली." -#: kdecoration_plugins_p.cpp:116 +#: kdecoration_plugins_p.cpp:178 #, fuzzy, kde-format #| msgid "The library %1 is not a KWin plugin." msgid "The library %1 has wrong API version %2" msgstr "लाइब्रेरी %1 के-विन प्लगइन नहीं है." -#: kdecoration_plugins_p.cpp:134 +#: kdecoration_plugins_p.cpp:189 +#, kde-format +msgid "The library %1 is not a KWin plugin." +msgstr "लाइब्रेरी %1 के-विन प्लगइन नहीं है." + +#: kdecoration_plugins_p.cpp:226 kdecoration_plugins_p.cpp:243 msgid "The default decoration plugin is corrupt and could not be loaded." msgstr "डिफ़ॉल्ट डेकोरेशन प्लगइन खराब है तथा लोड नहीं किया जा सकता." -#~ msgid "The library %1 is not a KWin plugin." -#~ msgstr "लाइब्रेरी %1 के-विन प्लगइन नहीं है." +#: kdecoration_plugins_p.cpp:238 +#, kde-format +msgid "" +"The library %1 was attempted to be loaded as a decoration plugin but it is " +"NOT" +msgstr "" #~ msgid "Menu" #~ msgstr "मेन्यू" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/libkscreensaver.po kde-l10n-hi-4.13.0/messages/kde-workspace/libkscreensaver.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/libkscreensaver.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/libkscreensaver.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,43 @@ +# translation of libkscreensaver.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007. +msgid "" +msgstr "" +"Project-Id-Version: libkscreensaver\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2007-11-01 12:43+0530\n" +"Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" + +msgctxt "NAME OF TRANSLATORS" +msgid "Your names" +msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर" + +msgctxt "EMAIL OF TRANSLATORS" +msgid "Your emails" +msgstr "raviratlami@aol.in" + +#: main.cpp:135 +msgid "Setup screen saver" +msgstr "स्क्रीन सेवर सेटअप करें" + +#: main.cpp:137 +msgid "Run in the specified XWindow" +msgstr "निर्दिष्ट एक्स-विंडो में चलाएँ" + +#: main.cpp:139 +msgid "Run in the root XWindow" +msgstr "रूट एक्स-विंडो में चलाएँ" + +#: main.cpp:141 +msgid "Start screen saver in demo mode" +msgstr "स्क्रीन सेवर को डेमो मोड मे चलाएँ" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/libkworkspace.po kde-l10n-hi-4.13.0/messages/kde-workspace/libkworkspace.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/libkworkspace.po 2014-03-18 04:10:55.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/libkworkspace.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: libkworkspace\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-18 01:45+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2007-11-01 12:45+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -18,56 +18,60 @@ "X-Generator: KBabel 1.11.4\n" "Plural-Forms: nplurals=2; plural=(n!=1);\n" -#: kdisplaymanager.cpp:781 +#: kdisplaymanager.cpp:780 #, kde-format msgctxt "user: ..." msgid "%1: TTY login" msgstr "%1: टीटीवाई लॉगइन" -#: kdisplaymanager.cpp:787 +#: kdisplaymanager.cpp:786 #, fuzzy #| msgid "Unused" msgctxt "... location (TTY or X display)" msgid "Unused" msgstr "उपयोग में नहीं" -#: kdisplaymanager.cpp:789 +#: kdisplaymanager.cpp:788 msgid "X login on remote host" msgstr "रिमोट होस्ट पर एक्स लॉगइन" -#: kdisplaymanager.cpp:790 +#: kdisplaymanager.cpp:789 #, kde-format msgctxt "... host" msgid "X login on %1" msgstr "एक्स %1 पर लॉगइन हो रहे हैं" -#: kdisplaymanager.cpp:793 +#: kdisplaymanager.cpp:792 #, kde-format msgctxt "user: session type" msgid "%1: %2" msgstr "%1: %2" -#: kdisplaymanager.cpp:808 +#: kdisplaymanager.cpp:807 #, kde-format msgctxt "session (location)" msgid "%1 (%2)" msgstr "%1 (%2)" +#: kwindowlistmenu.cpp:100 #, fuzzy -#~| msgid "Unclutter Windows" -#~ msgctxt "" -#~ "Action that reorganizes the windows to try to have them less cluttered" -#~ msgid "Unclutter Windows" -#~ msgstr "विंडो व्यवस्थित करें" +#| msgid "Unclutter Windows" +msgctxt "" +"Action that reorganizes the windows to try to have them less cluttered" +msgid "Unclutter Windows" +msgstr "विंडो व्यवस्थित करें" +#: kwindowlistmenu.cpp:102 #, fuzzy -#~| msgid "Cascade Windows" -#~ msgctxt "Action that reorganizes the windows so that they are in cascade" -#~ msgid "Cascade Windows" -#~ msgstr "विंडो एक के बाद एक रखें" - -#~ msgid "On All Desktops" -#~ msgstr "सभी डेस्कटॉप पर" - -#~ msgid "No Windows" -#~ msgstr "कोई विंडोज़ नहीं" +#| msgid "Cascade Windows" +msgctxt "Action that reorganizes the windows so that they are in cascade" +msgid "Cascade Windows" +msgstr "विंडो एक के बाद एक रखें" + +#: kwindowlistmenu.cpp:157 +msgid "On All Desktops" +msgstr "सभी डेस्कटॉप पर" + +#: kwindowlistmenu.cpp:184 +msgid "No Windows" +msgstr "कोई विंडोज़ नहीं" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/libplasmaclock.po kde-l10n-hi-4.13.0/messages/kde-workspace/libplasmaclock.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/libplasmaclock.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/libplasmaclock.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,334 @@ +# translation of libplasmaclock.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Rajesh Ranjan <rajesh672@gmail.com>, 2010. +msgid "" +msgstr "" +"Project-Id-Version: libplasmaclock\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2010-01-31 20:51+0530\n" +"Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" +"X-Generator: KBabel 1.11.4\n" + +#: calendar.cpp:190 +msgid "Select today" +msgstr "" + +#: calendar.cpp:444 +msgctxt "No events on the calendar starting from today" +msgid "No upcoming events." +msgstr "" + +#: calendar.cpp:467 +msgctxt "No events on the calendar" +msgid "No events for this date." +msgstr "" + +#. i18n: ectx: property (text), widget (QLabel, label_2) +#: calendarConfig.ui:33 calendarHolidaysConfig.ui:33 +#, fuzzy +#| msgid "Calendar System:" +msgid "Calendar system:" +msgstr "केलेण्डर तंत्र" + +#. i18n: ectx: property (text), widget (QLabel, label) +#: calendarConfig.ui:76 +msgid "Display Kontact events:" +msgstr "" + +#. i18n: ectx: property (text), widget (QLabel, label) +#: calendarHolidaysConfig.ui:76 +msgid "Display events:" +msgstr "" + +#. i18n: ectx: property (text), widget (QLabel, label_7) +#: calendarHolidaysConfig.ui:119 +#, fuzzy +#| msgid "Holidays:" +msgid "Holidays" +msgstr "छुट्टियाँ:" + +#: calendartable.cpp:679 +#, fuzzy, kde-format +#| msgid "Holiday: %1" +msgctxt "Day off: Holiday name (holiday region)" +msgid "<i>Holiday</i>: %1 (%2)" +msgstr "छुट्टी: %1" + +#: calendartable.cpp:685 +#, kde-format +msgctxt "Not day off: Holiday name (holiday region)" +msgid "%1 (%2)" +msgstr "" + +#: calendartable.cpp:694 +#, fuzzy, kde-format +#| msgid "Holiday: %1" +msgid "<i>Event</i>: %1" +msgstr "छुट्टी: %1" + +#: calendartable.cpp:701 +#, fuzzy, kde-format +#| msgid "Holiday: %1" +msgid "<i>Todo</i>: %1" +msgstr "छुट्टी: %1" + +#: calendartable.cpp:716 +#, kde-format +msgctxt "All-day calendar event summary" +msgid "<br>%1" +msgstr "" + +#: calendartable.cpp:718 +#, kde-format +msgctxt "Time and summary for a calendarevent" +msgid "%1<br>%2" +msgstr "" + +#: calendartable.cpp:723 +#, kde-format +msgctxt "Start and end time and summary for a calendar event" +msgid "%1 - %2<br>%3" +msgstr "" + +#: calendartable.cpp:952 +msgid "Calendar" +msgstr "कैलेन्डर" + +#: calendartable.cpp:955 +msgid "Local" +msgstr "स्थानीय" + +#: clockapplet.cpp:193 +msgid "Starting Jovie Text-to-Speech Service Failed" +msgstr "" + +#: clockapplet.cpp:206 +#, kde-format +msgctxt "Text sent to the text to speech service when minutes==0 and it is AM" +msgid "It is 1 o clock a m" +msgid_plural "It is %1 o clock a m" +msgstr[0] "" +msgstr[1] "" + +#: clockapplet.cpp:212 +#, kde-format +msgctxt "Text sent to the text to speech service when minutes==0 and it is PM" +msgid "It is 1 o clock p m" +msgid_plural "It is %1 o clock p m" +msgstr[0] "" +msgstr[1] "" + +#: clockapplet.cpp:219 +#, kde-format +msgctxt "" +"Text sent to the text to speech service when minutes==0 and it is the 24 " +"hour clock" +msgid "It is 1 o clock" +msgid_plural "It is %1 o clock" +msgstr[0] "" +msgstr[1] "" + +#: clockapplet.cpp:227 +#, kde-format +msgctxt "Text sent to the text to speech service for AM" +msgid "It is %1:%2 a m" +msgstr "अभी है %1:%2 पुआ" + +#: clockapplet.cpp:232 +#, kde-format +msgctxt "Text sent to the text to speech service for PM" +msgid "It is %1:%2 p m" +msgstr "अभी है %1:%2 अप्र" + +#: clockapplet.cpp:238 +#, kde-format +msgctxt "Text sent to the text to speech service for the 24 hour clock" +msgid "It is %1:%2" +msgstr "अभी है %1:%2" + +#: clockapplet.cpp:283 +msgid "Current Time and Events" +msgstr "" + +#: clockapplet.cpp:283 +msgid "Current Time" +msgstr "" + +#: clockapplet.cpp:306 +msgid "Today's Events" +msgstr "" + +#: clockapplet.cpp:380 +msgctxt "General configuration page" +msgid "General" +msgstr "सामान्य" + +#: clockapplet.cpp:382 +#, fuzzy +#| msgid "Never" +msgctxt "@inmenu interval between speaking clock" +msgid "Never" +msgstr "कभी नहीं" + +#: clockapplet.cpp:383 +#, fuzzy +#| msgid "th minute" +msgctxt "@inmenu interval between speaking clock" +msgid "Every minute" +msgstr "वां मिनट" + +#: clockapplet.cpp:384 +msgctxt "@inmenu interval between speaking clock" +msgid "Every 2 minutes" +msgstr "" + +#: clockapplet.cpp:385 +msgctxt "@inmenu interval between speaking clock" +msgid "Every 5 minutes" +msgstr "" + +#: clockapplet.cpp:386 +msgctxt "@inmenu interval between speaking clock" +msgid "Every 10 minutes" +msgstr "" + +#: clockapplet.cpp:387 +msgctxt "@inmenu interval between speaking clock" +msgid "Every 15 minutes" +msgstr "" + +#: clockapplet.cpp:388 +msgctxt "@inmenu interval between speaking clock" +msgid "Every 30 minutes" +msgstr "" + +#: clockapplet.cpp:389 +#, fuzzy +#| msgid "Every " +msgctxt "@inmenu interval between speaking clock" +msgid "Every hour" +msgstr "हर" + +#: clockapplet.cpp:409 +msgid "Time Zones" +msgstr "समय क्षेत्र" + +#: clockapplet.cpp:543 +msgid "C&opy to Clipboard" +msgstr "क्लिपबोर्ड पर नकल (&o)" + +#: clockapplet.cpp:551 +#, fuzzy +#| msgid "Adjust Date and Time" +msgid "Adjust Date and Time..." +msgstr "दिनांक व समय बदलें" + +#: clockapplet.cpp:690 +msgctxt "Local time zone" +msgid "Local" +msgstr "स्थानीय" + +#: clockapplet.cpp:739 +#, fuzzy +#| msgid "Calendar" +msgctxt "@item:inmenu Submenu for alternative calendar dates" +msgid "Other Calendars" +msgstr "कैलेन्डर" + +#. i18n: ectx: property (text), widget (QLabel, label_4) +#: generalConfig.ui:23 +msgid "Text to Speech" +msgstr "पाठ से ध्वनि" + +#. i18n: ectx: property (text), widget (QLabel, label_5) +#: generalConfig.ui:46 +msgid "Speak time:" +msgstr "बोलने का समय:" + +#. i18n: ectx: property (clickMessage), widget (KTreeWidgetSearchLine, searchLine) +#: timezonesConfig.ui:20 +msgid "Search" +msgstr "ढूंढें" + +#. i18n: ectx: property (toolTip), widget (KTimeZoneWidget, timeZones) +#: timezonesConfig.ui:33 +msgid "Select one or several time zones." +msgstr "एक या अनेक समय क्षेत्र चुनें" + +#. i18n: ectx: property (whatsThis), widget (KTimeZoneWidget, timeZones) +#: timezonesConfig.ui:43 +msgid "" +"<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.0//EN\" \"http://www.w3.org/TR/" +"REC-html40/strict.dtd\">\n" +"<html><head><meta name=\"qrichtext\" content=\"1\" /><style type=\"text/css" +"\">\n" +"p, li { white-space: pre-wrap; }\n" +"</style></head><body style=\" font-family:'Sans Serif'; font-size:10pt; font-" +"weight:400; font-style:normal;\">\n" +"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-" +"right:0px; -qt-block-indent:0; text-indent:0px;\">Your <span style=\" font-" +"weight:600;\">Local</span> time and time zone are defined in System " +"Settings, in the Date and Time tab. As default, your plasma clock will use " +"this setting.</p>\n" +"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-" +"right:0px; -qt-block-indent:0; text-indent:0px;\">The plasma clock tooltip " +"can display the time in several other time zones: to do so, select one or " +"several more time zones in the list. Click on a line to select it and click " +"on it again to deselect it. </p>\n" +"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-" +"right:0px; -qt-block-indent:0; text-indent:0px;\">After you validate your " +"choices with the OK button, when your mouse is over the clock, a tooltip " +"will display the time in all the selected time zones.</p>\n" +"<p style=\" margin-top:0px; margin-bottom:0px; margin-left:0px; margin-" +"right:0px; -qt-block-indent:0; text-indent:0px;\">To select a <span style=\" " +"font-weight:600;\">Default</span> time zone: you can either scroll over the " +"clock with your mouse wheel and set the one you want or you can set it with " +"\"Clock defaults to:\". .</p></body></html>" +msgstr "" + +#. i18n: ectx: property (text), widget (QLabel, label) +#: timezonesConfig.ui:73 +msgid "Clock defaults to:" +msgstr "घडी तयशुदा होगी इसपे:" + +#. i18n: ectx: property (toolTip), widget (QComboBox, clockDefaultsTo) +#: timezonesConfig.ui:89 +msgid "The time the clock will display" +msgstr "घडी जो समय दिखाएगा" + +#. i18n: ectx: property (whatsThis), widget (QComboBox, clockDefaultsTo) +#: timezonesConfig.ui:93 +msgid "" +"The clock will display the time for the selected default zone.\n" +"Local is the time you set in System Settings." +msgstr "" +"घडी चयनित तयशुदा क्षेत्र का समय दिखाएगा\n" +"स्थानिक समय तंत्र सेटिंग में सेट करें" + +#~ msgid "Today" +#~ msgstr "आज" + +#~ msgid "Do not show holidays" +#~ msgstr "छुट्टियाँ नही दिखाएँ" + +#~ msgid "Starting KTTSD Failed" +#~ msgstr "केटीटीएसडी प्रारंभ करना असफल" + +#~ msgid "Area" +#~ msgstr "क्षेत्र" + +#~ msgid "Region" +#~ msgstr "क्षेत्र" + +#~ msgid "Comment" +#~ msgstr "टिप्पणी" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/libtaskmanager.po kde-l10n-hi-4.13.0/messages/kde-workspace/libtaskmanager.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/libtaskmanager.po 2014-03-19 06:15:59.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/libtaskmanager.po 2014-03-13 07:16:13.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: libtaskmanager\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-19 04:21+0000\n" +"POT-Creation-Date: 2014-03-13 06:11+0000\n" "PO-Revision-Date: 2007-11-01 14:02+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -18,16 +18,16 @@ "X-Generator: KBabel 1.11.4\n" "Plural-Forms: nplurals=2; plural=(n!=1);\n" -#: launcherconfig.cpp:45 +#: launcherconfig.cpp:44 msgid "Launcher Matching Rules" msgstr "" -#: launcherconfig.cpp:145 +#: launcherconfig.cpp:144 #, kde-format msgid "A launcher is already defined for %1" msgstr "" -#: launcherconfig.cpp:202 +#: launcherconfig.cpp:201 msgid "" "To associate an application with a launcher, the task manager reads the " "application's window class and name. These are then used to look up the " @@ -51,17 +51,17 @@ msgid "Launcher" msgstr "" -#. i18n: ectx: property (text), widget (QPushButton, add) +#. i18n: ectx: property (text), widget (KPushButton, add) #: launcherconfig.ui:57 msgid "Add" msgstr "" -#. i18n: ectx: property (text), widget (QPushButton, edit) +#. i18n: ectx: property (text), widget (KPushButton, edit) #: launcherconfig.ui:64 msgid "Edit" msgstr "" -#. i18n: ectx: property (text), widget (QPushButton, remove) +#. i18n: ectx: property (text), widget (KPushButton, remove) #: launcherconfig.ui:71 msgid "Remove" msgstr "" @@ -83,7 +83,7 @@ msgid "Launcher Properties" msgstr "" -#: launcherproperties.cpp:104 +#: launcherproperties.cpp:96 msgid "Select launcher application:" msgstr "" @@ -97,7 +97,7 @@ msgid "Window name:" msgstr "" -#. i18n: ectx: property (text), widget (QPushButton, detect) +#. i18n: ectx: property (text), widget (KPushButton, detect) #: launcherproperties.ui:37 msgid "Detect Window Properties" msgstr "" @@ -107,108 +107,114 @@ msgid "Launcher:" msgstr "" -#: strategies/manualgroupingstrategy.cpp:76 +#: strategies/manualgroupingstrategy.cpp:77 msgid "Leave Group" msgstr "" -#: strategies/manualgroupingstrategy.cpp:83 +#: strategies/manualgroupingstrategy.cpp:84 msgid "Remove Group" msgstr "" -#: strategies/programgroupingstrategy.cpp:75 +#: strategies/programgroupingstrategy.cpp:76 msgid "Allow this program to be grouped" msgstr "" -#: strategies/programgroupingstrategy.cpp:77 +#: strategies/programgroupingstrategy.cpp:78 msgid "Do not allow this program to be grouped" msgstr "" -#: task.cpp:256 +#: task.cpp:257 #, fuzzy #| msgid "modified" msgctxt "marks that a task has been modified" msgid "modified" msgstr "परिवर्धित" -#: taskactions.cpp:171 +#: taskactions.cpp:174 msgid "Mi&nimize" msgstr "न्यूनतम करें (&n)" -#: taskactions.cpp:182 +#: taskactions.cpp:185 msgid "Ma&ximize" msgstr "अधिकतम करें (&x)" -#: taskactions.cpp:192 +#: taskactions.cpp:195 msgid "&Shade" msgstr "छाया (&S)" -#: taskactions.cpp:202 +#: taskactions.cpp:205 msgid "Re&size" msgstr "नया आकार (&s)" -#: taskactions.cpp:210 +#: taskactions.cpp:213 msgid "&Move" msgstr "खिसकाएँ (&M) " -#: taskactions.cpp:219 +#: taskactions.cpp:222 msgid "&Close" msgstr "बंद करें (&C)" -#: taskactions.cpp:252 +#: taskactions.cpp:255 #, fuzzy #| msgid "&To Current Desktop" msgid "Move &To Current Desktop" msgstr "मौज़ूदा डेस्कटॉप पर (&T)" -#: taskactions.cpp:273 +#: taskactions.cpp:276 msgid "&All Desktops" msgstr "सभी डेस्कटॉप (&A)" -#: taskactions.cpp:320 +#: taskactions.cpp:299 +#, fuzzy +#| msgid "&All Desktops" +msgid "&New Desktop" +msgstr "सभी डेस्कटॉप (&A)" + +#: taskactions.cpp:323 #, fuzzy #| msgid "To &Desktop" msgid "Move To &Desktop" msgstr "डेस्कटॉप पर (&D)" -#: taskactions.cpp:340 +#: taskactions.cpp:343 msgid "Keep &Above Others" msgstr "अन्यों के ऊपर रखें (&A)" -#: taskactions.cpp:350 +#: taskactions.cpp:353 msgid "Keep &Below Others" msgstr "अन्यों के नीचे रखें (&B)" -#: taskactions.cpp:360 +#: taskactions.cpp:363 msgid "&Fullscreen" msgstr "संपूर्ण स्क्रीन (&F)" -#: taskactions.cpp:370 +#: taskactions.cpp:373 msgid "More Actions" msgstr "" -#: taskactions.cpp:397 +#: taskactions.cpp:400 msgid "&Leave Group" msgstr "" -#: taskactions.cpp:425 +#: taskactions.cpp:428 msgid "Remove This Launcher" msgstr "" -#: taskactions.cpp:446 +#: taskactions.cpp:449 msgid "&Show A Launcher When Not Running" msgstr "" -#: taskactions.cpp:479 +#: taskactions.cpp:482 msgid "" "The application, to which this task is associated with, could not be " "determined. Please select the appropriate application from the list below:" msgstr "" -#: taskactions.cpp:526 +#: taskactions.cpp:529 msgid "Start New Instance" msgstr "" -#: taskactions.cpp:550 +#: taskactions.cpp:553 msgid "&Edit Group" msgstr "" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_battery.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_battery.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_battery.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_battery.po 2014-03-27 07:22:19.000000000 +0000 @@ -0,0 +1,307 @@ +# translation of plasma_applet_battery.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007. +# Rajesh Ranjan <rranjan@redhat.com>, 2008. +msgid "" +msgstr "" +"Project-Id-Version: plasma_applet_battery\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2014-03-27 06:16+0000\n" +"PO-Revision-Date: 2008-12-04 13:16+0530\n" +"Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" + +#: contents/code/logic.js:99 +#, fuzzy +#| msgctxt "Shown when a time estimate is not available" +#| msgid "<b>Battery:</b> %1% (discharging)<br />" +msgid "Not Charging" +msgstr "<b> बैटरी</b> %1% (चार्ज कम हो रहा है)<br />" + +#: contents/code/logic.js:100 +#, fuzzy +#| msgctxt "Shown when a time estimate is not available" +#| msgid "<b>Battery:</b> %1% (discharging)<br />" +msgid "Discharging" +msgstr "<b> बैटरी</b> %1% (चार्ज कम हो रहा है)<br />" + +#: contents/code/logic.js:101 +#, fuzzy +#| msgid "<b>Battery:</b> %1% (fully charged)<br />" +msgid "Fully Charged" +msgstr "<b>बैटरी:</b> %1% (पूरी तरह से चार्ज)<br />" + +#: contents/code/logic.js:102 +#, fuzzy +#| msgctxt "Shown when a time estimate is not available" +#| msgid "<b>Battery:</b> %1% (discharging)<br />" +msgid "Charging" +msgstr "<b> बैटरी</b> %1% (चार्ज कम हो रहा है)<br />" + +#: contents/code/logic.js:105 +msgctxt "Battery is currently not present in the bay" +msgid "Not present" +msgstr "" + +#: contents/code/logic.js:154 +msgid "No batteries available" +msgstr "" + +#: contents/code/logic.js:163 +#, kde-format +msgctxt "Placeholder is battery name" +msgid "%1:" +msgstr "" + +#: contents/code/logic.js:166 contents/ui/BatteryItem.qml:184 +#, kde-format +msgctxt "Placeholder is battery percentage" +msgid "%1%" +msgstr "" + +#: contents/code/logic.js:168 +msgid "N/A" +msgstr "" + +#: contents/code/logic.js:189 +#, fuzzy +#| msgid "Power Management" +msgid "Power management is disabled" +msgstr "शक्ति प्रबंधन" + +#: contents/ui/BatteryItem.qml:229 +msgid "Time To Full:" +msgstr "" + +#: contents/ui/BatteryItem.qml:229 +msgid "Time To Empty:" +msgstr "" + +#: contents/ui/BatteryItem.qml:241 +msgid "Capacity:" +msgstr "" + +#: contents/ui/BatteryItem.qml:253 +msgid "Vendor:" +msgstr "" + +#: contents/ui/BatteryItem.qml:265 +msgid "Model:" +msgstr "" + +#: contents/ui/BatteryItem.qml:289 +#, kde-format +msgctxt "Placeholder is battery capacity" +msgid "%1%" +msgstr "" + +#: contents/ui/batterymonitor.qml:165 +msgid "The battery applet has enabled system-wide inhibition" +msgstr "" + +#: contents/ui/BrightnessItem.qml:88 +#, kde-format +msgctxt "Placeholder is brightness percentage" +msgid "%1%" +msgstr "" + +#: contents/ui/CompactRepresentation.qml:92 +#, kde-format +msgctxt "battery percentage below battery icon" +msgid "%1%" +msgstr "" + +#: contents/ui/PopupDialog.qml:129 +#, fuzzy +#| msgid "Screen Brightness" +msgid "Display Brightness" +msgstr "स्क्रीन चमकीलापन" + +#: contents/ui/PopupDialog.qml:140 +#, fuzzy +#| msgid "Screen Brightness" +msgid "Keyboard Brightness" +msgstr "स्क्रीन चमकीलापन" + +#: contents/ui/PowerManagementItem.qml:56 +#, fuzzy +#| msgid "Power Management" +msgid "Enable Power Management" +msgstr "शक्ति प्रबंधन" + +#, fuzzy +#~| msgid "<b>AC Adapter:</b> Plugged in" +#~ msgid "AC Adapter" +#~ msgstr "<b> AC एडाप्टर </b> प्लग इन किया" + +#, fuzzy +#~| msgid "<b>AC Adapter:</b> Not plugged in" +#~ msgid "Plugged In" +#~ msgstr "<b> AC एडाप्टर: </b> प्लगिन नहीं" + +#, fuzzy +#~| msgid "<b>AC Adapter:</b> Not plugged in" +#~ msgid "Not Plugged In" +#~ msgstr "<b> AC एडाप्टर: </b> प्लगिन नहीं" + +#, fuzzy +#~| msgid "Time remaining: <b>%1</b><br />" +#~ msgid "Time remaining until full: %1" +#~ msgstr "शेष समय: <b>%1</b><br />" + +#, fuzzy +#~| msgid "Time remaining: <b>%1</b><br />" +#~ msgid "Time remaining until empty: %1" +#~ msgstr "शेष समय: <b>%1</b><br />" + +#, fuzzy +#~| msgid "<b>Battery:</b> %1% (fully charged)<br />" +#~ msgid "%1% (charged)" +#~ msgstr "<b>बैटरी:</b> %1% (पूरी तरह से चार्ज)<br />" + +#, fuzzy +#~| msgid "<b>AC Adapter:</b> Plugged in" +#~ msgctxt "tooltip" +#~ msgid "AC Adapter:" +#~ msgstr "<b> AC एडाप्टर </b> प्लग इन किया" + +#, fuzzy +#~| msgid "<b>AC Adapter:</b> Not plugged in" +#~ msgctxt "tooltip" +#~ msgid "<b>Not plugged in</b>" +#~ msgstr "<b> AC एडाप्टर: </b> प्लगिन नहीं" + +#~ msgid "Configure Battery Monitor" +#~ msgstr "बैटरी मॉनीटर कॉन्फ़िगर करें " + +#, fuzzy +#~| msgid "Screen Brightness" +#~ msgid "Screen Brightness:" +#~ msgstr "स्क्रीन चमकीलापन" + +#, fuzzy +#~| msgid "Sleep" +#~ msgctxt "Suspend the computer to RAM; translation should be short" +#~ msgid "Sleep" +#~ msgstr "स्लीप" + +#, fuzzy +#~| msgid "Hibernate" +#~ msgctxt "Suspend the computer to disk; translation should be short" +#~ msgid "Hibernate" +#~ msgstr "सुप्तावस्था" + +#, fuzzy +#~| msgid "<b>Battery:</b> %1% (fully charged)<br />" +#~ msgid "<b>%1% (charged)</b>" +#~ msgstr "<b>बैटरी:</b> %1% (पूरी तरह से चार्ज)<br />" + +#, fuzzy +#~| msgctxt "Shown when a time estimate is not available" +#~| msgid "<b>Battery:</b> %1% (discharging)<br />" +#~ msgid "<b>%1% (discharging)</b>" +#~ msgstr "<b> बैटरी</b> %1% (चार्ज कम हो रहा है)<br />" + +#, fuzzy +#~| msgctxt "Shown when a time estimate is not available" +#~| msgid "<b>Battery:</b> %1% (discharging)<br />" +#~ msgid "<b>%1% (charging)</b>" +#~ msgstr "<b> बैटरी</b> %1% (चार्ज कम हो रहा है)<br />" + +#, fuzzy +#~| msgctxt "Battery is not plugged in" +#~| msgid "<b>Battery:</b> not present<br />" +#~ msgid "Battery:" +#~ msgstr "<b> बैटरी</b>मोजूद नहीं<br />" + +#, fuzzy +#~| msgctxt "Battery is not plugged in" +#~| msgid "<b>Battery:</b> not present<br />" +#~ msgctxt "tooltip: placeholder is the battery ID" +#~ msgid "Battery %1:" +#~ msgstr "<b> बैटरी</b>मोजूद नहीं<br />" + +#~ msgid "Show the state for &each battery present" +#~ msgstr "हर उपस्थित बैटरी के लिए स्थिति दिखाएँ (&e)" + +#, fuzzy +#~| msgctxt "Battery is not plugged in" +#~| msgid "<b>Battery:</b> not present<br />" +#~ msgctxt "Placeholder is the battery ID" +#~ msgid "Battery %1:" +#~ msgstr "<b> बैटरी</b>मोजूद नहीं<br />" + +#, fuzzy +#~| msgctxt "Battery is not plugged in" +#~| msgid "<b>Battery:</b> not present<br />" +#~ msgid "<b>Battery:</b>" +#~ msgstr "<b> बैटरी</b>मोजूद नहीं<br />" + +#, fuzzy +#~| msgid "<b>AC Adapter:</b> Plugged in" +#~ msgctxt "tooltip" +#~ msgid "<b>AC Adapter:</b>" +#~ msgstr "<b> AC एडाप्टर </b> प्लग इन किया" + +#, fuzzy +#~| msgid "Show the percentage of &charge on the battery" +#~ msgid "Show remaining time for the battery" +#~ msgstr "बैटरी के चार्ज का प्रतिशत दिखाएँ (&c)" + +#, fuzzy +#~| msgid "<b>Battery %1:</b> %2% (charging)<br />" +#~ msgctxt "tooltip: placeholder is the battery ID" +#~ msgid "<b>Battery %1:</b>" +#~ msgstr "<b>बैटरी %1:</b> %2% (चार्ज कर रहा है)<br />" + +#~ msgid "General" +#~ msgstr "सामान्य" + +#, fuzzy +#~| msgid "Power Profile" +#~ msgid "Power Profile:" +#~ msgstr "पावर प्रोफाइल" + +#, fuzzy +#~| msgid "<b>AC Adapter:</b> Plugged in" +#~ msgid "AC Adapter: " +#~ msgstr "<b> AC एडाप्टर </b> प्लग इन किया" + +#, fuzzy +#~| msgctxt "Battery is not plugged in" +#~| msgid "<b>Battery:</b> not present<br />" +#~ msgid "<b>Battery:</b> " +#~ msgstr "<b> बैटरी</b>मोजूद नहीं<br />" + +#, fuzzy +#~| msgctxt "Shown when a time estimate is not available" +#~| msgid "<b>Battery:</b> %1% (discharging)<br />" +#~ msgctxt "state of battery" +#~ msgid "%1% (discharging)" +#~ msgstr "<b> बैटरी</b> %1% (चार्ज कम हो रहा है)<br />" + +#, fuzzy +#~| msgid "More..." +#~ msgid "Configure..." +#~ msgstr "ज्यादा..." + +#~ msgid "Actions" +#~ msgstr "क्रियाएं" + +#~ msgid "<b>Battery:</b> %1% (charging)<br />" +#~ msgstr "<b> बैटरी</b> %1% (चार्ज कर रहा है) <br />" + +#~ msgid "<b>Battery %1:</b> %2% (fully charged)<br />" +#~ msgstr "<b>बैटरी %1:</b> %2% (पूरा चार्ज)<br />" + +#~ msgid "<b>Battery %1:</b> %2% (discharging)<br />" +#~ msgstr "<b>बैटरी %1:</b> %2% (चार्ज कम हो रहा है)<br />" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_clock.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_clock.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_clock.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_clock.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,58 @@ +# translation of plasma_applet_clock.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007. +# Rajesh Ranjan <rranjan@redhat.com>, 2008. +msgid "" +msgstr "" +"Project-Id-Version: plasma_applet_clock\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2008-12-04 13:18+0530\n" +"Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" + +#: clock.cpp:179 +msgid "Appearance" +msgstr "" + +#. i18n: ectx: property (toolTip), widget (QCheckBox, showSecondHandCheckBox) +#: clockConfig.ui:22 +msgid "Show the seconds" +msgstr "सेकेंड दिखाएँ" + +#. i18n: ectx: property (whatsThis), widget (QCheckBox, showSecondHandCheckBox) +#: clockConfig.ui:25 +msgid "Check this if you want to show the seconds." +msgstr "जाँचें यदि आप सेकेंड दिखाना चाहते हैं" + +#. i18n: ectx: property (text), widget (QCheckBox, showSecondHandCheckBox) +#: clockConfig.ui:28 +msgid "Show &seconds hand" +msgstr "सेकण्ड सुई दिखाएँ (&s)" + +#. i18n: ectx: property (toolTip), widget (QCheckBox, showTimezoneStringCheckBox) +#: clockConfig.ui:35 +msgid "Show the Timezone in text" +msgstr "समयक्षेत्र को पाठ के रूप में दिखाएँ" + +#. i18n: ectx: property (whatsThis), widget (QCheckBox, showTimezoneStringCheckBox) +#: clockConfig.ui:38 +msgid "Check this if you want to display Timezone in text." +msgstr "इसे जाँचें यदि आप समयक्षेत्र को पाठ रूप में दिखाना चाहते हैं." + +#. i18n: ectx: property (text), widget (QCheckBox, showTimezoneStringCheckBox) +#: clockConfig.ui:41 +msgid "Show &time zone" +msgstr "समयक्षेत्र दिखाएँ (&t)" + +#~ msgid "General" +#~ msgstr "सामान्य" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_dig_clock.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_dig_clock.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_dig_clock.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_dig_clock.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,265 @@ +# translation of plasma_applet_dig_clock.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007, 2008. +# Rajesh Ranjan <rranjan@redhat.com>, 2008. +msgid "" +msgstr "" +"Project-Id-Version: plasma_applet_dig_clock\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2008-12-04 13:26+0530\n" +"Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" + +#: clock.cpp:263 +msgid "Appearance" +msgstr "" + +#: clock.cpp:278 +#, fuzzy +#| msgid "Show date:" +msgctxt "A kind of date representation" +msgid "No date" +msgstr "दिखाएँ तारीख़:" + +#: clock.cpp:279 +msgctxt "A kind of date representation" +msgid "Compact date" +msgstr "" + +#: clock.cpp:280 +#, fuzzy +#| msgid "Show date:" +msgctxt "A kind of date representation" +msgid "Short date" +msgstr "दिखाएँ तारीख़:" + +#: clock.cpp:281 +#, fuzzy +#| msgid "Show date:" +msgctxt "A kind of date representation" +msgid "Long date" +msgstr "दिखाएँ तारीख़:" + +#: clock.cpp:282 +#, fuzzy +#| msgid "Show date:" +msgctxt "A kind of date representation" +msgid "ISO date" +msgstr "दिखाएँ तारीख़:" + +#: clock.cpp:476 +#, fuzzy, kde-format +#| msgctxt "@label Short date: %1 day in the month, %2 short month name" +#| msgid "%1 %2" +msgctxt "@label Compact date: %1 day in the month, %2 month number" +msgid "%1/%2" +msgstr "%1 %2" + +#: clock.cpp:491 +#, kde-format +msgctxt "" +"@label Date with currentTimezone: %1 day of the week with date, %2 " +"currentTimezone" +msgid "%1 %2" +msgstr "%1 %2" + +#. i18n: ectx: property (text), widget (QLabel, label_6) +#: clockConfig.ui:26 +msgid "Font" +msgstr "फ़ॉन्ट" + +#. i18n: ectx: property (text), widget (QLabel, label) +#: clockConfig.ui:33 +msgid "Font style:" +msgstr "फ़ॉन्ट शैली:" + +#. i18n: ectx: property (toolTip), widget (QCheckBox, plainClockFontBold) +#: clockConfig.ui:69 +msgid "Check if you want the font in bold" +msgstr "जाँचें यदि आप फान्ट को बोल्ड रखना चाहते हैं" + +#. i18n: ectx: property (whatsThis), widget (QCheckBox, plainClockFontBold) +#: clockConfig.ui:72 +msgid "When this is checked, the clock font will be bold." +msgstr "इसके जाँचे जाने पर क्लॉक फ़ॉन्ट गहरा हो जाएगा." + +#. i18n: ectx: property (text), widget (QCheckBox, plainClockFontBold) +#: clockConfig.ui:75 +msgid "&Bold" +msgstr "गाढ़ा (&B)" + +#. i18n: ectx: property (toolTip), widget (QCheckBox, plainClockFontItalic) +#: clockConfig.ui:82 +msgid "Check if you want the font in italic" +msgstr "जाँचें यदि आप फ़ॉन्ट तिरछा रखना चाहते हैं" + +#. i18n: ectx: property (whatsThis), widget (QCheckBox, plainClockFontItalic) +#: clockConfig.ui:85 +msgid "When this is checked, the clock font will be in italic." +msgstr "इसके जाँचे जाने पर क्लॉक फ़ॉन्ट तिरछा हो जाएगा." + +#. i18n: ectx: property (text), widget (QCheckBox, plainClockFontItalic) +#: clockConfig.ui:88 +msgid "&Italic" +msgstr "तिरछा (&I)" + +#. i18n: ectx: property (text), widget (QLabel, label_2) +#: clockConfig.ui:111 +#, fuzzy +#| msgid "Font color:" +msgid "Custom font color:" +msgstr "फ़ॉन्ट रंग:" + +#. i18n: ectx: property (toolTip), widget (KColorButton, plainClockColor) +#: clockConfig.ui:136 +msgid "Color chooser" +msgstr "रंग चयनक" + +#. i18n: ectx: property (whatsThis), widget (KColorButton, plainClockColor) +#: clockConfig.ui:139 +msgid "" +"Click on this button and the KDE standard color dialog will show. You can " +"then choose the new color you want for your clock." +msgstr "" +"इस बटन पर क्लिक करें और KDE मानक रंग संवाद दिखेगा. आप तब नया रंग चुन सकते हैं जो आप अपने " +"क्लॉक के लिए चाहते हैं." + +#. i18n: ectx: property (text), widget (QLabel, label_9) +#: clockConfig.ui:161 +#, fuzzy +#| msgid "Show seconds:" +msgid "Show shadow:" +msgstr "दिखाएँ सेकण्ड:" + +#. i18n: ectx: property (text), widget (QLabel, customShadowColorLabel) +#: clockConfig.ui:198 +#, fuzzy +#| msgid "Use custom color" +msgid "Custom shadow color:" +msgstr "पसंदीदा रंग का प्रयोग करें" + +#. i18n: ectx: property (toolTip), widget (KColorButton, plainClockShadowColor) +#: clockConfig.ui:216 +#, fuzzy +#| msgid "Color chooser" +msgid "Shadow color chooser" +msgstr "रंग चयनक" + +#. i18n: ectx: property (whatsThis), widget (KColorButton, plainClockShadowColor) +#: clockConfig.ui:219 +#, fuzzy +#| msgid "" +#| "Click on this button and the KDE standard color dialog will show. You can " +#| "then choose the new color you want for your clock." +msgid "" +"Click on this button and the KDE standard color dialog will show. You can " +"then choose the new color you want for the text shadow for your clock." +msgstr "" +"इस बटन पर क्लिक करें और KDE मानक रंग संवाद दिखेगा. आप तब नया रंग चुन सकते हैं जो आप अपने " +"क्लॉक के लिए चाहते हैं." + +#. i18n: ectx: property (text), widget (QLabel, label_7) +#: clockConfig.ui:257 +msgid "Information" +msgstr "जानकारी" + +#. i18n: ectx: property (text), widget (QLabel, label_4) +#: clockConfig.ui:264 +msgid "Show time zone:" +msgstr "दिखाएँ समय क्षेत्र:" + +#. i18n: ectx: property (toolTip), widget (QCheckBox, showTimeZone) +#: clockConfig.ui:279 +msgid "Display the time zone name" +msgstr "समय क्षेत्र नाम दिखाएँ" + +#. i18n: ectx: property (whatsThis), widget (QCheckBox, showTimeZone) +#: clockConfig.ui:282 +msgid "Display the time zone name under the time." +msgstr "समय के अंतर्गत समय क्षेत्र नाम दिखाएँ." + +#. i18n: ectx: property (text), widget (QLabel, label_5) +#: clockConfig.ui:307 +msgid "Show seconds:" +msgstr "दिखाएँ सेकण्ड:" + +#. i18n: ectx: property (toolTip), widget (QCheckBox, secondsCheckbox) +#: clockConfig.ui:322 +msgid "Show the seconds" +msgstr "सेकेंड दिखाएँ" + +#. i18n: ectx: property (whatsThis), widget (QCheckBox, secondsCheckbox) +#: clockConfig.ui:325 +msgid "Check this if you want to show the seconds." +msgstr "जाँचें यदि आप सेकेंड दिखाना चाहते हैं" + +#. i18n: ectx: property (text), widget (QLabel, label_3) +#: clockConfig.ui:350 +msgid "Date format:" +msgstr "" + +#~ msgctxt "" +#~ "@label Short date: %1 day in the month, %2 short month name, %3 year" +#~ msgid "%1 %2 %3" +#~ msgstr "%1 %2 %3" + +#~ msgctxt "@label Day of the week with date: %1 short day name, %2 short date" +#~ msgid "%1, %2" +#~ msgstr "%1, %2" + +#~ msgid "Display the date of the day" +#~ msgstr "दिन का तिथि दिखाएँ" + +#, fuzzy +#~| msgid "Show day of the &week" +#~ msgid "Include the day of the week:" +#~ msgstr "सप्ताह का दिन दिखाएँ (&w)" + +#~ msgid "Display day of the week" +#~ msgstr "सप्ताह का दिन दिखाएँ" + +#~ msgid "Add the day of the week to the date display." +#~ msgstr "तिथि प्रदर्शन में सप्ताह का दिन जोड़ें." + +#~ msgid "Display the current year" +#~ msgstr "मौजूदा साल को दिखाएँ" + +#~ msgid "Add the year to the date string." +#~ msgstr "तिथि स्ट्रिंग में साल जोड़ें." + +#~ msgid "Show &year" +#~ msgstr "वर्ष दिखाएँ (&y)" + +#~ msgid "Use current desktop theme color" +#~ msgstr "मौजूदा डेस्कटॉप प्रसंग रंग का प्रयोग करें" + +#~ msgid "" +#~ "This is default. The clock will get its font color from the current " +#~ "desktop theme." +#~ msgstr "यह मूलभूत है. क्लॉक अपना फ़ॉन्ट रंग को अपने मौजूदा डेस्कटॉप प्रसंग से पाएगा." + +#~ msgid "Use theme color" +#~ msgstr "प्रसंग रंग का प्रयोग करें" + +#~ msgid "Choose your own font color" +#~ msgstr "अपना फ़ॉन्ट रंग चुनें" + +#~ msgid "" +#~ "When checked you can choose a custom color for the clock font by clicking " +#~ "on the color widget on the right." +#~ msgstr "" +#~ "जब जाँचा जाता है आप पसंदीदा रंग चुन सकते हैं क्लॉक फ़ॉन्ट के लिए दाहिने ओर रंग विजेट पर " +#~ "क्लिक करके." + +#~ msgid "General" +#~ msgstr "सामान्य" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_icon.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_icon.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_icon.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_icon.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,48 @@ +# translation of plasma_applet_icon.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Rajesh Ranjan <rajesh672@gmail.com>, 2010. +msgid "" +msgstr "" +"Project-Id-Version: plasma_applet_icon\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2010-01-31 19:37+0530\n" +"Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" +"Language-Team: Hindi <indlinux>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" + +#: icon.cpp:334 +#, kde-format +msgid "%1 Icon Settings" +msgstr "%1 चिह्न सेटिंग" + +#: icon.cpp:501 +#, kde-format +msgctxt "@action:inmenu" +msgid "&Move Here\t<shortcut>%1</shortcut>" +msgstr "यहाँ खिसकाएँ (&M) \t<shortcut>%1</shortcut>" + +#: icon.cpp:507 +#, kde-format +msgctxt "@action:inmenu" +msgid "&Copy Here\t<shortcut>%1</shortcut>" +msgstr "यहाँ नक़ल करें (&C) \t<shortcut>%1</shortcut>" + +#: icon.cpp:513 +#, kde-format +msgctxt "@action:inmenu" +msgid "&Link Here\t<shortcut>%1</shortcut>" +msgstr "यहाँ कड़ी बनाएँ (&L) \t<shortcut>%1</shortcut>" + +#: icon.cpp:516 +msgctxt "@action:inmenu" +msgid "Cancel" +msgstr "रद्द करें" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_launcher.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_launcher.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_launcher.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_launcher.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,504 @@ +# translation of plasma_applet_launcher.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2008. +# Rajesh Ranjan <rranjan@redhat.com>, 2008. +msgid "" +msgstr "" +"Project-Id-Version: plasma_applet_launcher\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2008-12-04 13:50+0530\n" +"Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" + +msgctxt "NAME OF TRANSLATORS" +msgid "Your names" +msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर, राजेश रंजन" + +msgctxt "EMAIL OF TRANSLATORS" +msgid "Your emails" +msgstr "raviratlami@aol.in, rajesh@indlinux.in" + +#: applet/applet.cpp:84 +msgid "Kickoff Application Launcher" +msgstr "किकऑफ अनुप्रयोग लान्चर" + +#: applet/applet.cpp:85 +msgid "" +"Favorites, applications, computer places, recently used items and desktop " +"sessions" +msgstr "प्रिय अनुप्रयोग प्रयुक्त वस्तुएँ और" + +#: applet/applet.cpp:108 simpleapplet/simpleapplet.cpp:343 +#, fuzzy +#| msgid "Applications" +msgid "Edit Applications..." +msgstr "अनुप्रयोग" + +#: applet/applet.cpp:114 +msgid "Switch to Classic Menu Style" +msgstr "को क्लासिक मेन्यू शैली" + +#: applet/applet.cpp:159 +#, fuzzy +#| msgid "General" +msgctxt "General configuration page" +msgid "General" +msgstr "सामान्य" + +#. i18n: ectx: property (text), widget (QLabel, label_3) +#: applet/kickoffConfig.ui:27 +#, fuzzy +#| msgid "Known Applications" +msgid "Show applications by &name:" +msgstr "ज्ञात अनुप्रयोग" + +#. i18n: ectx: property (text), widget (QLabel, iconLabel) +#: applet/kickoffConfig.ui:73 +msgid "&Icon:" +msgstr "" + +#. i18n: ectx: property (text), widget (QLabel, label_2) +#: applet/kickoffConfig.ui:86 +#, fuzzy +#| msgid "Switch tabs on hover" +msgid "Switch &tabs on hover:" +msgstr "मंडराने पर टैब स्विच करें" + +#. i18n: ectx: property (text), widget (QLabel, label) +#: applet/kickoffConfig.ui:106 simpleapplet/simpleapplet.cpp:491 +#, fuzzy +#| msgid "Recently Used" +msgid "Show 'Recently Installed':" +msgstr "हाल ही में इस्तेमाल किए गए" + +#: core/applicationmodel.cpp:294 +#, fuzzy +#| msgid "Recently Used" +msgid "Recently Installed" +msgstr "हाल ही में इस्तेमाल किए गए" + +#: core/applicationmodel.cpp:384 +msgid "Games" +msgstr "" + +#: core/applicationmodel.cpp:478 ui/launcher.cpp:1056 +msgid "All Applications" +msgstr "सभी अनुप्रयोग" + +#: core/favoritesmodel.cpp:49 simpleapplet/simpleapplet.cpp:196 +#: ui/launcher.cpp:123 ui/launcher.cpp:193 +msgid "Favorites" +msgstr "पसंदीदा" + +#: core/favoritesmodel.cpp:322 +#, fuzzy +#| msgid "Favorites" +msgctxt "@title:column" +msgid "Favorites" +msgstr "पसंदीदा" + +#: core/leavemodel.cpp:50 simpleapplet/simpleapplet.cpp:213 +#, fuzzy +#| msgid "Logout" +msgid "Log out" +msgstr "लॉगआउट" + +#: core/leavemodel.cpp:52 +msgid "End session" +msgstr "सत्र समाप्त करें" + +#: core/leavemodel.cpp:54 +msgid "Lock" +msgstr "तालाबंद" + +#: core/leavemodel.cpp:56 +#, fuzzy +#| msgid "Lock the screen" +msgid "Lock screen" +msgstr "स्क्रीन पर ताला लगाएँ" + +#: core/leavemodel.cpp:58 +#, fuzzy +#| msgid "Switch User" +msgid "Switch user" +msgstr "उपयोक्ता स्विच करें" + +#: core/leavemodel.cpp:60 +msgid "Start a parallel session as a different user" +msgstr "एक भिन्न उपयोक्ता के रूप में समानान्तर सत्र प्रारंभ करें" + +#: core/leavemodel.cpp:62 simpleapplet/simpleapplet.cpp:212 +#, fuzzy +#| msgid "Shutdown" +msgid "Shut down" +msgstr "बन्दकरें" + +#: core/leavemodel.cpp:64 +#, fuzzy +#| msgid "Turn off the computer" +msgid "Turn off computer" +msgstr "कम्प्यूटर बन्द करें" + +#: core/leavemodel.cpp:66 +#, fuzzy +#| msgid "Restart" +msgctxt "Restart computer" +msgid "Restart" +msgstr "फिर से चालू करें" + +#: core/leavemodel.cpp:68 +#, fuzzy +#| msgid "Restart the computer" +msgid "Restart computer" +msgstr "कम्प्यूटर फिर से प्रारंभ करें" + +#: core/leavemodel.cpp:70 simpleapplet/simpleapplet.cpp:206 +msgid "Save Session" +msgstr "सहेजें सत्र" + +#: core/leavemodel.cpp:72 +msgid "Save current session for next login" +msgstr "सहेजें सत्र के लिये लॉगिन" + +#: core/leavemodel.cpp:74 simpleapplet/simpleapplet.cpp:208 +msgctxt "Puts the system on standby" +msgid "Standby" +msgstr "स्टैंडबाए" + +#: core/leavemodel.cpp:76 +msgid "Pause without logging out" +msgstr "ठहरें लॉगिंग बाहर" + +#: core/leavemodel.cpp:78 simpleapplet/simpleapplet.cpp:209 +msgid "Hibernate" +msgstr "" + +#: core/leavemodel.cpp:80 +#, fuzzy +#| msgid "Suspend to Disk" +msgid "Suspend to disk" +msgstr "स्थगित को डिस्क" + +#: core/leavemodel.cpp:82 simpleapplet/simpleapplet.cpp:210 +msgid "Sleep" +msgstr "" + +#: core/leavemodel.cpp:84 +msgid "Suspend to RAM" +msgstr "स्थगित को" + +#: core/leavemodel.cpp:107 simpleapplet/simpleapplet.cpp:214 +#: ui/launcher.cpp:181 +msgid "Leave" +msgstr "छोड़ें" + +#: core/leavemodel.cpp:119 +msgid "Session" +msgstr "सत्र" + +#: core/leavemodel.cpp:150 +msgid "System" +msgstr "तंत्र" + +#: core/models.cpp:121 +msgid "Home Folder" +msgstr "होम फ़ोल्डर" + +#: core/models.cpp:124 +msgid "Network Folders" +msgstr "नेटवर्क फोल्डर्स" + +#: core/recentlyusedmodel.cpp:109 +msgid "Documents" +msgstr "दस्तावेज़" + +#: core/recentlyusedmodel.cpp:120 core/systemmodel.cpp:74 +#: simpleapplet/simpleapplet.cpp:198 ui/launcher.cpp:125 ui/launcher.cpp:241 +msgid "Applications" +msgstr "अनुप्रयोग" + +#: core/recentlyusedmodel.cpp:186 simpleapplet/simpleapplet.cpp:200 +#: ui/launcher.cpp:126 ui/launcher.cpp:254 +msgid "Recently Used" +msgstr "हाल ही में इस्तेमाल किए गए" + +#: core/recentlyusedmodel.cpp:188 simpleapplet/simpleapplet.cpp:202 +#, fuzzy +#| msgid "Recently Used" +msgid "Recently Used Documents" +msgstr "हाल ही में इस्तेमाल किए गए" + +#: core/recentlyusedmodel.cpp:190 simpleapplet/simpleapplet.cpp:201 +#, fuzzy +#| msgid "Clear Recent Applications" +msgid "Recently Used Applications" +msgstr "हाल ही के अनुप्रयोग साफ करें" + +#: core/systemmodel.cpp:75 +msgid "Places" +msgstr "स्थान" + +#: core/systemmodel.cpp:76 +msgid "Removable Storage" +msgstr "हटाया जा सकने वाला भंडार" + +#: core/systemmodel.cpp:77 +msgid "Storage" +msgstr "भंडारण" + +#: core/systemmodel.cpp:207 simpleapplet/simpleapplet.cpp:204 +msgid "Run Command..." +msgstr "" + +#: core/systemmodel.cpp:211 +msgid "Run a command or a search query" +msgstr "" + +#: core/systemmodel.cpp:319 simpleapplet/simpleapplet.cpp:199 +#: ui/launcher.cpp:125 ui/launcher.cpp:275 +msgid "Computer" +msgstr "कम्प्यूटर" + +#: main.cpp:32 +msgid "Kickoff" +msgstr "किकऑफ" + +#: main.cpp:33 +msgid "Application Launcher" +msgstr "अनुप्रयोग चालक" + +#: simpleapplet/simpleapplet.cpp:197 +#, fuzzy +#| msgctxt "@item:inlistbox View:" +#| msgid "Bookmarks" +msgid "Bookmarks" +msgstr " पसंदीदा " + +#: simpleapplet/simpleapplet.cpp:203 +msgid "System Settings" +msgstr "" + +#: simpleapplet/simpleapplet.cpp:205 +msgid "Switch User" +msgstr "उपयोक्ता स्विच करें" + +#: simpleapplet/simpleapplet.cpp:207 +#, fuzzy +#| msgid "Lock the screen" +msgid "Lock Screen" +msgstr "स्क्रीन पर ताला लगाएँ" + +#: simpleapplet/simpleapplet.cpp:211 +#, fuzzy +#| msgid "Restart" +msgctxt "Restart Computer" +msgid "Restart" +msgstr "फिर से चालू करें" + +#: simpleapplet/simpleapplet.cpp:270 +#, fuzzy +#| msgid "Application Launcher" +msgid "Application Launcher Menu" +msgstr "अनुप्रयोग चालक" + +#: simpleapplet/simpleapplet.cpp:349 +#, fuzzy +#| msgid "Kickoff Application Launcher" +msgid "Switch to Application Launcher Style" +msgstr "किकऑफ अनुप्रयोग लान्चर" + +#: simpleapplet/simpleapplet.cpp:448 +#, fuzzy +#| msgctxt "" +#| "@label:listbox Which category of items to view in a KMenu-like menu" +#| msgid "View:" +msgid "View" +msgstr "देखें:" + +#: simpleapplet/simpleapplet.cpp:455 +msgid "Icon:" +msgstr "" + +#: simpleapplet/simpleapplet.cpp:462 +msgctxt "@label:listbox How to present applications in a KMenu-like menu" +msgid "Format:" +msgstr "फॉर्मेटः" + +#: simpleapplet/simpleapplet.cpp:466 +msgctxt "@item:inlistbox Format:" +msgid "Name Only" +msgstr "नाम सिर्फ" + +#: simpleapplet/simpleapplet.cpp:467 +msgctxt "@item:inlistbox Format:" +msgid "Description Only" +msgstr "वर्णन सिर्फ" + +#: simpleapplet/simpleapplet.cpp:468 +#, fuzzy +#| msgctxt "@item:inlistbox Format:" +#| msgid "Name Description" +msgctxt "@item:inlistbox Format:" +msgid "Name (Description)" +msgstr "नाम वर्णन" + +#: simpleapplet/simpleapplet.cpp:469 +msgctxt "@item:inlistbox Format:" +msgid "Description (Name)" +msgstr "वर्णन नाम" + +#: simpleapplet/simpleapplet.cpp:470 +msgctxt "@item:inlistbox Format:" +msgid "Name - Description" +msgstr "नाम वर्णन" + +#: simpleapplet/simpleapplet.cpp:475 +#, fuzzy +#| msgid "Clear Recent Applications" +msgid "Recently used applications:" +msgstr "हाल ही के अनुप्रयोग साफ करें" + +#: simpleapplet/simpleapplet.cpp:485 +msgid "Show menu titles:" +msgstr "" + +#: simpleapplet/simpleapplet.cpp:498 +#, fuzzy +#| msgid "Applications" +msgid "Options" +msgstr "अनुप्रयोग" + +#: simpleapplet/simpleapplet.cpp:644 +#, fuzzy +#| msgid "Applications" +msgid "Actions" +msgstr "अनुप्रयोग" + +#: ui/contextmenufactory.cpp:85 +msgid "Advanced" +msgstr "विस्तृत" + +#: ui/contextmenufactory.cpp:178 +msgid "Remove From Favorites" +msgstr "पसंदीदा से मिटाएँ" + +#: ui/contextmenufactory.cpp:183 +msgid "Add to Favorites" +msgstr "पसंदीदा में जोड़ें" + +#: ui/contextmenufactory.cpp:215 +msgid "Add to Desktop" +msgstr "डेस्कटॉप में जोड़ें" + +#: ui/contextmenufactory.cpp:223 +msgid "Add to Panel" +msgstr "फलक में जोड़ें" + +#: ui/contextmenufactory.cpp:236 +msgid "Uninstall" +msgstr "" + +#: ui/contextmenufactory.cpp:261 +msgid "Eject" +msgstr "बाहर करें" + +#: ui/contextmenufactory.cpp:263 +msgid "Safely Remove" +msgstr "हटाएँ" + +#: ui/launcher.cpp:196 +msgid "Sort Alphabetically (A to Z)" +msgstr "सोर्ट वर्णक्रम में A को Z" + +#: ui/launcher.cpp:199 +msgid "Sort Alphabetically (Z to A)" +msgstr "सोर्ट वर्णक्रम में Z को A" + +#: ui/launcher.cpp:256 +msgid "Clear Recent Applications" +msgstr "हाल ही के अनुप्रयोग साफ करें" + +#: ui/launcher.cpp:257 +msgid "Clear Recent Documents" +msgstr "हाल ही के दस्तावेज़ साफ करें" + +#: ui/launcher.cpp:565 +#, kde-format +msgctxt "login name, hostname" +msgid "User <b>%1</b> on <b>%2</b>" +msgstr "उपयोक्ता<b>%1</b> पर<b>%2</b>" + +#: ui/launcher.cpp:567 +#, kde-format +msgctxt "full name, login name, hostname" +msgid "<b>%1 (%2)</b> on <b>%3</b>" +msgstr "<b>%1 (%2)</b> पर<b>%3</b>" + +#: ui/searchbar.cpp:70 +#, fuzzy +#| msgid "Search:" +msgctxt "Label of the search bar textedit" +msgid "Search:" +msgstr "ढूंढें:" + +#~ msgid "Switch to Kickoff Menu Style" +#~ msgstr "को किकऑफ मेन्यू शैली" + +#~ msgid "Menu Editor" +#~ msgstr "मेन्यू संपादक" + +#~ msgid "Web Searches" +#~ msgstr "जाल स्थल में खोज" + +#~ msgid "Search web for '%1'" +#~ msgstr "'%1' के लिए जालस्थल में ढूंढें" + +#~ msgid "Lock the screen" +#~ msgstr "स्क्रीन पर ताला लगाएँ" + +#~ msgid "Known Applications" +#~ msgstr "ज्ञात अनुप्रयोग" + +#, fuzzy +#~| msgid "Application Launcher" +#~ msgid "Classic Application Launcher" +#~ msgstr "अनुप्रयोग चालक" + +#, fuzzy +#~| msgctxt "@item:inlistbox View:" +#~| msgid "Standard" +#~ msgid "Standard" +#~ msgstr "मानक" + +#~ msgid "Leave..." +#~ msgstr "छोड़ें..." + +#~ msgctxt "@item:inlistbox View:" +#~ msgid "Favorites" +#~ msgstr "प्रिय" + +#~ msgctxt "@item:inlistbox View:" +#~ msgid "Applications" +#~ msgstr "अनुप्रयोग" + +#~ msgctxt "@item:inlistbox View:" +#~ msgid "Computer" +#~ msgstr "कम्प्यूटर" + +#~ msgctxt "@item:inlistbox View:" +#~ msgid "Recently Used" +#~ msgstr "हाल ही में इस्तेमाल किए गए" + +#~ msgctxt "@item:inlistbox View:" +#~ msgid "Leave" +#~ msgstr "छोड़ें" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_lockout.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_lockout.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_lockout.po 2014-02-08 03:11:35.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_lockout.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: plasma_applet_lockout\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-02-08 01:38+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-01-31 19:46+0530\n" "Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" "Language-Team: Hindi <indlinux>\n" @@ -48,7 +48,7 @@ msgstr "" #. i18n: ectx: property (text), widget (QLabel, label_5) -#: contents/ui/config.ui:66 contents/ui/data.js:24 contents/ui/lockout.qml:164 +#: contents/ui/config.ui:66 contents/ui/data.js:24 contents/ui/lockout.qml:186 msgid "Hibernate" msgstr "सुप्तावस्था" @@ -73,7 +73,7 @@ msgid "Logout, turn off or restart the computer" msgstr "लॉगआउट, बंद या कंप्यूटर फिर से चालू करें" -#: contents/ui/data.js:19 contents/ui/lockout.qml:179 +#: contents/ui/data.js:19 contents/ui/lockout.qml:201 msgid "Suspend" msgstr "स्थगित" @@ -85,19 +85,19 @@ msgid "Hibernate (suspend to disk)" msgstr "सुप्तावस्था (डिस्क में सस्पेंड करें)" -#: contents/ui/lockout.qml:165 +#: contents/ui/lockout.qml:187 msgid "Do you want to suspend to disk (hibernate)?" msgstr "क्या तुम डिस्क में स्थगित करना चाहते हो (hibernate)?" -#: contents/ui/lockout.qml:167 contents/ui/lockout.qml:182 +#: contents/ui/lockout.qml:189 contents/ui/lockout.qml:204 msgid "Yes" msgstr "" -#: contents/ui/lockout.qml:168 contents/ui/lockout.qml:183 +#: contents/ui/lockout.qml:190 contents/ui/lockout.qml:205 msgid "No" msgstr "" -#: contents/ui/lockout.qml:180 +#: contents/ui/lockout.qml:202 msgid "Do you want to suspend to RAM (sleep)?" msgstr "क्या तुम रैम में स्थगित करना चाहते हो (sleep)?" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_netpanel.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_netpanel.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_netpanel.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_netpanel.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,32 @@ +# translation of plasma_applet_netpanel.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Rajesh Ranjan <rajesh672@gmail.com>, 2010. +msgid "" +msgstr "" +"Project-Id-Version: plasma_applet_netpanel\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2010-01-31 19:38+0530\n" +"Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" +"Language-Team: Hindi <indlinux>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" + +#: panel.cpp:88 panel.cpp:360 +msgid "Lock Panel" +msgstr "पैनल लॉक करें" + +#: panel.cpp:94 +msgid "Settings" +msgstr "" + +#: panel.cpp:354 +msgid "Unlock Panel" +msgstr "पैनल खोलें" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_notifier.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_notifier.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_notifier.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_notifier.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,169 @@ +# translation of plasma_applet_devicenotifier.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2008. +# Rajesh Ranjan <rranjan@redhat.com>, 2008. +msgid "" +msgstr "" +"Project-Id-Version: plasma_applet_devicenotifier\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2008-12-04 13:18+0530\n" +"Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" +"X-Generator: KBabel 1.11.4\n" + +#. i18n: ectx: property (text), widget (QRadioButton, kcfg_removableDevices) +#: package/contents/ui/config.ui:17 +msgid "Removable devices only" +msgstr "" + +#. i18n: ectx: property (text), widget (QRadioButton, kcfg_nonRemovableDevices) +#: package/contents/ui/config.ui:24 +msgid "Non-removable devices only" +msgstr "" + +#. i18n: ectx: property (text), widget (QRadioButton, kcfg_allDevices) +#: package/contents/ui/config.ui:44 +msgid "All devices" +msgstr "" + +#: package/contents/ui/DeviceItem.qml:164 +msgctxt "" +"Accessing is a less technical word for Mounting; translation should be short " +"and mean 'Currently mounting this device'" +msgid "Accessing..." +msgstr "" + +#: package/contents/ui/DeviceItem.qml:164 +msgctxt "" +"Removing is a less technical word for Unmounting; translation shoud be short " +"and mean 'Currently unmounting this device'" +msgid "Removing..." +msgstr "" + +#: package/contents/ui/DeviceItem.qml:177 +#, fuzzy, kde-format +#| msgid "1 action for this device" +#| msgid_plural "%1 actions for this device" +msgid "1 action for this device" +msgid_plural "%1 actions for this device" +msgstr[0] "इस उपकरण के लिए 1 क्रिया" +msgstr[1] "इस उपकरण के लिए 1 क्रिया" + +#: package/contents/ui/DeviceItem.qml:186 +#, kde-format +msgctxt "@info:status Free disk space" +msgid "%1 free" +msgstr "" + +#: package/contents/ui/DeviceItem.qml:225 +#, fuzzy +#| msgid "1 action for this device" +#| msgid_plural "%1 actions for this device" +msgid "Click to mount this device." +msgstr "इस उपकरण के लिए 1 क्रिया" + +#: package/contents/ui/DeviceItem.qml:227 +#, fuzzy +#| msgid "1 action for this device" +#| msgid_plural "%1 actions for this device" +msgid "Click to eject this disc." +msgstr "इस उपकरण के लिए 1 क्रिया" + +#: package/contents/ui/DeviceItem.qml:229 +#, fuzzy +#| msgid "1 action for this device" +#| msgid_plural "%1 actions for this device" +msgid "Click to safely remove this device." +msgstr "इस उपकरण के लिए 1 क्रिया" + +#: package/contents/ui/DeviceItem.qml:231 +msgid "Click to access this device from other applications." +msgstr "" + +#: package/contents/ui/DeviceItem.qml:241 +msgid "" +"It is currently <b>not safe</b> to remove this device: applications may be " +"accessing it. Click the eject button to safely remove this device." +msgstr "" + +#: package/contents/ui/DeviceItem.qml:243 +msgid "This device is currently accessible." +msgstr "" + +#: package/contents/ui/DeviceItem.qml:248 +msgid "" +"It is currently <b>not safe</b> to remove this device: applications may be " +"accessing other volumes on this device. Click the eject button on these " +"other volumes to safely remove this device." +msgstr "" + +#: package/contents/ui/DeviceItem.qml:250 +#, fuzzy +#| msgid "1 action for this device" +#| msgid_plural "%1 actions for this device" +msgid "It is currently safe to remove this device." +msgstr "इस उपकरण के लिए 1 क्रिया" + +#: package/contents/ui/DeviceItem.qml:253 +msgid "This device is not currently accessible." +msgstr "" + +#: package/contents/ui/devicenotifier.qml:163 +#, fuzzy +#| msgid "No devices plugged in" +msgid "No devices available" +msgstr "कोई युक्ति प्लगिन नहीं" + +#: package/contents/ui/devicenotifier.qml:166 +#, fuzzy +#| msgid "Last plugged in device: %1" +msgid "Most recent device" +msgstr "हाल ही में प्लग किए गए उपकरण: %1" + +#: package/contents/ui/devicenotifier.qml:193 +msgid "Available Devices" +msgstr "" + +#: package/contents/ui/devicenotifier.qml:193 +msgid "No Devices Available" +msgstr "" + +#, fuzzy +#~| msgid "" +#~| "Cannot unmount the device.\n" +#~| "One or more files on this device are open within an application." +#~ msgid "" +#~ "Could not unmount device %1.\n" +#~ "One or more files on this device are open within an application." +#~ msgstr "" +#~ "उपकरण को अनमाउन्ट नहीं किया जा सका.\n" +#~ "किसी अनुप्रयोग में इस उपकरण का एकाधिक फ़ाइल खुला हुआ है." + +#~ msgid "" +#~ "Cannot eject the disc.\n" +#~ "One or more files on this disc are open within an application." +#~ msgstr "" +#~ "उपकरण को बाहर नहीं किया जा सका.\n" +#~ "किसी अनुप्रयोग में इस उपकरण का एकाधिक फ़ाइल खुला हुआ है." + +#, fuzzy +#~| msgid "Last plugged in device: %1" +#~ msgid "Could not mount device %1." +#~ msgstr "हाल ही में प्लग किए गए उपकरण: %1" + +#~ msgid "No devices plugged in" +#~ msgstr "कोई युक्ति प्लगिन नहीं" + +#, fuzzy +#~| msgid "<font color=\"%1\">Devices recently plugged in:</font>" +#~ msgid "Devices recently plugged in:" +#~ msgstr "<font color=\"%1\">हाल ही में प्लग किए गए उपकरण:</font>" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_org.kde.notifications.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_org.kde.notifications.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_org.kde.notifications.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_org.kde.notifications.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,209 @@ +# translation of plasma_applet_notifications.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# FIRST AUTHOR <EMAIL@ADDRESS>, YEAR. +# +msgid "" +msgstr "" +"Project-Id-Version: plasma_applet_notifications\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2010-12-09 02:08+0530\n" +"Last-Translator: G Karunakar\n" +"Language-Team: Hindi <en@li.org>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"X-Generator: KBabel 1.11.4\n" + +#. i18n: ectx: property (text), widget (QLabel, label_2) +#: contents/ui/config.ui:17 +#, fuzzy +#| msgid "Application notifications" +msgid "&Application notifications:" +msgstr "अनुप्रयोग सूचनाएँ" + +#. i18n: ectx: property (text), widget (QLabel, label_3) +#: contents/ui/config.ui:34 +#, fuzzy +#| msgid "File transfers and other jobs" +msgid "&File transfers and jobs:" +msgstr "फ़ाइल हस्तांतरण और अन्य कार्य" + +#. i18n: ectx: property (text), widget (QLabel, label) +#: contents/ui/config.ui:57 +msgid "Choose which information to show" +msgstr "दिखाने योग्य जानकारी चुनें" + +#: contents/ui/JobDelegate.qml:66 contents/ui/JobDelegate.qml:86 +msgid "%1:" +msgstr "" + +#: contents/ui/JobDelegate.qml:182 +#, fuzzy +#| msgid "%1 (%2 remaining)" +msgctxt "Speed and estimated time to completition" +msgid "%1 (%2 remaining)" +msgstr "%1 (%2 बचे)" + +#: contents/ui/JobDelegate.qml:208 +msgctxt "" +"How much many bytes (or whether unit in the locale has been copied over total" +msgid "%1 of %2" +msgstr "" + +#: contents/ui/JobDelegate.qml:213 +msgid "%1 of %2 %3" +msgstr "" + +#: contents/ui/JobDelegate.qml:241 +msgid "KiB/s" +msgstr "" + +#: contents/ui/Jobs.qml:52 +msgid "%1 [Finished]" +msgstr "%1 [पूर्ण]" + +#: contents/ui/Jobs.qml:56 +msgid "Open" +msgstr "खोलें" + +#: contents/ui/Jobs.qml:83 +msgid "Transfers" +msgstr "" + +#: contents/ui/main.qml:64 +#, fuzzy +#| msgid "Notifications and jobs" +msgid "Notifications and Jobs" +msgstr "सूचनाएँ और कार्य" + +#: contents/ui/main.qml:66 +#, fuzzy +#| msgid "No notifications and no jobs" +msgid "No notifications or jobs" +msgstr "कोई कार्य या सूचना नहीं" + +#: contents/ui/main.qml:68 contents/ui/main.qml:72 +#, fuzzy +#| msgid "no running jobs" +msgid "%1 running job" +msgid_plural "%1 running jobs" +msgstr[0] "कार्य नहीं चल रहे" +msgstr[1] "कार्य नहीं चल रहे" + +#: contents/ui/main.qml:70 contents/ui/main.qml:72 +msgid "%1 notification" +msgid_plural "%1 notifications" +msgstr[0] "%1 सूचना" +msgstr[1] "%1 सूचनाएँ" + +#: contents/ui/NotificationDelegate/NotificationDelegate.qml:188 +msgid "Copy" +msgstr "" + +#: contents/ui/NotificationDelegate/NotificationDelegate.qml:192 +msgid "Select All" +msgstr "" + +#: contents/ui/Notifications.qml:191 +msgid "Notifications" +msgstr "सूचनाएँ" + +#: contents/ui/Notifications.qml:211 +#, fuzzy +#| msgctxt "Show all notifications" +#| msgid "All" +msgid "All" +msgstr "सभी" + +#~ msgid "%1 file, to: %2" +#~ msgid_plural "%1 files, to: %2" +#~ msgstr[0] "%1 फ़ाइल, से: %2" +#~ msgstr[1] "%1 फ़ाइलो, से: %2" + +#~ msgid "1 running job (%2 remaining)" +#~ msgid_plural "%1 running jobs (%2 remaining)" +#~ msgstr[0] "1 चल रहा है...(%2 बचे)" +#~ msgstr[1] "%1 चल रहे (%2 बचे)" + +#, fuzzy +#~| msgid "%1 running job" +#~| msgid_plural "%1 running jobs" +#~ msgctxt "Number of jobs and the speed at which they are downloading" +#~ msgid "%1 running job (%2/s)" +#~ msgid_plural "%1 running jobs (%2/s)" +#~ msgstr[0] "%1 कार्य चल रहा" +#~ msgstr[1] "%1 कार्य चल रहे.." + +#~ msgid "%1 suspended job" +#~ msgid_plural "%1 suspended jobs" +#~ msgstr[0] "%1 कार्य निलंबित है" +#~ msgstr[1] "%1 कार्य निलंबित हैं" + +#~ msgid "%1 completed job" +#~ msgid_plural "%1 completed jobs" +#~ msgstr[0] "%1 पूर्ण कार्य" +#~ msgstr[1] "%1 पूर्ण कार्य" + +#~ msgid "No active jobs or notifications" +#~ msgstr "कोई सक्रिय कार्य या सूचना नहीं" + +#~ msgctxt "Generic title for the job transfer popup" +#~ msgid "Jobs" +#~ msgstr "कार्य" + +#~ msgid "More" +#~ msgstr "अधिक" + +#~ msgid "Pause job" +#~ msgstr "कार्य ठहराएँ" + +#~ msgid "Resume job" +#~ msgstr "कार्य पुनरारंभ" + +#~ msgid "Cancel job" +#~ msgstr "कार्य रद्द" + +#~ msgctxt "" +#~ "%1 is the name of the job, can be things like Copying, deleting, moving" +#~ msgid "%1 [Paused]" +#~ msgstr "%1 [ठहरा]" + +#~ msgid "Paused" +#~ msgstr "ठहरा" + +#~ msgctxt "" +#~ "%1 is the name of the job, can be things like Copying, deleting, moving" +#~ msgid "%1 [Finished]" +#~ msgstr "%1 [पूर्ण]" + +#~ msgid "%2 / 1 folder" +#~ msgid_plural "%2 / %1 folders" +#~ msgstr[0] "%2 / 1 फ़ोल्डर" +#~ msgstr[1] "%2 / %1 फ़ोल्डरें" + +#~ msgid "%2 / 1 file" +#~ msgid_plural "%2 / %1 files" +#~ msgstr[0] "%2 / 1 फ़ाइल" +#~ msgstr[1] "%2 / %1 फ़ाइलें" + +#~ msgid "Less" +#~ msgstr "कम" + +#~ msgid "Notification from %1" +#~ msgstr "%1 से सूचना" + +#~ msgid "Information" +#~ msgstr "जानकारी" + +#~ msgid "Pop Up Notices" +#~ msgstr "पॉपअप सूचनाएँ" + +#~ msgid "Popup" +#~ msgstr "पॉप अप" + +#~ msgid "Automatically hide" +#~ msgstr "स्वतः छुपाएँ" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_org.kde.plasma.analogclock.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_org.kde.plasma.analogclock.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_org.kde.plasma.analogclock.po 2014-03-21 04:12:46.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_org.kde.plasma.analogclock.po 1970-01-01 00:00:00.000000000 +0000 @@ -1,54 +0,0 @@ -# translation of plasma_applet_clock.po to Hindi -# Copyright (C) YEAR This_file_is_part_of_KDE -# This file is distributed under the same license as the PACKAGE package. -# -# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007. -# Rajesh Ranjan <rranjan@redhat.com>, 2008. -msgid "" -msgstr "" -"Project-Id-Version: plasma_applet_clock\n" -"Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-21 02:05+0000\n" -"PO-Revision-Date: 2008-12-04 13:18+0530\n" -"Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" -"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" -"Language: hi\n" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" -"X-Generator: KBabel 1.11.4\n" -"Plural-Forms: nplurals=2; plural=(n!=1);\n" -"\n" - -#: contents/ui/configGeneral.qml:38 -#, fuzzy -#| msgid "Show &seconds hand" -msgid "Show seconds hand" -msgstr "सेकण्ड सुई दिखाएँ (&s)" - -#: contents/ui/configGeneral.qml:42 -#, fuzzy -#| msgid "Show &time zone" -msgid "Show time zone" -msgstr "समयक्षेत्र दिखाएँ (&t)" - -#~ msgid "Show the seconds" -#~ msgstr "सेकेंड दिखाएँ" - -#~ msgid "Check this if you want to show the seconds." -#~ msgstr "जाँचें यदि आप सेकेंड दिखाना चाहते हैं" - -#~ msgid "Show &seconds hand" -#~ msgstr "सेकण्ड सुई दिखाएँ (&s)" - -#~ msgid "Show the Timezone in text" -#~ msgstr "समयक्षेत्र को पाठ के रूप में दिखाएँ" - -#~ msgid "Check this if you want to display Timezone in text." -#~ msgstr "इसे जाँचें यदि आप समयक्षेत्र को पाठ रूप में दिखाना चाहते हैं." - -#~ msgid "Show &time zone" -#~ msgstr "समयक्षेत्र दिखाएँ (&t)" - -#~ msgid "General" -#~ msgstr "सामान्य" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_org.kde.plasma.battery.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_org.kde.plasma.battery.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_org.kde.plasma.battery.po 2014-03-19 06:15:59.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_org.kde.plasma.battery.po 1970-01-01 00:00:00.000000000 +0000 @@ -1,310 +0,0 @@ -# translation of plasma_applet_battery.po to Hindi -# Copyright (C) YEAR This_file_is_part_of_KDE -# This file is distributed under the same license as the PACKAGE package. -# -# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007. -# Rajesh Ranjan <rranjan@redhat.com>, 2008. -msgid "" -msgstr "" -"Project-Id-Version: plasma_applet_battery\n" -"Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-19 04:21+0000\n" -"PO-Revision-Date: 2008-12-04 13:16+0530\n" -"Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" -"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" -"Language: hi\n" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" -"X-Generator: KBabel 1.11.4\n" -"Plural-Forms: nplurals=2; plural=(n!=1);\n" -"\n" - -#: contents/code/logic.js:97 contents/code/logic.js:99 -#, fuzzy -#| msgid "<b>Battery:</b> %1% (fully charged)<br />" -msgid "Fully Charged" -msgstr "<b>बैटरी:</b> %1% (पूरी तरह से चार्ज)<br />" - -#: contents/code/logic.js:98 -#, fuzzy -#| msgctxt "Shown when a time estimate is not available" -#| msgid "<b>Battery:</b> %1% (discharging)<br />" -msgid "Discharging" -msgstr "<b> बैटरी</b> %1% (चार्ज कम हो रहा है)<br />" - -#: contents/code/logic.js:100 -#, fuzzy -#| msgctxt "Shown when a time estimate is not available" -#| msgid "<b>Battery:</b> %1% (discharging)<br />" -msgid "Charging" -msgstr "<b> बैटरी</b> %1% (चार्ज कम हो रहा है)<br />" - -#: contents/code/logic.js:103 -msgctxt "Battery is currently not present in the bay" -msgid "Not present" -msgstr "" - -#: contents/code/logic.js:154 -msgid "No batteries available" -msgstr "" - -#: contents/code/logic.js:163 -#, kde-format -msgctxt "Placeholder is battery name" -msgid "%1:" -msgstr "" - -#: contents/code/logic.js:166 contents/ui/BatteryItem.qml:185 -#, kde-format -msgctxt "Placeholder is battery percentage" -msgid "%1%" -msgstr "" - -#: contents/code/logic.js:168 -msgid "N/A" -msgstr "" - -#: contents/code/logic.js:189 -#, fuzzy -#| msgid "Power Management" -msgid "Power management is disabled" -msgstr "शक्ति प्रबंधन" - -#: contents/ui/BatteryItem.qml:225 -msgid "Time To Full:" -msgstr "" - -#: contents/ui/BatteryItem.qml:225 -msgid "Time To Empty:" -msgstr "" - -#: contents/ui/BatteryItem.qml:230 -msgid "Capacity:" -msgstr "" - -#: contents/ui/BatteryItem.qml:235 -msgid "Vendor:" -msgstr "" - -#: contents/ui/BatteryItem.qml:240 -msgid "Model:" -msgstr "" - -#: contents/ui/BatteryItem.qml:257 -#, kde-format -msgctxt "Placeholder is battery capacity" -msgid "%1%" -msgstr "" - -#: contents/ui/batterymonitor.qml:172 -msgid "The battery applet has enabled system-wide inhibition" -msgstr "" - -#: contents/ui/BrightnessItem.qml:88 -#, kde-format -msgctxt "Placeholder is brightness percentage" -msgid "%1%" -msgstr "" - -#: contents/ui/CompactRepresentation.qml:88 -#, kde-format -msgctxt "battery percentage below battery icon" -msgid "%1%" -msgstr "" - -#: contents/ui/PopupDialog.qml:126 -#, fuzzy -#| msgid "Screen Brightness" -msgid "Display Brightness" -msgstr "स्क्रीन चमकीलापन" - -#: contents/ui/PopupDialog.qml:137 -#, fuzzy -#| msgid "Screen Brightness" -msgid "Keyboard Brightness" -msgstr "स्क्रीन चमकीलापन" - -#: contents/ui/PopupDialog.qml:155 -msgid "No screen or keyboard brightness controls available" -msgstr "" - -#: contents/ui/PowerManagementItem.qml:55 -#, fuzzy -#| msgid "Power Management" -msgid "Enable Power Management" -msgstr "शक्ति प्रबंधन" - -#, fuzzy -#~| msgctxt "Shown when a time estimate is not available" -#~| msgid "<b>Battery:</b> %1% (discharging)<br />" -#~ msgid "Not Charging" -#~ msgstr "<b> बैटरी</b> %1% (चार्ज कम हो रहा है)<br />" - -#, fuzzy -#~| msgid "<b>AC Adapter:</b> Plugged in" -#~ msgid "AC Adapter" -#~ msgstr "<b> AC एडाप्टर </b> प्लग इन किया" - -#, fuzzy -#~| msgid "<b>AC Adapter:</b> Not plugged in" -#~ msgid "Plugged In" -#~ msgstr "<b> AC एडाप्टर: </b> प्लगिन नहीं" - -#, fuzzy -#~| msgid "<b>AC Adapter:</b> Not plugged in" -#~ msgid "Not Plugged In" -#~ msgstr "<b> AC एडाप्टर: </b> प्लगिन नहीं" - -#, fuzzy -#~| msgid "Time remaining: <b>%1</b><br />" -#~ msgid "Time remaining until full: %1" -#~ msgstr "शेष समय: <b>%1</b><br />" - -#, fuzzy -#~| msgid "Time remaining: <b>%1</b><br />" -#~ msgid "Time remaining until empty: %1" -#~ msgstr "शेष समय: <b>%1</b><br />" - -#, fuzzy -#~| msgid "<b>Battery:</b> %1% (fully charged)<br />" -#~ msgid "%1% (charged)" -#~ msgstr "<b>बैटरी:</b> %1% (पूरी तरह से चार्ज)<br />" - -#, fuzzy -#~| msgid "<b>AC Adapter:</b> Plugged in" -#~ msgctxt "tooltip" -#~ msgid "AC Adapter:" -#~ msgstr "<b> AC एडाप्टर </b> प्लग इन किया" - -#, fuzzy -#~| msgid "<b>AC Adapter:</b> Not plugged in" -#~ msgctxt "tooltip" -#~ msgid "<b>Not plugged in</b>" -#~ msgstr "<b> AC एडाप्टर: </b> प्लगिन नहीं" - -#~ msgid "Configure Battery Monitor" -#~ msgstr "बैटरी मॉनीटर कॉन्फ़िगर करें " - -#, fuzzy -#~| msgid "Screen Brightness" -#~ msgid "Screen Brightness:" -#~ msgstr "स्क्रीन चमकीलापन" - -#, fuzzy -#~| msgid "Sleep" -#~ msgctxt "Suspend the computer to RAM; translation should be short" -#~ msgid "Sleep" -#~ msgstr "स्लीप" - -#, fuzzy -#~| msgid "Hibernate" -#~ msgctxt "Suspend the computer to disk; translation should be short" -#~ msgid "Hibernate" -#~ msgstr "सुप्तावस्था" - -#, fuzzy -#~| msgid "<b>Battery:</b> %1% (fully charged)<br />" -#~ msgid "<b>%1% (charged)</b>" -#~ msgstr "<b>बैटरी:</b> %1% (पूरी तरह से चार्ज)<br />" - -#, fuzzy -#~| msgctxt "Shown when a time estimate is not available" -#~| msgid "<b>Battery:</b> %1% (discharging)<br />" -#~ msgid "<b>%1% (discharging)</b>" -#~ msgstr "<b> बैटरी</b> %1% (चार्ज कम हो रहा है)<br />" - -#, fuzzy -#~| msgctxt "Shown when a time estimate is not available" -#~| msgid "<b>Battery:</b> %1% (discharging)<br />" -#~ msgid "<b>%1% (charging)</b>" -#~ msgstr "<b> बैटरी</b> %1% (चार्ज कम हो रहा है)<br />" - -#, fuzzy -#~| msgctxt "Battery is not plugged in" -#~| msgid "<b>Battery:</b> not present<br />" -#~ msgid "Battery:" -#~ msgstr "<b> बैटरी</b>मोजूद नहीं<br />" - -#, fuzzy -#~| msgctxt "Battery is not plugged in" -#~| msgid "<b>Battery:</b> not present<br />" -#~ msgctxt "tooltip: placeholder is the battery ID" -#~ msgid "Battery %1:" -#~ msgstr "<b> बैटरी</b>मोजूद नहीं<br />" - -#~ msgid "Show the state for &each battery present" -#~ msgstr "हर उपस्थित बैटरी के लिए स्थिति दिखाएँ (&e)" - -#, fuzzy -#~| msgctxt "Battery is not plugged in" -#~| msgid "<b>Battery:</b> not present<br />" -#~ msgctxt "Placeholder is the battery ID" -#~ msgid "Battery %1:" -#~ msgstr "<b> बैटरी</b>मोजूद नहीं<br />" - -#, fuzzy -#~| msgctxt "Battery is not plugged in" -#~| msgid "<b>Battery:</b> not present<br />" -#~ msgid "<b>Battery:</b>" -#~ msgstr "<b> बैटरी</b>मोजूद नहीं<br />" - -#, fuzzy -#~| msgid "<b>AC Adapter:</b> Plugged in" -#~ msgctxt "tooltip" -#~ msgid "<b>AC Adapter:</b>" -#~ msgstr "<b> AC एडाप्टर </b> प्लग इन किया" - -#, fuzzy -#~| msgid "Show the percentage of &charge on the battery" -#~ msgid "Show remaining time for the battery" -#~ msgstr "बैटरी के चार्ज का प्रतिशत दिखाएँ (&c)" - -#, fuzzy -#~| msgid "<b>Battery %1:</b> %2% (charging)<br />" -#~ msgctxt "tooltip: placeholder is the battery ID" -#~ msgid "<b>Battery %1:</b>" -#~ msgstr "<b>बैटरी %1:</b> %2% (चार्ज कर रहा है)<br />" - -#~ msgid "General" -#~ msgstr "सामान्य" - -#, fuzzy -#~| msgid "Power Profile" -#~ msgid "Power Profile:" -#~ msgstr "पावर प्रोफाइल" - -#, fuzzy -#~| msgid "<b>AC Adapter:</b> Plugged in" -#~ msgid "AC Adapter: " -#~ msgstr "<b> AC एडाप्टर </b> प्लग इन किया" - -#, fuzzy -#~| msgctxt "Battery is not plugged in" -#~| msgid "<b>Battery:</b> not present<br />" -#~ msgid "<b>Battery:</b> " -#~ msgstr "<b> बैटरी</b>मोजूद नहीं<br />" - -#, fuzzy -#~| msgctxt "Shown when a time estimate is not available" -#~| msgid "<b>Battery:</b> %1% (discharging)<br />" -#~ msgctxt "state of battery" -#~ msgid "%1% (discharging)" -#~ msgstr "<b> बैटरी</b> %1% (चार्ज कम हो रहा है)<br />" - -#, fuzzy -#~| msgid "More..." -#~ msgid "Configure..." -#~ msgstr "ज्यादा..." - -#~ msgid "Actions" -#~ msgstr "क्रियाएं" - -#~ msgid "<b>Battery:</b> %1% (charging)<br />" -#~ msgstr "<b> बैटरी</b> %1% (चार्ज कर रहा है) <br />" - -#~ msgid "<b>Battery %1:</b> %2% (fully charged)<br />" -#~ msgstr "<b>बैटरी %1:</b> %2% (पूरा चार्ज)<br />" - -#~ msgid "<b>Battery %1:</b> %2% (discharging)<br />" -#~ msgstr "<b>बैटरी %1:</b> %2% (चार्ज कम हो रहा है)<br />" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_org.kde.plasma.devicenotifier.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_org.kde.plasma.devicenotifier.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_org.kde.plasma.devicenotifier.po 2014-03-26 03:45:43.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_org.kde.plasma.devicenotifier.po 1970-01-01 00:00:00.000000000 +0000 @@ -1,154 +0,0 @@ -# translation of plasma_applet_devicenotifier.po to Hindi -# Copyright (C) YEAR This_file_is_part_of_KDE -# This file is distributed under the same license as the PACKAGE package. -# -# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2008. -# Rajesh Ranjan <rranjan@redhat.com>, 2008. -msgid "" -msgstr "" -"Project-Id-Version: plasma_applet_devicenotifier\n" -"Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-26 01:54+0000\n" -"PO-Revision-Date: 2008-12-04 13:18+0530\n" -"Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" -"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" -"Language: hi\n" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" -"Plural-Forms: nplurals=2; plural=(n!=1);\n" -"\n" -"X-Generator: KBabel 1.11.4\n" - -#: package/contents/ui/DeviceItem.qml:141 -#, kde-format -msgctxt "@info:status Free disk space" -msgid "%1 free" -msgstr "" - -#: package/contents/ui/DeviceItem.qml:174 -msgctxt "" -"Accessing is a less technical word for Mounting; translation should be short " -"and mean 'Currently mounting this device'" -msgid "Accessing..." -msgstr "" - -#: package/contents/ui/DeviceItem.qml:174 -msgctxt "" -"Removing is a less technical word for Unmounting; translation shoud be short " -"and mean 'Currently unmounting this device'" -msgid "Removing..." -msgstr "" - -#: package/contents/ui/DeviceItem.qml:187 -#, fuzzy, kde-format -#| msgid "1 action for this device" -#| msgid_plural "%1 actions for this device" -msgid "1 action for this device" -msgid_plural "%1 actions for this device" -msgstr[0] "इस उपकरण के लिए 1 क्रिया" -msgstr[1] "इस उपकरण के लिए 1 क्रिया" - -#: package/contents/ui/DeviceItem.qml:220 -#, fuzzy -#| msgid "1 action for this device" -#| msgid_plural "%1 actions for this device" -msgid "Click to mount this device." -msgstr "इस उपकरण के लिए 1 क्रिया" - -#: package/contents/ui/DeviceItem.qml:222 -#, fuzzy -#| msgid "1 action for this device" -#| msgid_plural "%1 actions for this device" -msgid "Click to eject this disc." -msgstr "इस उपकरण के लिए 1 क्रिया" - -#: package/contents/ui/DeviceItem.qml:224 -#, fuzzy -#| msgid "1 action for this device" -#| msgid_plural "%1 actions for this device" -msgid "Click to safely remove this device." -msgstr "इस उपकरण के लिए 1 क्रिया" - -#: package/contents/ui/DeviceItem.qml:226 -msgid "Click to access this device from other applications." -msgstr "" - -#: package/contents/ui/DeviceItem.qml:245 -msgid "" -"It is currently <b>not safe</b> to remove this device: applications may be " -"accessing it. Click the eject button to safely remove this device." -msgstr "" - -#: package/contents/ui/DeviceItem.qml:247 -msgid "This device is currently accessible." -msgstr "" - -#: package/contents/ui/DeviceItem.qml:252 -msgid "" -"It is currently <b>not safe</b> to remove this device: applications may be " -"accessing other volumes on this device. Click the eject button on these " -"other volumes to safely remove this device." -msgstr "" - -#: package/contents/ui/DeviceItem.qml:254 -#, fuzzy -#| msgid "1 action for this device" -#| msgid_plural "%1 actions for this device" -msgid "It is currently safe to remove this device." -msgstr "इस उपकरण के लिए 1 क्रिया" - -#: package/contents/ui/DeviceItem.qml:257 -msgid "This device is not currently accessible." -msgstr "" - -#: package/contents/ui/devicenotifier.qml:39 -#, fuzzy -#| msgid "No devices plugged in" -msgid "No devices available" -msgstr "कोई युक्ति प्लगिन नहीं" - -#: package/contents/ui/devicenotifier.qml:39 -#, fuzzy -#| msgid "Last plugged in device: %1" -msgid "Most recent device" -msgstr "हाल ही में प्लग किए गए उपकरण: %1" - -#: package/contents/ui/devicenotifier.qml:210 -msgid "Available Devices" -msgstr "" - -#: package/contents/ui/devicenotifier.qml:210 -msgid "No Devices Available" -msgstr "" - -#, fuzzy -#~| msgid "" -#~| "Cannot unmount the device.\n" -#~| "One or more files on this device are open within an application." -#~ msgid "" -#~ "Could not unmount device %1.\n" -#~ "One or more files on this device are open within an application." -#~ msgstr "" -#~ "उपकरण को अनमाउन्ट नहीं किया जा सका.\n" -#~ "किसी अनुप्रयोग में इस उपकरण का एकाधिक फ़ाइल खुला हुआ है." - -#~ msgid "" -#~ "Cannot eject the disc.\n" -#~ "One or more files on this disc are open within an application." -#~ msgstr "" -#~ "उपकरण को बाहर नहीं किया जा सका.\n" -#~ "किसी अनुप्रयोग में इस उपकरण का एकाधिक फ़ाइल खुला हुआ है." - -#, fuzzy -#~| msgid "Last plugged in device: %1" -#~ msgid "Could not mount device %1." -#~ msgstr "हाल ही में प्लग किए गए उपकरण: %1" - -#~ msgid "No devices plugged in" -#~ msgstr "कोई युक्ति प्लगिन नहीं" - -#, fuzzy -#~| msgid "<font color=\"%1\">Devices recently plugged in:</font>" -#~ msgid "Devices recently plugged in:" -#~ msgstr "<font color=\"%1\">हाल ही में प्लग किए गए उपकरण:</font>" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_org.kde.plasma.notifications.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_org.kde.plasma.notifications.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_org.kde.plasma.notifications.po 2014-03-25 04:40:13.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_org.kde.plasma.notifications.po 1970-01-01 00:00:00.000000000 +0000 @@ -1,209 +0,0 @@ -# translation of plasma_applet_notifications.po to Hindi -# Copyright (C) YEAR This_file_is_part_of_KDE -# This file is distributed under the same license as the PACKAGE package. -# FIRST AUTHOR <EMAIL@ADDRESS>, YEAR. -# -msgid "" -msgstr "" -"Project-Id-Version: plasma_applet_notifications\n" -"Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-25 01:54+0000\n" -"PO-Revision-Date: 2010-12-09 02:08+0530\n" -"Last-Translator: G Karunakar\n" -"Language-Team: Hindi <en@li.org>\n" -"Language: hi\n" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" -"Plural-Forms: nplurals=2; plural=(n!=1);\n" -"X-Generator: KBabel 1.11.4\n" - -#. i18n: ectx: property (text), widget (QLabel, label_2) -#: contents/ui/config.ui:17 -#, fuzzy -#| msgid "Application notifications" -msgid "&Application notifications:" -msgstr "अनुप्रयोग सूचनाएँ" - -#. i18n: ectx: property (text), widget (QLabel, label_3) -#: contents/ui/config.ui:34 -#, fuzzy -#| msgid "File transfers and other jobs" -msgid "&File transfers and jobs:" -msgstr "फ़ाइल हस्तांतरण और अन्य कार्य" - -#. i18n: ectx: property (text), widget (QLabel, label) -#: contents/ui/config.ui:57 -msgid "Choose which information to show" -msgstr "दिखाने योग्य जानकारी चुनें" - -#: contents/ui/JobDelegate.qml:156 contents/ui/JobDelegate.qml:195 -msgid "%1:" -msgstr "" - -#: contents/ui/JobDelegate.qml:236 -msgctxt "" -"How much many bytes (or whether unit in the locale has been copied over total" -msgid "%1 of %2" -msgstr "" - -#: contents/ui/JobDelegate.qml:241 -msgid "%1 of %2 %3" -msgstr "" - -#: contents/ui/JobDelegate.qml:283 -#, fuzzy -#| msgid "%1 (%2 remaining)" -msgctxt "Speed and estimated time to completition" -msgid "%1 (%2 remaining)" -msgstr "%1 (%2 बचे)" - -#: contents/ui/Jobs.qml:58 -msgid "%1 [Finished]" -msgstr "%1 [पूर्ण]" - -#: contents/ui/Jobs.qml:65 -msgid "Open" -msgstr "खोलें" - -#: contents/ui/Jobs.qml:96 -msgid "Transfers" -msgstr "" - -#: contents/ui/main.qml:79 -#, fuzzy -#| msgid "Notifications and jobs" -msgid "Notifications and Jobs" -msgstr "सूचनाएँ और कार्य" - -#: contents/ui/main.qml:82 -#, fuzzy -#| msgid "No notifications and no jobs" -msgid "No notifications or jobs" -msgstr "कोई कार्य या सूचना नहीं" - -#: contents/ui/main.qml:84 contents/ui/main.qml:88 -#, fuzzy -#| msgid "no running jobs" -msgid "%1 running job" -msgid_plural "%1 running jobs" -msgstr[0] "कार्य नहीं चल रहे" -msgstr[1] "कार्य नहीं चल रहे" - -#: contents/ui/main.qml:86 contents/ui/main.qml:88 -msgid "%1 notification" -msgid_plural "%1 notifications" -msgstr[0] "%1 सूचना" -msgstr[1] "%1 सूचनाएँ" - -#: contents/ui/main.qml:127 -#, fuzzy -#| msgid "Notifications" -msgid "No new notifications." -msgstr "सूचनाएँ" - -#: contents/ui/NotificationDelegate.qml:194 -msgid "Copy" -msgstr "" - -#: contents/ui/NotificationDelegate.qml:199 -msgid "Select All" -msgstr "" - -#~ msgid "Notifications" -#~ msgstr "सूचनाएँ" - -#, fuzzy -#~| msgctxt "Show all notifications" -#~| msgid "All" -#~ msgid "All" -#~ msgstr "सभी" - -#~ msgid "%1 file, to: %2" -#~ msgid_plural "%1 files, to: %2" -#~ msgstr[0] "%1 फ़ाइल, से: %2" -#~ msgstr[1] "%1 फ़ाइलो, से: %2" - -#~ msgid "1 running job (%2 remaining)" -#~ msgid_plural "%1 running jobs (%2 remaining)" -#~ msgstr[0] "1 चल रहा है...(%2 बचे)" -#~ msgstr[1] "%1 चल रहे (%2 बचे)" - -#, fuzzy -#~| msgid "%1 running job" -#~| msgid_plural "%1 running jobs" -#~ msgctxt "Number of jobs and the speed at which they are downloading" -#~ msgid "%1 running job (%2/s)" -#~ msgid_plural "%1 running jobs (%2/s)" -#~ msgstr[0] "%1 कार्य चल रहा" -#~ msgstr[1] "%1 कार्य चल रहे.." - -#~ msgid "%1 suspended job" -#~ msgid_plural "%1 suspended jobs" -#~ msgstr[0] "%1 कार्य निलंबित है" -#~ msgstr[1] "%1 कार्य निलंबित हैं" - -#~ msgid "%1 completed job" -#~ msgid_plural "%1 completed jobs" -#~ msgstr[0] "%1 पूर्ण कार्य" -#~ msgstr[1] "%1 पूर्ण कार्य" - -#~ msgid "No active jobs or notifications" -#~ msgstr "कोई सक्रिय कार्य या सूचना नहीं" - -#~ msgctxt "Generic title for the job transfer popup" -#~ msgid "Jobs" -#~ msgstr "कार्य" - -#~ msgid "More" -#~ msgstr "अधिक" - -#~ msgid "Pause job" -#~ msgstr "कार्य ठहराएँ" - -#~ msgid "Resume job" -#~ msgstr "कार्य पुनरारंभ" - -#~ msgid "Cancel job" -#~ msgstr "कार्य रद्द" - -#~ msgctxt "" -#~ "%1 is the name of the job, can be things like Copying, deleting, moving" -#~ msgid "%1 [Paused]" -#~ msgstr "%1 [ठहरा]" - -#~ msgid "Paused" -#~ msgstr "ठहरा" - -#~ msgctxt "" -#~ "%1 is the name of the job, can be things like Copying, deleting, moving" -#~ msgid "%1 [Finished]" -#~ msgstr "%1 [पूर्ण]" - -#~ msgid "%2 / 1 folder" -#~ msgid_plural "%2 / %1 folders" -#~ msgstr[0] "%2 / 1 फ़ोल्डर" -#~ msgstr[1] "%2 / %1 फ़ोल्डरें" - -#~ msgid "%2 / 1 file" -#~ msgid_plural "%2 / %1 files" -#~ msgstr[0] "%2 / 1 फ़ाइल" -#~ msgstr[1] "%2 / %1 फ़ाइलें" - -#~ msgid "Less" -#~ msgstr "कम" - -#~ msgid "Notification from %1" -#~ msgstr "%1 से सूचना" - -#~ msgid "Information" -#~ msgstr "जानकारी" - -#~ msgid "Pop Up Notices" -#~ msgstr "पॉपअप सूचनाएँ" - -#~ msgid "Popup" -#~ msgstr "पॉप अप" - -#~ msgid "Automatically hide" -#~ msgstr "स्वतः छुपाएँ" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_org.kde.plasma.pager.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_org.kde.plasma.pager.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_org.kde.plasma.pager.po 2014-03-26 03:45:43.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_org.kde.plasma.pager.po 1970-01-01 00:00:00.000000000 +0000 @@ -1,109 +0,0 @@ -# translation of plasma_applet_pager.po to Hindi -# Copyright (C) YEAR This_file_is_part_of_KDE -# This file is distributed under the same license as the PACKAGE package. -# -# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007, 2008. -# Rajesh Ranjan <rranjan@redhat.com>, 2008. -msgid "" -msgstr "" -"Project-Id-Version: plasma_applet_pager\n" -"Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-26 01:53+0000\n" -"PO-Revision-Date: 2008-12-04 13:51+0530\n" -"Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" -"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" -"Language: hi\n" -"MIME-Version: 1.0\n" -"Content-Type: text/plain; charset=UTF-8\n" -"Content-Transfer-Encoding: 8bit\n" -"X-Generator: KBabel 1.11.4\n" -"Plural-Forms: nplurals=2; plural=(n!=1);\n" -"\n" - -#: package/contents/config/config.qml:25 -msgid "General" -msgstr "सामान्य" - -#: package/contents/ui/configGeneral.qml:79 -#, fuzzy -#| msgid "Display text:" -msgid "Display Text:" -msgstr "प्रदर्शक पाठ:" - -#: package/contents/ui/configGeneral.qml:85 -msgid "Desktop number" -msgstr "डेस्कटॉप संख्या" - -#: package/contents/ui/configGeneral.qml:96 -msgid "Desktop name" -msgstr "डेस्कटॉप नाम" - -#: package/contents/ui/configGeneral.qml:102 -msgid "No text" -msgstr "कोई पाठ नहीं" - -#: package/contents/ui/configGeneral.qml:107 -msgid "Display icons:" -msgstr "प्रदर्शक चिह्न:" - -#: package/contents/ui/configGeneral.qml:115 -msgid "Selecting current desktop:" -msgstr "" - -#: package/contents/ui/configGeneral.qml:121 -msgid "Does nothing" -msgstr "" - -#: package/contents/ui/configGeneral.qml:132 -msgid "Shows desktop" -msgstr "" - -#: package/contents/ui/configGeneral.qml:138 -msgid "Shows the dashboard" -msgstr "" - -#: package/contents/ui/main.qml:186 -#, fuzzy, kde-format -#| msgid "One window:" -#| msgid_plural "%1 windows:" -msgid "%1 windows" -msgstr "एक विंडो:" - -#: package/contents/ui/main.qml:193 -#, fuzzy, kde-format -#| msgid "and 1 other" -#| msgid_plural "and %1 others" -msgid "and %1 other windows" -msgstr "और 1 अन्य" - -#: plugin/pager.cpp:214 -msgid "&Add Virtual Desktop" -msgstr "" - -#: plugin/pager.cpp:217 -#, fuzzy -#| msgid "&Configure Desktops..." -msgid "&Remove Last Virtual Desktop" -msgstr "डेस्कटॉप कॉन्फ़िगर करें... (&C)" - -#~ msgid "Configure Pager" -#~ msgstr "पेजर कॉन्फ़िगर करें" - -#, fuzzy -#~| msgid "Number of rows:" -#~ msgid "Number of columns:" -#~ msgstr "पंक्तियों की संख्या:" - -#~ msgid "Number of rows:" -#~ msgstr "पंक्तियों की संख्या:" - -#~ msgid "Change the number of rows" -#~ msgstr "पंक्तियों की संख्या बदलें" - -#, fuzzy -#~| msgid "&Configure Desktops..." -#~ msgid "&Configure Virtual Desktops..." -#~ msgstr "डेस्कटॉप कॉन्फ़िगर करें... (&C)" - -#~ msgid "Configure Desktops..." -#~ msgstr "डेस्कटॉप कॉन्फ़िगर करें" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_pager.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_pager.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_pager.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_pager.po 2013-11-27 06:24:07.000000000 +0000 @@ -0,0 +1,118 @@ +# translation of plasma_applet_pager.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007, 2008. +# Rajesh Ranjan <rranjan@redhat.com>, 2008. +msgid "" +msgstr "" +"Project-Id-Version: plasma_applet_pager\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-27 05:29+0000\n" +"PO-Revision-Date: 2008-12-04 13:51+0530\n" +"Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" + +#: pager.cpp:307 +msgid "&Add Virtual Desktop" +msgstr "" + +#: pager.cpp:310 +#, fuzzy +#| msgid "&Configure Desktops..." +msgid "&Remove Last Virtual Desktop" +msgstr "डेस्कटॉप कॉन्फ़िगर करें... (&C)" + +#: pager.cpp:350 +msgid "General" +msgstr "सामान्य" + +#: pager.cpp:877 +#, kde-format +msgid "One window:" +msgid_plural "%1 windows:" +msgstr[0] "एक विंडो:" +msgstr[1] "%1 विंडो:" + +#: pager.cpp:881 +#, kde-format +msgid "and 1 other" +msgid_plural "and %1 others" +msgstr[0] "और 1 अन्य" +msgstr[1] "और %1 अन्य" + +#. i18n: ectx: property (windowTitle), widget (QWidget, pagerConfig) +#: pagerConfig.ui:14 +msgid "Configure Pager" +msgstr "पेजर कॉन्फ़िगर करें" + +#. i18n: ectx: property (text), widget (QLabel, displayLabel) +#: pagerConfig.ui:41 +msgid "Display text:" +msgstr "प्रदर्शक पाठ:" + +#. i18n: ectx: property (text), widget (QRadioButton, desktopNumberRadioButton) +#: pagerConfig.ui:51 +msgid "Desktop number" +msgstr "डेस्कटॉप संख्या" + +#. i18n: ectx: property (text), widget (QRadioButton, desktopNameRadioButton) +#: pagerConfig.ui:61 +msgid "Desktop name" +msgstr "डेस्कटॉप नाम" + +#. i18n: ectx: property (text), widget (QRadioButton, displayNoneRadioButton) +#: pagerConfig.ui:71 +msgid "No text" +msgstr "कोई पाठ नहीं" + +#. i18n: ectx: property (text), widget (QLabel, label) +#: pagerConfig.ui:81 +msgid "Display icons:" +msgstr "प्रदर्शक चिह्न:" + +#. i18n: ectx: property (text), widget (QLabel, currentLabel) +#: pagerConfig.ui:101 +msgid "Selecting current desktop:" +msgstr "" + +#. i18n: ectx: property (text), widget (QRadioButton, doNothingRadioButton) +#: pagerConfig.ui:111 +msgid "Does nothing" +msgstr "" + +#. i18n: ectx: property (text), widget (QRadioButton, showDesktopRadioButton) +#: pagerConfig.ui:121 +msgid "Shows desktop" +msgstr "" + +#. i18n: ectx: property (text), widget (QRadioButton, showDashboardRadioButton) +#: pagerConfig.ui:131 +msgid "Shows the dashboard" +msgstr "" + +#, fuzzy +#~| msgid "Number of rows:" +#~ msgid "Number of columns:" +#~ msgstr "पंक्तियों की संख्या:" + +#~ msgid "Number of rows:" +#~ msgstr "पंक्तियों की संख्या:" + +#~ msgid "Change the number of rows" +#~ msgstr "पंक्तियों की संख्या बदलें" + +#, fuzzy +#~| msgid "&Configure Desktops..." +#~ msgid "&Configure Virtual Desktops..." +#~ msgstr "डेस्कटॉप कॉन्फ़िगर करें... (&C)" + +#~ msgid "Configure Desktops..." +#~ msgstr "डेस्कटॉप कॉन्फ़िगर करें" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_panel.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_panel.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_panel.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_panel.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,26 @@ +# translation of plasma_applet_panel.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@aol.in>, 2008. +msgid "" +msgstr "" +"Project-Id-Version: plasma_applet_panel\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2008-07-09 15:24+0530\n" +"Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" +"Language-Team: Hindi <Indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" + +#: panel.cpp:160 +msgid "Panel Settings" +msgstr "फलक विन्यास" + +#~ msgid "Add Panel" +#~ msgstr "फलक जोड़ें" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_panelspacer_internal.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_panelspacer_internal.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_panelspacer_internal.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_panelspacer_internal.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,24 @@ +# translation of plasma_applet_panelspacer_internal.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Rajesh Ranjan <rajesh672@gmail.com>, 2010. +msgid "" +msgstr "" +"Project-Id-Version: plasma_applet_panelspacer_internal\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2010-01-31 19:38+0530\n" +"Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" +"Language-Team: Hindi <indlinux>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" + +#: panelspacer.cpp:38 +msgid "Set Flexible Size" +msgstr "लचीला आकार सेट करें" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_quicklaunch.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_quicklaunch.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_quicklaunch.po 2013-02-11 21:49:05.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_quicklaunch.po 2013-11-05 12:40:10.000000000 +0000 @@ -8,7 +8,7 @@ msgstr "" "Project-Id-Version: plasma_applet_quicklaunch\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2012-08-20 05:35+0200\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2008-12-04 13:53+0530\n" "Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_sal.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_sal.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_sal.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_sal.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,76 @@ +# translation of plasma_applet_sal.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Rajesh Ranjan <rajesh672@gmail.com>, 2010. +msgid "" +msgstr "" +"Project-Id-Version: plasma_applet_sal\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2010-01-31 19:39+0530\n" +"Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" +"Language-Team: Hindi <indlinux>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" + +#: runnersconfig.cpp:41 +msgid "Available Features" +msgstr "उपलब्ध विशेषताएँ" + +#: sal.cpp:122 +msgid "Configure Search and Launch" +msgstr "ढूंढें और लांच करें कॉन्फ़िगर करें" + +#: sal.cpp:134 sal.cpp:518 +msgid "Lock Page" +msgstr "पृष्ठ लॉक करें" + +#: sal.cpp:150 +msgid "Next activity" +msgstr "अगला गतिविधि" + +#: sal.cpp:152 +msgid "Previous activity" +msgstr "पिछला गतिविधि" + +#: sal.cpp:205 +msgid "Back" +msgstr "पीछे" + +#: sal.cpp:217 +msgid "Search..." +msgstr "" + +#: sal.cpp:271 +msgid "Add applications" +msgstr "" + +#: sal.cpp:511 +msgid "Unlock Page" +msgstr "पृष्ठ खोलें" + +#: sal.cpp:705 +msgctxt "" +"Title of the page that lets the user choose the loaded krunner plugins" +msgid "Search plugins" +msgstr "प्लगिन ढूंढें" + +#: sal.cpp:713 +msgctxt "" +"Title of the page that lets the user choose what entries will be allowed in " +"the main menu" +msgid "Main menu" +msgstr "" + +#: sal.cpp:727 +msgid "Keyboard Shortcut" +msgstr "" + +#~ msgid "Enter your query here" +#~ msgstr "प्रश्न यहाँ दर्ज करें" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_saverdesktop.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_saverdesktop.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_saverdesktop.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_saverdesktop.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,40 @@ +# translation of plasma_containment_saverdesktop.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# G Karunakar <karunakar@indlinux.org>, 2008. +# Rajesh Ranjan <rranjan@redhat.com>, 2008. +msgid "" +msgstr "" +"Project-Id-Version: plasma_containment_saverdesktop\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2008-12-04 14:01+0530\n" +"Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" + +#: desktop.cpp:98 +msgid "Settings" +msgstr "विन्यास" + +#~ msgid "Quit" +#~ msgstr "बाहर जाएँ" + +#~ msgid "Unlock and Quit" +#~ msgstr "तालाखोलें और बाहर जाएँ" + +#~ msgid "Lock" +#~ msgstr "तालाबंद" + +#~ msgid "Unlock" +#~ msgstr "तालाखोलें" + +#~ msgid "Unlock Plasma Widgets" +#~ msgstr "प्लाजमा विजेट्स को खोलें" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_appletscriptengine_dashboard.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_appletscriptengine_dashboard.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_appletscriptengine_dashboard.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_appletscriptengine_dashboard.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,37 @@ +# translation of plasma_appletscriptengine_dashboard.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@aol.in>, 2008. +# Rajesh Ranjan <rranjan@redhat.com>, 2008. +msgid "" +msgstr "" +"Project-Id-Version: plasma_appletscriptengine_dashboard\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2008-12-04 13:53+0530\n" +"Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" + +#: bundle.cpp:313 +msgid "Main Webpage" +msgstr "मुख्य जालपृष्ठ" + +#: bundle.cpp:320 webapplet_package.cpp:37 +msgid "Root HTML directory" +msgstr "रूट HTML निर्देशिका" + +#: plasmawebapplet.cpp:163 +msgid "Inspect this widget" +msgstr "" + +#: webapplet_package.cpp:33 webapplet_package.cpp:46 +msgid "Main Script File" +msgstr "मुख्य स्क्रिप्ट फ़ाइल" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_searchbox.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_searchbox.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_searchbox.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_searchbox.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,24 @@ +# translation of plasma_applet_searchbox.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Rajesh Ranjan <rajesh672@gmail.com>, 2010. +msgid "" +msgstr "" +"Project-Id-Version: plasma_applet_searchbox\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2010-01-31 19:40+0530\n" +"Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" +"Language-Team: Hindi <indlinux>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" + +#: searchbox.cpp:72 +msgid "Enter your query here" +msgstr "अपना प्रश्न यहाँ डालें" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_system-monitor.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_system-monitor.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_system-monitor.po 2014-01-08 03:15:59.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_system-monitor.po 2013-12-25 06:06:17.000000000 +0000 @@ -8,7 +8,7 @@ msgstr "" "Project-Id-Version: plasma_applet_system-monitor\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-01-08 01:37+0000\n" +"POT-Creation-Date: 2013-12-25 05:10+0000\n" "PO-Revision-Date: 2008-12-04 13:56+0530\n" "Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_systemtray.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_systemtray.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_systemtray.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_systemtray.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,226 @@ +# translation of plasma_applet_systemtray.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# G Karunakar <karunakar@indlinux.org>, 2008. +# Rajesh Ranjan <rranjan@redhat.com>, 2008. +msgid "" +msgstr "" +"Project-Id-Version: plasma_applet_systemtray\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2008-12-04 13:57+0530\n" +"Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" + +#: package/contents/ui/ArrowArea.qml:57 +#, fuzzy +#| msgid "Visible icons:" +msgid "Hide icons" +msgstr "दृष्टिगोचर चिह्न:" + +#: package/contents/ui/ArrowArea.qml:57 +#, fuzzy +#| msgid "Visible icons:" +msgid "Show hidden icons" +msgstr "दृष्टिगोचर चिह्न:" + +#: ui/applet.cpp:407 +msgid "Display" +msgstr "" + +#: ui/applet.cpp:409 +msgid "Choose which information to show" +msgstr "" + +#: ui/applet.cpp:410 +msgid "Entries" +msgstr "" + +#: ui/applet.cpp:471 +msgctxt "Item will be automatically shown or hidden from the systray" +msgid "Auto" +msgstr "" + +#: ui/applet.cpp:472 +#, fuzzy +#| msgid "Hidden icons:" +msgctxt "Item is never visible in the systray" +msgid "Hidden" +msgstr "छुपा हुआ चिह्न:" + +#: ui/applet.cpp:473 +msgctxt "Item is always visible in the systray" +msgid "Always Visible" +msgstr "" + +#: ui/applet.cpp:513 +msgctxt "Categories of items in the systemtray that will be shown or hidden" +msgid "Shown Item Categories" +msgstr "" + +#: ui/applet.cpp:516 +#, fuzzy +#| msgid "Show or hide notifications and jobs" +msgctxt "Systemtray items that describe the status of a generic application" +msgid "Application status" +msgstr "सूचना और कार्य दिखाएँ या छुपाएँ" + +#: ui/applet.cpp:526 +#, fuzzy +#| msgid "Notification from %1" +msgctxt "Items communication related, such as chat or email clients" +msgid "Communications" +msgstr "अधिसूचना %1" + +#: ui/applet.cpp:536 +msgctxt "Items about the status of the system, such as a filesystem indexer" +msgid "System services" +msgstr "" + +#: ui/applet.cpp:546 +msgctxt "Items about hardware, such as battery or volume control" +msgid "Hardware control" +msgstr "" + +#: ui/applet.cpp:556 +msgctxt "Other uncategorized systemtray items" +msgid "Miscellaneous" +msgstr "" + +#: ui/applet.cpp:603 +msgctxt "" +"Extra items to be manually added in the systray, such as little Plasma " +"widgets" +msgid "Extra Items" +msgstr "" + +#. i18n: ectx: property (text), widget (QTreeWidget, icons) +#: ui/autohide.ui:39 +msgid "Item" +msgstr "" + +#. i18n: ectx: property (text), widget (QTreeWidget, icons) +#: ui/autohide.ui:44 +msgid "Visibility" +msgstr "" + +#. i18n: ectx: property (text), widget (QTreeWidget, icons) +#: ui/autohide.ui:49 +msgid "Keyboard Shortcut" +msgstr "" + +#. i18n: ectx: property (text), widget (QLabel, unlockLabel) +#: ui/visibleitems.ui:26 +msgid "Widgets are currently locked, disabling some options." +msgstr "" + +#. i18n: ectx: property (text), widget (QPushButton, unlockButton) +#: ui/visibleitems.ui:54 +msgid "Unlock Widgets" +msgstr "" + +#, fuzzy +#~| msgid "Notification from %1" +#~ msgid "statusnotifierwatcher" +#~ msgstr "अधिसूचना %1" + +#~ msgid "Notification from %1" +#~ msgstr "अधिसूचना %1" + +#~ msgid "Pause job" +#~ msgstr "कार्य ठहराएँ" + +#~ msgid "Resume job" +#~ msgstr "कार्य पुनरारंभ करें" + +#~ msgid "Cancel job" +#~ msgstr "कार्य रद्द करें" + +#, fuzzy +#~| msgid "(finished) %1" +#~ msgctxt "" +#~ "%1 is the name of the job, can be things like Copying, deleting, moving" +#~ msgid "%1 [Paused]" +#~ msgstr "पूर्ण %1" + +#, fuzzy +#~| msgid "(paused) %1" +#~ msgid "Paused" +#~ msgstr "ठहरा है %1" + +#, fuzzy +#~| msgid "(finished) %1" +#~ msgctxt "" +#~ "%1 is the name of the job, can be things like Copying, deleting, moving" +#~ msgid "%1 [Finished]" +#~ msgstr "पूर्ण %1" + +#~ msgid "No notifications and no jobs" +#~ msgstr "सूचना नहीं और काम नहीं" + +#, fuzzy +#~| msgid "Notification from %1" +#~ msgid "Notifications" +#~ msgstr "अधिसूचना %1" + +#, fuzzy +#~| msgid "(finished) %1" +#~ msgid "%1 [Finished]" +#~ msgstr "पूर्ण %1" + +#, fuzzy +#~| msgid "Notification from %1" +#~ msgid "%1 notification" +#~ msgid_plural "%1 notifications" +#~ msgstr[0] "अधिसूचना %1" +#~ msgstr[1] "अधिसूचना %1" + +#, fuzzy +#~| msgid "Notification from %1" +#~ msgid "No active jobs or notifications" +#~ msgstr "अधिसूचना %1" + +#, fuzzy +#~| msgid "No notifications and no jobs" +#~ msgid "Notifications and jobs" +#~ msgstr "सूचना नहीं और काम नहीं" + +#~ msgid "Show or hide notifications and jobs" +#~ msgstr "सूचना और कार्य दिखाएँ या छुपाएँ" + +#, fuzzy +#~| msgid "Notification from %1" +#~ msgid "Jobs & Notifications" +#~ msgstr "अधिसूचना %1" + +#, fuzzy +#~| msgid "Notification from %1" +#~ msgid "Recent notifications" +#~ msgstr "अधिसूचना %1" + +#, fuzzy +#~| msgid "(paused) %1" +#~ msgctxt "" +#~ "%1 is the name of the job, can be things like Copying, deleting, moving" +#~ msgid "(paused) %1" +#~ msgstr "ठहरा है %1" + +#, fuzzy +#~| msgid "(finished) %1" +#~ msgctxt "" +#~ "%1 is the name of the job, can be things like Copying, deleting, moving" +#~ msgid "(finished) %1" +#~ msgstr "पूर्ण %1" + +#, fuzzy +#~| msgid "toggle visibility of notifications and jobs" +#~ msgid "Toggle visibility of notifications and jobs" +#~ msgstr "सूचना और कार्य टॉगल करें" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_tasks.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_tasks.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_tasks.po 2014-03-25 04:40:13.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_tasks.po 2013-11-05 12:40:10.000000000 +0000 @@ -8,7 +8,7 @@ msgstr "" "Project-Id-Version: plasma_applet_tasks\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-25 01:54+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2008-12-04 13:59+0530\n" "Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -20,135 +20,138 @@ "Plural-Forms: nplurals=2; plural=(n!=1);\n" "\n" -#: package/contents/ui/ConfigGeneral.qml:29 +#: package/contents/ui/main.qml:112 +#, fuzzy +#| msgctxt "Which virtual desktop a window is currently on" +#| msgid "On %1" +msgid "On %1" +msgstr "%1 पर" + +#: package/contents/ui/main.qml:117 +msgctxt "Which virtual desktop a window is currently on" +msgid "Available on all activities" +msgstr "" + +#: package/contents/ui/main.qml:121 +msgctxt "Activities a window is currently on (apart from the current one)" +msgid "Also available on %1" +msgstr "" + +#: package/contents/ui/main.qml:126 +msgctxt "Which activities a window is currently on" +msgid "Available on %1" +msgstr "" + +#: tasks.cpp:476 msgid "General" msgstr "सामान्य" -#: package/contents/ui/ConfigGeneral.qml:45 +#: tasks.cpp:486 +msgid "Do Not Group" +msgstr "समूहित मत करें" + +#: tasks.cpp:489 +msgid "By Program Name" +msgstr "प्रोग्राम नाम से" + +#: tasks.cpp:511 +msgid "Do Not Sort" +msgstr "मत छांटें" + +#: tasks.cpp:512 +msgid "Manually" +msgstr "हस्तचालित" + +#: tasks.cpp:513 +msgid "Alphabetically" +msgstr "वर्णक्रम में" + +#: tasks.cpp:514 +msgid "By Desktop" +msgstr "डेस्कटॉप से" + +#: tasks.cpp:515 +msgid "By Activity" +msgstr "" + +#. i18n: ectx: property (text), widget (QLabel, label_5) +#: tasksConfig.ui:29 msgid "Appearance" msgstr "रूप" -#: package/contents/ui/ConfigGeneral.qml:51 +#. i18n: ectx: property (text), widget (QLabel, label_7) +#: tasksConfig.ui:36 #, fuzzy #| msgid "Force row settings:" msgid "Force row settings" msgstr "पंक्ति सेटिंग बाध्य करें:" -#: package/contents/ui/ConfigGeneral.qml:56 +#. i18n: ectx: property (text), widget (QLabel, label_8) +#: tasksConfig.ui:56 #, fuzzy #| msgid "Show tooltips:" msgid "Show tooltips" msgstr "टूलटिप दिखाएँ:" -#: package/contents/ui/ConfigGeneral.qml:61 +#. i18n: ectx: property (text), widget (QLabel, label_9) +#: tasksConfig.ui:76 msgid "Highlight windows" msgstr "" -#: package/contents/ui/ConfigGeneral.qml:66 +#. i18n: ectx: property (text), widget (QLabel, label_3) +#: tasksConfig.ui:96 msgid "Maximum rows:" msgstr "अधिकतम पंक्तियाँ:" -#: package/contents/ui/ConfigGeneral.qml:77 +#. i18n: ectx: property (text), widget (QLabel, label_6) +#: tasksConfig.ui:148 #, fuzzy #| msgid "Grouping & Sorting" msgid "Grouping and Sorting" msgstr "समूहबद्धता और छांटना" -#: package/contents/ui/ConfigGeneral.qml:83 +#. i18n: ectx: property (text), widget (QLabel, label) +#: tasksConfig.ui:155 msgid "Grouping:" msgstr "समूहबद्धता:" -#: package/contents/ui/ConfigGeneral.qml:88 -msgid "Do Not Group" -msgstr "समूहित मत करें" - -#: package/contents/ui/ConfigGeneral.qml:88 -#: package/contents/ui/ConfigGeneral.qml:104 -msgid "Manually" -msgstr "हस्तचालित" - -#: package/contents/ui/ConfigGeneral.qml:88 -msgid "By Program Name" -msgstr "प्रोग्राम नाम से" - -#: package/contents/ui/ConfigGeneral.qml:94 -#, fuzzy -#| msgid "Only when the taskbar is full" -msgid "Only when the task manager is full" +#. i18n: ectx: property (text), widget (QLabel, label_10) +#: tasksConfig.ui:195 +msgid "Only when the taskbar is full" msgstr "सिर्फ तभी जब कार्यपट्टी भरा है" -#: package/contents/ui/ConfigGeneral.qml:99 +#. i18n: ectx: property (text), widget (QLabel, label_2) +#: tasksConfig.ui:221 msgid "Sorting:" msgstr "छांटा जा रहा है:" -#: package/contents/ui/ConfigGeneral.qml:104 -msgid "Do Not Sort" -msgstr "मत छांटें" - -#: package/contents/ui/ConfigGeneral.qml:104 -msgid "Alphabetically" -msgstr "वर्णक्रम में" - -#: package/contents/ui/ConfigGeneral.qml:104 -msgid "By Desktop" -msgstr "डेस्कटॉप से" - -#: package/contents/ui/ConfigGeneral.qml:104 -msgid "By Activity" -msgstr "" - -#: package/contents/ui/ConfigGeneral.qml:111 +#. i18n: ectx: property (text), widget (QLabel, label_4) +#: tasksConfig.ui:273 msgid "Filters" msgstr "फ़िल्टर्स" -#: package/contents/ui/ConfigGeneral.qml:117 -#, fuzzy -#| msgid "Only show tasks from the current screen" -msgid "Show only tasks from the current screen" +#. i18n: ectx: property (text), widget (QLabel, label_11) +#: tasksConfig.ui:280 +msgid "Only show tasks from the current screen" msgstr "सिर्फ मौजूदा स्क्रीन से कार्यों को दिखाएँ" -#: package/contents/ui/ConfigGeneral.qml:122 -#, fuzzy -#| msgid "Only show tasks from the current desktop" -msgid "Show only tasks from the current desktop" +#. i18n: ectx: property (text), widget (QLabel, label_12) +#: tasksConfig.ui:300 +msgid "Only show tasks from the current desktop" msgstr "सिर्फ मौजूदा डेस्कटॉप से कार्यों को दिखाएँ" -#: package/contents/ui/ConfigGeneral.qml:127 +#. i18n: ectx: property (text), widget (QLabel, label_14) +#: tasksConfig.ui:320 #, fuzzy #| msgid "Only show tasks from the current screen" -msgid "Show only tasks from the current activity" +msgid "Only show tasks from the current activity" msgstr "सिर्फ मौजूदा स्क्रीन से कार्यों को दिखाएँ" -#: package/contents/ui/ConfigGeneral.qml:132 -#, fuzzy -#| msgid "Only show tasks that are minimized" -msgid "Show only tasks that are minimized" +#. i18n: ectx: property (text), widget (QLabel, label_13) +#: tasksConfig.ui:340 +msgid "Only show tasks that are minimized" msgstr "सिर्फ न्यूनतम किए कार्यों को दिखाएँ" -#: package/contents/ui/Task.qml:175 -#, fuzzy, kde-format -#| msgctxt "Which virtual desktop a window is currently on" -#| msgid "On %1" -msgid "On %1" -msgstr "%1 पर" - -#: package/contents/ui/Task.qml:180 -msgctxt "Which virtual desktop a window is currently on" -msgid "Available on all activities" -msgstr "" - -#: package/contents/ui/Task.qml:184 -#, kde-format -msgctxt "Activities a window is currently on (apart from the current one)" -msgid "Also available on %1" -msgstr "" - -#: package/contents/ui/Task.qml:189 -#, kde-format -msgctxt "Which activities a window is currently on" -msgid "Available on %1" -msgstr "" - #~ msgid "Collapse Group" #~ msgstr "समूह सिकोड़ें" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_trash.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_trash.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_trash.po 2014-02-07 03:47:07.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_trash.po 2013-11-05 12:40:10.000000000 +0000 @@ -8,7 +8,7 @@ msgstr "" "Project-Id-Version: plasma_applet_trash\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-02-07 01:46+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2008-12-04 14:00+0530\n" "Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -20,77 +20,61 @@ "\n" "X-Generator: KBabel 1.11.4\n" -#: contents/ui/main.qml:68 -#, fuzzy -#| msgid "Trash" -msgid "" -"Trash\n" -"Empty" +#: trash.cpp:115 trash.cpp:131 trash.cpp:164 trash.cpp:249 +msgid "Trash" msgstr "रद्दी" -#: contents/ui/main.qml:68 contents/ui/main.qml:80 -#, fuzzy, kde-format -#| msgid "One item" -#| msgid_plural "%1 items" -msgid "" -"Trash\n" -"One item" -msgid_plural "" -"Trash\n" -" %1 items" +#: trash.cpp:123 +msgid "&Open" +msgstr "खोलें (&O)" + +#: trash.cpp:127 trash.cpp:243 +msgid "&Empty Trashcan" +msgstr "रद्दी की टोकरी खाली करें (&E)" + +#: trash.cpp:136 +msgid "&Menu" +msgstr "मेन्यू (&M)" + +#: trash.cpp:165 trash.cpp:254 trash.cpp:256 +#, kde-format +msgid "One item" +msgid_plural "%1 items" msgstr[0] "एक वस्तु" msgstr[1] "%1 वस्तुएँ" -#: contents/ui/main.qml:79 -msgid "Trash" -msgstr "रद्दी" - -#: contents/ui/main.qml:80 -msgid "" -"Trash \n" -" Empty" +#: trash.cpp:201 +msgctxt "@info" +msgid "Do you really want to empty the trash? All items will be deleted." msgstr "" +"क्या आप सचमुच रद्दी की टोकरी को खाली करना चाहते हैं? सभी वस्तुओं को मिटा दिया जाएगा." -#: contents/ui/main.qml:88 contents/ui/main.qml:90 +#: trash.cpp:203 #, fuzzy #| msgctxt "@action:button" #| msgid "Empty Trash" +msgctxt "@title:window" msgid "Empty Trash" msgstr "रद्दी खाली करें" -#: contents/ui/main.qml:89 +#: trash.cpp:205 #, fuzzy -#| msgctxt "@info" -#| msgid "Do you really want to empty the trash? All items will be deleted." -msgid "Do you really want to empty the trash ? All the items will be deleted." -msgstr "" -"क्या आप सचमुच रद्दी की टोकरी को खाली करना चाहते हैं? सभी वस्तुओं को मिटा दिया जाएगा." +#| msgctxt "@action:button" +#| msgid "Empty Trash" +msgid "Empty Trash" +msgstr "रद्दी खाली करें" -#: contents/ui/main.qml:91 +#: trash.cpp:206 msgid "Cancel" msgstr "" -#~ msgid "&Open" -#~ msgstr "खोलें (&O)" - -#~ msgid "&Empty Trashcan" -#~ msgstr "रद्दी की टोकरी खाली करें (&E)" - -#~ msgid "&Menu" -#~ msgstr "मेन्यू (&M)" - -#, fuzzy -#~| msgctxt "@action:button" -#~| msgid "Empty Trash" -#~ msgctxt "@title:window" -#~ msgid "Empty Trash" -#~ msgstr "रद्दी खाली करें" - +#: trash.cpp:224 #, fuzzy -#~| msgid "&Empty Trashcan" -#~ msgid "Emptying Trashcan..." -#~ msgstr "रद्दी की टोकरी खाली करें (&E)" - -#~ msgctxt "The trash is empty. This is not an action, but a state" -#~ msgid "Empty" -#~ msgstr "रिक्त" +#| msgid "&Empty Trashcan" +msgid "Emptying Trashcan..." +msgstr "रद्दी की टोकरी खाली करें (&E)" + +#: trash.cpp:261 trash.cpp:263 +msgctxt "The trash is empty. This is not an action, but a state" +msgid "Empty" +msgstr "रिक्त" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_webbrowser.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_webbrowser.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_applet_webbrowser.po 2013-02-11 21:49:05.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_applet_webbrowser.po 2013-11-05 12:40:10.000000000 +0000 @@ -8,7 +8,7 @@ msgstr "" "Project-Id-Version: plasma_applet_webbrowser\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2012-08-20 05:35+0200\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2008-12-04 14:00+0530\n" "Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_containmentactions_contextmenu.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_containmentactions_contextmenu.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_containmentactions_contextmenu.po 2013-12-19 03:27:50.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_containmentactions_contextmenu.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: plasma_containmentactions_contextmenu\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-12-19 01:36+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-01-31 19:48+0530\n" "Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" "Language-Team: Hindi <indlinux>\n" @@ -20,30 +20,30 @@ "\n" "\n" -#: menu.cpp:98 +#: menu.cpp:99 msgid "Run Command..." msgstr "कमांड चलाएँ..." -#: menu.cpp:102 +#: menu.cpp:103 msgid "Lock Screen" msgstr "स्क्रीन पर ताला लगाएँ" -#: menu.cpp:106 +#: menu.cpp:107 msgid "Leave..." msgstr "छोड़ें..." -#: menu.cpp:246 +#: menu.cpp:253 msgid "Configure Contextual Menu Plugin" msgstr "संदर्भ मेन्यू प्लगइन कॉन्फ़िगर करें" -#: menu.cpp:256 +#: menu.cpp:263 msgid "[Other Actions]" msgstr "[अन्य क्रियाएं]" -#: menu.cpp:259 +#: menu.cpp:266 msgid "Wallpaper Actions" msgstr "वालपेपर क्रियाएं" -#: menu.cpp:263 +#: menu.cpp:270 msgid "[Separator]" msgstr "[Separator]" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_containmentactions_switchactivity.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_containmentactions_switchactivity.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_containmentactions_switchactivity.po 2011-09-14 00:21:35.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_containmentactions_switchactivity.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: plasma_containmentactions_switchactivity\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2011-08-02 05:39+0200\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-01-31 19:40+0530\n" "Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" "Language-Team: Hindi <indlinux>\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_containmentactions_switchdesktop.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_containmentactions_switchdesktop.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_containmentactions_switchdesktop.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_containmentactions_switchdesktop.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,25 @@ +# translation of plasma_containmentactions_switchdesktop.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Rajesh Ranjan <rajesh672@gmail.com>, 2010. +msgid "" +msgstr "" +"Project-Id-Version: plasma_containmentactions_switchdesktop\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2010-01-31 19:48+0530\n" +"Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" +"Language-Team: Hindi <indlinux>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" +"\n" + +#: desktop.cpp:34 desktop.cpp:62 +msgid "Virtual Desktops" +msgstr "आभासी डेस्कटॉप" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_containmentactions_switchwindow.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_containmentactions_switchwindow.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_containmentactions_switchwindow.po 2013-02-11 21:49:05.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_containmentactions_switchwindow.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: plasma_containmentactions_switchwindow\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2012-08-20 05:35+0200\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-01-31 19:49+0530\n" "Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" "Language-Team: Hindi <indlinux>\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma-desktop.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma-desktop.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma-desktop.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma-desktop.po 2014-03-02 07:58:15.000000000 +0000 @@ -0,0 +1,437 @@ +# translation of plasma.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Ravishankar Shrivastava <raviratlami@yahoo.com>, 2007. +# Rajesh Ranjan <rranjan@redhat.com>, 2008. +msgid "" +msgstr "" +"Project-Id-Version: plasma\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2014-03-02 06:58+0000\n" +"PO-Revision-Date: 2008-12-04 13:12+0530\n" +"Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" + +msgctxt "NAME OF TRANSLATORS" +msgid "Your names" +msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर" + +msgctxt "EMAIL OF TRANSLATORS" +msgid "Your emails" +msgstr "raviratlami@aol.in" + +#: activitymanager/activitymanager.cpp:293 +#, fuzzy +#| msgid "New Theme..." +msgid "Get New Templates..." +msgstr "नया प्रसंग..." + +#: controllerwindow.cpp:397 +#, fuzzy +#| msgid "Next Activity" +msgid "Activities" +msgstr "अगला क्रियाकलाप" + +#: dashboardview.cpp:108 +msgid "Hide Dashboard" +msgstr "डैश बोर्ड छिपाएँ" + +#: dashboardview.cpp:156 +msgid "Widget Dashboard" +msgstr "विजेट डैशबोर्ड" + +#. i18n: ectx: label, entry, group (General) +#: data/plasma-shell-desktop.kcfg:10 +msgid "The font to use on the desktop" +msgstr "" + +#. i18n: ectx: label, entry, group (General) +#: data/plasma-shell-desktop.kcfg:15 +msgid "" +"Set to true if each virtual desktop should get its own, unique Plasma view." +msgstr "" + +#: desktopcorona.cpp:106 +msgid "Next Activity" +msgstr "अगला क्रियाकलाप" + +#: desktopcorona.cpp:112 +msgid "Previous Activity" +msgstr "पिछला क्रियाकलाप" + +#: desktopcorona.cpp:118 +#, fuzzy +#| msgid "Next Activity" +msgid "Stop Current Activity" +msgstr "अगला क्रियाकलाप" + +#: desktopcorona.cpp:163 desktopcorona.cpp:169 +msgid "Add Panel" +msgstr "" + +#: desktopcorona.cpp:635 desktopcorona.cpp:666 plasmaapp.cpp:1470 +#, fuzzy +#| msgid "Next Activity" +msgctxt "Default name for a new activity" +msgid "New Activity" +msgstr "अगला क्रियाकलाप" + +#: interactiveconsole.cpp:70 +msgid "&Execute" +msgstr "" + +#: interactiveconsole.cpp:71 +msgctxt "Toolbar Button to switch to Plasma Scripting Mode" +msgid "Plasma" +msgstr "" + +#: interactiveconsole.cpp:72 +msgctxt "Toolbar Button to switch to KWin Scripting Mode" +msgid "KWin" +msgstr "" + +#: interactiveconsole.cpp:73 +msgid "Templates" +msgstr "" + +#: interactiveconsole.cpp:81 +#, fuzzy +#| msgid "Desktop Settings" +msgid "Desktop Shell Scripting Console" +msgstr "डेस्कटॉप समायोजन" + +#: interactiveconsole.cpp:88 +#, fuzzy +#| msgid "Monitor" +msgid "Editor" +msgstr "मॉनीटर" + +#: interactiveconsole.cpp:99 +msgid "Load" +msgstr "" + +#: interactiveconsole.cpp:105 +msgid "Use" +msgstr "" + +#: interactiveconsole.cpp:162 +msgid "Output" +msgstr "" + +#: interactiveconsole.cpp:245 +#, kde-format +msgid "Unable to load script file <b>%1</b>" +msgstr "" + +#: interactiveconsole.cpp:296 +msgid "Open Script File" +msgstr "" + +#: interactiveconsole.cpp:424 +msgid "Save Script File" +msgstr "" + +#: interactiveconsole.cpp:510 +#, kde-format +msgid "Executing script at %1" +msgstr "" + +#: interactiveconsole.cpp:549 +#, no-c-format, kde-format +msgid "Runtime: %1ms" +msgstr "" + +#: main.cpp:45 +msgid "The KDE desktop, panels and widgets workspace application." +msgstr "केडीई डेस्कटॉप, फलक तथा विजेट कार्यस्थान अनुप्रयोग." + +#: main.cpp:106 +#, fuzzy +#| msgid "Desktop Theme" +msgid "Plasma Desktop Shell" +msgstr "डेस्कटॉप प्रसंग" + +#: main.cpp:108 +#, fuzzy +#| msgid "Copyright 2006-2007, The KDE Team" +msgid "Copyright 2006-2009, The KDE Team" +msgstr "सर्वाधिकार २००६-२००७, केडीई टोली" + +#: main.cpp:109 +msgid "Aaron J. Seigo" +msgstr "एरॉन जे. सीगो" + +#: main.cpp:110 +msgid "Author and maintainer" +msgstr "लेखक तथा मेंटेनर" + +#: main.cpp:112 +msgid "John Lions" +msgstr "जॉन लॉयन्स" + +#: main.cpp:113 +msgid "In memory of his contributions, 1937-1998." +msgstr "उनके द्वारा दिए गए सहयोग की याद में, १९३७-१९९८" + +#: panelcontroller.cpp:138 +msgid "Panel Alignment" +msgstr "पैनल संरेखन" + +#: panelcontroller.cpp:141 panelcontroller.cpp:407 +msgid "Left" +msgstr "बायाँ" + +#: panelcontroller.cpp:147 +msgid "Center" +msgstr "बीच में" + +#: panelcontroller.cpp:152 panelcontroller.cpp:408 +msgid "Right" +msgstr "दायाँ" + +#: panelcontroller.cpp:163 +msgid "Visibility" +msgstr "दृश्यता" + +#: panelcontroller.cpp:166 +msgid "Always visible" +msgstr "हमेशा दृष्टिगोचर " + +#: panelcontroller.cpp:171 +#, fuzzy +#| msgid "Auto hide" +msgid "Auto-hide" +msgstr "स्वतः छिपाएँ" + +#: panelcontroller.cpp:176 +msgid "Windows can cover" +msgstr "विंडोज कवर कर सकता है" + +#: panelcontroller.cpp:181 +#, fuzzy +#| msgid "Windows can cover" +msgid "Windows go below" +msgstr "विंडोज कवर कर सकता है" + +#: panelcontroller.cpp:187 +msgid "Screen Edge" +msgstr "स्क्रीन किनारा" + +#: panelcontroller.cpp:191 +msgid "Press left mouse button and drag to a screen edge to change panel edge" +msgstr "" + +#: panelcontroller.cpp:194 panelcontroller.cpp:404 +msgid "Height" +msgstr "ऊँचाई" + +#: panelcontroller.cpp:197 +msgid "Press left mouse button and drag vertically to change panel height" +msgstr "" + +#: panelcontroller.cpp:205 +msgid "More Settings" +msgstr "अधिक सेटिंग" + +#: panelcontroller.cpp:206 +msgid "Show more options about panel alignment, visibility and other settings" +msgstr "" + +#: panelcontroller.cpp:218 +msgid "Maximize Panel" +msgstr "पैनल अधिकतम करें" + +#: panelcontroller.cpp:224 +msgid "Close this configuration window" +msgstr "इस विन्यास विंडो को बंद करें" + +#: panelcontroller.cpp:273 +msgid "Add Spacer" +msgstr "" + +#: panelcontroller.cpp:276 +msgid "Add a spacer to the panel useful to add some space between two widgets" +msgstr "" + +#: panelcontroller.cpp:393 +msgid "Width" +msgstr "चौड़ाई" + +#: panelcontroller.cpp:396 +msgid "Top" +msgstr "ऊपर" + +#: panelcontroller.cpp:397 +msgid "Bottom" +msgstr "नीचे" + +#: plasmaapp.cpp:266 +msgid "Show Dashboard" +msgstr "डैश बोर्ड दिखाएँ" + +#: plasmaapp.cpp:845 +#, fuzzy +#| msgid "Next Activity" +msgid "Activities..." +msgstr "अगला क्रियाकलाप" + +#: plasmaapp.cpp:1268 +#, kde-format +msgctxt "%1 is the activity name" +msgid "Copy of %1" +msgstr "" + +#: plasmaapp.cpp:1411 +#, kde-format +msgid "" +"A new widget has become available on the network:<br><b>%1</b> - <i>%2</i>" +msgstr "" + +#: plasmaapp.cpp:1422 +#, fuzzy +#| msgid "Next Activity" +msgid "Unlock and add to current activity" +msgstr "अगला क्रियाकलाप" + +#: plasmaapp.cpp:1425 +#, fuzzy +#| msgid "Next Activity" +msgid "Add to current activity" +msgstr "अगला क्रियाकलाप" + +#: plasmaapp.cpp:1505 +msgid "Run applications" +msgstr "" + +#: plasmaapp.cpp:1506 +msgid "This activity template requests to run the following applications" +msgstr "" + +#: plasmaapp.cpp:1507 +msgid "Run selected" +msgstr "" + +#: plasmaapp.cpp:1508 +msgid "Run none" +msgstr "" + +#: positioningruler.cpp:465 +msgid "Move this slider to set the panel position" +msgstr "पैनल स्थिति सेट करने के लिए इस स्लाइडर को खिसकाएँ" + +#: positioningruler.cpp:468 +msgid "Move this slider to set the maximum panel size" +msgstr "पैनल आकार अधिकतम करने के लिए इस स्लाइडर को खिसकाएँ" + +#: positioningruler.cpp:471 +msgid "Move this slider to set the minimum panel size" +msgstr "पैनल आकार न्यूनतम करने के लिए इस स्लाइडर को खिसकाएँ" + +#, fuzzy +#~| msgid "Next Activity" +#~ msgid "Remove activity?" +#~ msgstr "अगला क्रियाकलाप" + +#, fuzzy +#~| msgid "Next Activity" +#~ msgid "Configure activity" +#~ msgstr "अगला क्रियाकलाप" + +#, fuzzy +#~| msgid "Desktop Activity" +#~ msgid "Stop activity" +#~ msgstr "डेस्कटॉप क्रियाकलाप" + +#, fuzzy +#~| msgid "Desktop Activity" +#~ msgid "Start activity" +#~ msgstr "डेस्कटॉप क्रियाकलाप" + +#~ msgid "Add Widgets" +#~ msgstr "विजेट जोड़ें" + +#, fuzzy +#~| msgid "Next Activity" +#~ msgid "Create Activity" +#~ msgstr "अगला क्रियाकलाप" + +#, fuzzy +#~| msgid "Desktop" +#~ msgid "Empty Desktop" +#~ msgstr "डेस्कटॉप" + +#, fuzzy +#~| msgid "Next Activity" +#~ msgid "Clone current activity" +#~ msgstr "अगला क्रियाकलाप" + +#, fuzzy +#~| msgid "Next Activity" +#~ msgctxt "Action used to create a new activity" +#~ msgid "New Activity" +#~ msgstr "अगला क्रियाकलाप" + +#, fuzzy +#~| msgid "Next Activity" +#~ msgid "Activity name" +#~ msgstr "अगला क्रियाकलाप" + +#~ msgid "Plasma Workspace" +#~ msgstr "प्लाज़्मा कार्यस्थान" + +#, fuzzy +#~| msgid "Next Activity" +#~ msgid "Add Activity" +#~ msgstr "अगला क्रियाकलाप" + +#, fuzzy +#~| msgid "Desktop Settings" +#~ msgid "Plasma Settings" +#~ msgstr "डेस्कटॉप समायोजन" + +#, fuzzy +#~| msgid "Center" +#~ msgid "Ctrl" +#~ msgstr "बीच में" + +#, fuzzy +#~| msgid "Name:" +#~ msgid "Name" +#~ msgstr "नाम:" + +#, fuzzy +#~| msgid "Bottom" +#~ msgid "Button:" +#~ msgstr "नीचे" + +#~ msgid "Desktop Settings" +#~ msgstr "डेस्कटॉप समायोजन" + +#~ msgid "Wallpaper" +#~ msgstr "वालपेपर" + +#~ msgid "" +#~ "This picture of a monitor contains a preview of what the current settings " +#~ "will look like on your desktop." +#~ msgstr "" +#~ "मॉनीटर का छवि पूर्वावलोकन रखता है कि मौज़ूदा विन्यास आपके डेस्कटॉप में कैसे दिखेगा." + +#~ msgid "Type:" +#~ msgstr "क़िस्मः" + +#~ msgid "Name:" +#~ msgstr "नाम:" + +#~ msgid "Theme:" +#~ msgstr "प्रसंगः" + +#~ msgid "Starts plasma as an ordinary window rather than as the desktop." +#~ msgstr "प्लाज़्मा को एक आम विंडो के रूप में चालू करता है, बजाय डेस्कटॉप के रूप में." diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_engine_keystate.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_engine_keystate.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_engine_keystate.po 2013-09-25 03:30:14.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_engine_keystate.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: plasma_engine_keystate\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-09-25 01:46+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-01-31 19:57+0530\n" "Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" "Language-Team: Hindi <indlinux>\n" @@ -80,15 +80,15 @@ msgid "Second X Button" msgstr "दूसरा एक्स बटन" -#: keystate.cpp:59 keystate.cpp:70 keystate.cpp:99 keystate.cpp:120 -#: keystate.cpp:128 +#: keystate.cpp:58 keystate.cpp:69 keystate.cpp:98 keystate.cpp:119 +#: keystate.cpp:127 msgid "Pressed" msgstr "दबा हुआ" -#: keystate.cpp:60 keystate.cpp:106 keystate.cpp:129 +#: keystate.cpp:59 keystate.cpp:105 keystate.cpp:128 msgid "Latched" msgstr "बंद" -#: keystate.cpp:61 keystate.cpp:113 keystate.cpp:130 +#: keystate.cpp:60 keystate.cpp:112 keystate.cpp:129 msgid "Locked" msgstr "तालाबंद" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_engine_kuiserver.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_engine_kuiserver.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_engine_kuiserver.po 2013-12-09 03:10:30.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_engine_kuiserver.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: plasma_engine_applicationjobs\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-12-09 01:39+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2008-12-02 16:53+0530\n" "Last-Translator: G Karunakar <karunakar@indlinux.org>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -18,18 +18,18 @@ "X-Generator: KBabel 1.11.4\n" "Plural-Forms: nplurals=2; plural=(n!=1);\n" -#: jobaction.cpp:31 +#: jobaction.cpp:30 #, fuzzy, kde-format #| msgid "The JobView for %1 can't be found" msgctxt "%1 is the subject (can be anything) upon which the job is performed" msgid "The JobView for %1 cannot be found" msgstr "%1 के लिए JobView नहीं मिला" -#: jobaction.cpp:45 +#: jobaction.cpp:44 msgid "Job canceled by user." msgstr "" -#: kuiserverengine.cpp:239 +#: kuiserverengine.cpp:232 #, kde-format msgctxt "Byes per second" msgid "%1/s" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_engine_metadata.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_engine_metadata.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_engine_metadata.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_engine_metadata.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,106 @@ +# translation of plasma_engine_metadata.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Rajesh Ranjan <rajesh672@gmail.com>, 2010. +msgid "" +msgstr "" +"Project-Id-Version: plasma_engine_metadata\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2010-01-31 19:58+0530\n" +"Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" +"Language-Team: Hindi <indlinux>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" +"\n" + +#: metadata_engine.cpp:70 metadata_engine.cpp:122 +msgctxt "@label" +msgid "Size" +msgstr "आकार" + +#: metadata_engine.cpp:73 metadata_engine.cpp:116 +msgctxt "@label" +msgid "Source Modified" +msgstr "स्रोत परिवर्धित" + +#: metadata_engine.cpp:112 +msgctxt "@label" +msgid "Model" +msgstr "मॉडल" + +#: metadata_engine.cpp:113 +msgctxt "@label" +msgid "Focal Length" +msgstr "फोकल लंबाई" + +#: metadata_engine.cpp:114 +msgctxt "@label" +msgid "Mime Type" +msgstr "माइम क़िस्म" + +#: metadata_engine.cpp:115 +msgctxt "@label" +msgid "Manufacturer" +msgstr "उत्पादक" + +#: metadata_engine.cpp:117 +msgctxt "@label" +msgid "Orientation" +msgstr "दिशा" + +#: metadata_engine.cpp:118 +msgctxt "@label" +msgid "Flash Used" +msgstr "फ्लैश प्रयुक्त" + +#: metadata_engine.cpp:119 +msgctxt "@label" +msgid "Height" +msgstr "ऊँचाई" + +#: metadata_engine.cpp:120 +msgctxt "@label" +msgid "Width" +msgstr "चौड़ाई" + +#: metadata_engine.cpp:121 +msgctxt "@label" +msgid "Url" +msgstr "यूआरएल" + +#: metadata_engine.cpp:123 +msgctxt "@label" +msgid "Aperture" +msgstr "एपर्चर" + +#: metadata_engine.cpp:124 +msgctxt "@label" +msgid "Metering Mode" +msgstr "मीटरिंग मोड" + +#: metadata_engine.cpp:125 +msgctxt "@label" +msgid "35mm Equivalent" +msgstr "35mm समवर्ती" + +#: metadata_engine.cpp:126 +msgctxt "@label" +msgid "File Extension" +msgstr "फ़ाइल विस्तार" + +#: metadata_engine.cpp:127 +msgctxt "@label" +msgid "Name" +msgstr "नाम" + +#: metadata_engine.cpp:128 +msgctxt "@label" +msgid "Exposure Time" +msgstr "एक्सपोज़र समय" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_engine_network.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_engine_network.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_engine_network.po 2012-08-19 09:34:25.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_engine_network.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: plasma_engine_network\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2012-08-19 05:50+0200\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-01-31 19:58+0530\n" "Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" "Language-Team: Hindi <indlinux>\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_engine_notifications.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_engine_notifications.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_engine_notifications.po 2014-03-22 03:29:17.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_engine_notifications.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: plasma_engine_notifications\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-22 01:48+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-01-31 19:59+0530\n" "Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" "Language-Team: Hindi <indlinux>\n" @@ -20,15 +20,15 @@ "\n" "\n" -#: notificationaction.cpp:33 +#: notificationaction.cpp:31 msgid "The notification dataEngine is not set." msgstr "अधिसूचना dataEngine सेट नहीं है." -#: notificationaction.cpp:43 +#: notificationaction.cpp:41 #, kde-format msgid "Invalid destination: %1" msgstr "अवैध गंतव्य: %1" -#: notificationsengine.cpp:176 +#: notificationsengine.cpp:149 msgid "Unknown Application" msgstr "अज्ञात अनुप्रयोग" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_engine_nowplaying.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_engine_nowplaying.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_engine_nowplaying.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_engine_nowplaying.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,79 @@ +# translation of plasma_engine_nowplaying.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Rajesh Ranjan <rajesh672@gmail.com>, 2010. +msgid "" +msgstr "" +"Project-Id-Version: plasma_engine_nowplaying\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2010-01-31 19:59+0530\n" +"Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" +"Language-Team: Hindi <indlinux>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" +"\n" + +#: playeractionjob.cpp:28 +#, kde-format +msgid "The player '%1' cannot be found." +msgstr "" + +#: playeractionjob.cpp:39 +#, kde-format +msgid "The player '%1' cannot perform the action 'play'." +msgstr "" + +#: playeractionjob.cpp:46 +#, kde-format +msgid "The player '%1' cannot perform the action 'pause'." +msgstr "" + +#: playeractionjob.cpp:53 +#, kde-format +msgid "The player '%1' cannot perform the action 'stop'." +msgstr "" + +#: playeractionjob.cpp:60 +#, kde-format +msgid "The player '%1' cannot perform the action 'previous'." +msgstr "" + +#: playeractionjob.cpp:67 +#, kde-format +msgid "The player '%1' cannot perform the action 'next'." +msgstr "" + +#: playeractionjob.cpp:77 +msgid "The 'level' argument to the 'volume' command must be between 0 and 1." +msgstr "" + +#: playeractionjob.cpp:81 +msgid "The 'volume' command requires a 'level' argument." +msgstr "" + +#: playeractionjob.cpp:85 +#, kde-format +msgid "The player '%1' cannot perform the action 'volume'." +msgstr "" + +#: playeractionjob.cpp:95 +msgid "" +"The 'seconds' argument to the 'seek' command must be between 0 and the " +"length of the track." +msgstr "" + +#: playeractionjob.cpp:100 +msgid "The 'seek' command requires a 'seconds' argument." +msgstr "" + +#: playeractionjob.cpp:104 +#, kde-format +msgid "The player '%1' cannot perform the action 'seek'." +msgstr "" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_engine_rss.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_engine_rss.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_engine_rss.po 2011-09-14 00:21:35.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_engine_rss.po 2013-11-05 12:40:10.000000000 +0000 @@ -8,7 +8,7 @@ msgstr "" "Project-Id-Version: plasma_engine_rss\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2011-08-02 05:39+0200\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2008-12-04 14:07+0530\n" "Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_engine_soliddevice.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_engine_soliddevice.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_engine_soliddevice.po 2013-09-25 03:30:14.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_engine_soliddevice.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: plasma_engine_soliddevice\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-09-25 01:46+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-01-31 20:06+0530\n" "Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" "Language-Team: Hindi <indlinux>\n" @@ -20,744 +20,744 @@ "\n" "\n" -#: soliddeviceengine.cpp:128 +#: soliddeviceengine.cpp:127 msgid "Parent UDI" msgstr "पैरेंट UDI" -#: soliddeviceengine.cpp:129 +#: soliddeviceengine.cpp:128 msgid "Vendor" msgstr "विक्रेता" -#: soliddeviceengine.cpp:130 +#: soliddeviceengine.cpp:129 msgid "Product" msgstr "उत्पाद" -#: soliddeviceengine.cpp:131 +#: soliddeviceengine.cpp:130 msgid "Description" msgstr "" -#: soliddeviceengine.cpp:132 +#: soliddeviceengine.cpp:131 msgid "Icon" msgstr "प्रतीक" -#: soliddeviceengine.cpp:133 soliddeviceengine.cpp:711 +#: soliddeviceengine.cpp:132 soliddeviceengine.cpp:710 msgid "Emblems" msgstr "प्रतीक" -#: soliddeviceengine.cpp:134 soliddeviceengine.cpp:607 -#: soliddeviceengine.cpp:613 soliddeviceengine.cpp:626 +#: soliddeviceengine.cpp:133 soliddeviceengine.cpp:606 +#: soliddeviceengine.cpp:612 soliddeviceengine.cpp:625 #, fuzzy #| msgid "Has State" msgid "State" msgstr "हैस स्थिति" -#: soliddeviceengine.cpp:135 soliddeviceengine.cpp:608 -#: soliddeviceengine.cpp:614 soliddeviceengine.cpp:622 -#: soliddeviceengine.cpp:624 +#: soliddeviceengine.cpp:134 soliddeviceengine.cpp:607 +#: soliddeviceengine.cpp:613 soliddeviceengine.cpp:621 +#: soliddeviceengine.cpp:623 msgid "Operation result" msgstr "" -#: soliddeviceengine.cpp:136 +#: soliddeviceengine.cpp:135 msgid "Timestamp" msgstr "" -#: soliddeviceengine.cpp:144 +#: soliddeviceengine.cpp:143 msgid "Processor" msgstr "प्रोसेसर" -#: soliddeviceengine.cpp:145 +#: soliddeviceengine.cpp:144 msgid "Number" msgstr "संख्या" -#: soliddeviceengine.cpp:146 +#: soliddeviceengine.cpp:145 msgid "Max Speed" msgstr "अधिकतम गति" -#: soliddeviceengine.cpp:147 +#: soliddeviceengine.cpp:146 msgid "Can Change Frequency" msgstr "आवृत्ति बदल सकता है" -#: soliddeviceengine.cpp:155 +#: soliddeviceengine.cpp:154 msgid "Block" msgstr "रोकें" -#: soliddeviceengine.cpp:156 +#: soliddeviceengine.cpp:155 msgid "Major" msgstr "मैजर" -#: soliddeviceengine.cpp:157 +#: soliddeviceengine.cpp:156 msgid "Minor" msgstr "लघु" -#: soliddeviceengine.cpp:158 soliddeviceengine.cpp:514 +#: soliddeviceengine.cpp:157 soliddeviceengine.cpp:513 msgid "Device" msgstr "उपकरण" -#: soliddeviceengine.cpp:166 +#: soliddeviceengine.cpp:165 msgid "Storage Access" msgstr "भंडारण पहुँच" -#: soliddeviceengine.cpp:167 soliddeviceengine.cpp:638 -#: soliddeviceengine.cpp:725 +#: soliddeviceengine.cpp:166 soliddeviceengine.cpp:637 +#: soliddeviceengine.cpp:724 msgid "Accessible" msgstr "अभिगम योग्य" -#: soliddeviceengine.cpp:168 soliddeviceengine.cpp:639 +#: soliddeviceengine.cpp:167 soliddeviceengine.cpp:638 msgid "File Path" msgstr "फ़ाइल पथ" -#: soliddeviceengine.cpp:177 soliddeviceengine.cpp:667 -#: soliddeviceengine.cpp:681 +#: soliddeviceengine.cpp:176 soliddeviceengine.cpp:666 +#: soliddeviceengine.cpp:680 msgid "Free Space" msgstr "खाली जगह" -#: soliddeviceengine.cpp:178 soliddeviceengine.cpp:668 -#: soliddeviceengine.cpp:682 +#: soliddeviceengine.cpp:177 soliddeviceengine.cpp:667 +#: soliddeviceengine.cpp:681 #, fuzzy #| msgid "Free Space" msgid "Free Space Text" msgstr "खाली जगह" -#: soliddeviceengine.cpp:191 +#: soliddeviceengine.cpp:190 msgid "Storage Drive" msgstr "भंडारण ड्राइव" -#: soliddeviceengine.cpp:194 +#: soliddeviceengine.cpp:193 msgid "Ide" msgstr "Ide" -#: soliddeviceengine.cpp:194 +#: soliddeviceengine.cpp:193 msgid "Usb" msgstr "Usb" -#: soliddeviceengine.cpp:194 +#: soliddeviceengine.cpp:193 msgid "Ieee1394" msgstr "Ieee1394" -#: soliddeviceengine.cpp:194 +#: soliddeviceengine.cpp:193 msgid "Scsi" msgstr "Scsi" -#: soliddeviceengine.cpp:194 +#: soliddeviceengine.cpp:193 msgid "Sata" msgstr "Sata" -#: soliddeviceengine.cpp:194 +#: soliddeviceengine.cpp:193 msgid "Platform" msgstr "प्लेटफॉर्म" -#: soliddeviceengine.cpp:196 +#: soliddeviceengine.cpp:195 msgid "Hard Disk" msgstr "हार्ड डिस्क" -#: soliddeviceengine.cpp:196 +#: soliddeviceengine.cpp:195 msgid "Cdrom Drive" msgstr "सीडीरोम ड्राइव" -#: soliddeviceengine.cpp:196 +#: soliddeviceengine.cpp:195 msgid "Floppy" msgstr "फ़्लॉपी" -#: soliddeviceengine.cpp:196 +#: soliddeviceengine.cpp:195 msgid "Tape" msgstr "टेप" -#: soliddeviceengine.cpp:196 +#: soliddeviceengine.cpp:195 msgid "Compact Flash" msgstr "कॉम्पैक्ट फ़्लैश" -#: soliddeviceengine.cpp:196 +#: soliddeviceengine.cpp:195 msgid "Memory Stick" msgstr "मेमोरी स्टिक" -#: soliddeviceengine.cpp:196 +#: soliddeviceengine.cpp:195 msgid "Smart Media" msgstr "स्मार्ट मीडिया" -#: soliddeviceengine.cpp:196 +#: soliddeviceengine.cpp:195 msgid "SdMmc" msgstr "SdMmc" -#: soliddeviceengine.cpp:196 +#: soliddeviceengine.cpp:195 msgid "Xd" msgstr "Xd" -#: soliddeviceengine.cpp:198 +#: soliddeviceengine.cpp:197 msgid "Bus" msgstr "बस" -#: soliddeviceengine.cpp:199 +#: soliddeviceengine.cpp:198 msgid "Drive Type" msgstr "ड्राइव प्रकार" -#: soliddeviceengine.cpp:200 soliddeviceengine.cpp:214 -#: soliddeviceengine.cpp:382 soliddeviceengine.cpp:397 +#: soliddeviceengine.cpp:199 soliddeviceengine.cpp:213 +#: soliddeviceengine.cpp:381 soliddeviceengine.cpp:396 msgid "Removable" msgstr "विस्थापनीय" -#: soliddeviceengine.cpp:201 soliddeviceengine.cpp:215 -#: soliddeviceengine.cpp:383 soliddeviceengine.cpp:398 +#: soliddeviceengine.cpp:200 soliddeviceengine.cpp:214 +#: soliddeviceengine.cpp:382 soliddeviceengine.cpp:397 msgid "Hotpluggable" msgstr "Hotpluggable" -#: soliddeviceengine.cpp:225 +#: soliddeviceengine.cpp:224 msgid "Optical Drive" msgstr "ऑप्टिकल ड्राइव" -#: soliddeviceengine.cpp:230 +#: soliddeviceengine.cpp:229 msgid "CD-R" msgstr "सीडी-आर" -#: soliddeviceengine.cpp:233 +#: soliddeviceengine.cpp:232 msgid "CD-RW" msgstr "सीडी-आरडब्ल्यू" -#: soliddeviceengine.cpp:236 +#: soliddeviceengine.cpp:235 msgid "DVD" msgstr "डीवीडी" -#: soliddeviceengine.cpp:239 +#: soliddeviceengine.cpp:238 msgid "DVD-R" msgstr "डीवीडी-आर" -#: soliddeviceengine.cpp:242 +#: soliddeviceengine.cpp:241 msgid "DVD-RW" msgstr "डीवीडी-आरडबल्यू" -#: soliddeviceengine.cpp:245 +#: soliddeviceengine.cpp:244 msgid "DVD-RAM" msgstr "डीवीडी-रैम" -#: soliddeviceengine.cpp:248 +#: soliddeviceengine.cpp:247 msgid "DVD+R" msgstr "डीवीडी+आर" -#: soliddeviceengine.cpp:251 +#: soliddeviceengine.cpp:250 msgid "DVD+RW" msgstr "डीवीडी+आरडबल्यू" -#: soliddeviceengine.cpp:254 +#: soliddeviceengine.cpp:253 msgid "DVD+DL" msgstr "डीवीडी DL" -#: soliddeviceengine.cpp:257 +#: soliddeviceengine.cpp:256 msgid "DVD+DLRW" msgstr "डीवीडी+DLRW" -#: soliddeviceengine.cpp:260 +#: soliddeviceengine.cpp:259 msgid "BD" msgstr "BD" -#: soliddeviceengine.cpp:263 +#: soliddeviceengine.cpp:262 msgid "BD-R" msgstr "BD-R" -#: soliddeviceengine.cpp:266 +#: soliddeviceengine.cpp:265 msgid "BD-RE" msgstr "BD-RE" -#: soliddeviceengine.cpp:269 +#: soliddeviceengine.cpp:268 msgid "HDDVD" msgstr "HDDVD" -#: soliddeviceengine.cpp:272 +#: soliddeviceengine.cpp:271 msgid "HDDVD-R" msgstr "HDDVD-R" -#: soliddeviceengine.cpp:275 +#: soliddeviceengine.cpp:274 msgid "HDDVD-RW" msgstr "HDDVD-RW" -#: soliddeviceengine.cpp:277 +#: soliddeviceengine.cpp:276 msgid "Supported Media" msgstr "समर्थित मीडिया" -#: soliddeviceengine.cpp:279 +#: soliddeviceengine.cpp:278 msgid "Read Speed" msgstr "पढ़ें गति" -#: soliddeviceengine.cpp:280 +#: soliddeviceengine.cpp:279 msgid "Write Speed" msgstr "लेखन गति" -#: soliddeviceengine.cpp:288 +#: soliddeviceengine.cpp:287 msgid "Write Speeds" msgstr "लेखन गति" -#: soliddeviceengine.cpp:297 +#: soliddeviceengine.cpp:296 msgid "Storage Volume" msgstr "भंडारण आवाज़" -#: soliddeviceengine.cpp:300 +#: soliddeviceengine.cpp:299 msgid "Other" msgstr "अन्य" -#: soliddeviceengine.cpp:300 +#: soliddeviceengine.cpp:299 msgid "Unused" msgstr "उपयोग में नहीं" -#: soliddeviceengine.cpp:300 +#: soliddeviceengine.cpp:299 msgid "File System" msgstr "फ़ाइल सिस्टम" -#: soliddeviceengine.cpp:301 +#: soliddeviceengine.cpp:300 msgid "Partition Table" msgstr "विभाजन सारणी" -#: soliddeviceengine.cpp:301 +#: soliddeviceengine.cpp:300 msgid "Raid" msgstr "Raid" -#: soliddeviceengine.cpp:301 +#: soliddeviceengine.cpp:300 msgid "Encrypted" msgstr "एनक्रिप्टेड" -#: soliddeviceengine.cpp:304 soliddeviceengine.cpp:306 +#: soliddeviceengine.cpp:303 soliddeviceengine.cpp:305 msgid "Usage" msgstr "प्रयोग" -#: soliddeviceengine.cpp:306 +#: soliddeviceengine.cpp:305 msgid "Unknown" msgstr "अज्ञात" -#: soliddeviceengine.cpp:309 +#: soliddeviceengine.cpp:308 msgid "Ignored" msgstr "नज़रअंदाज़ किया" -#: soliddeviceengine.cpp:310 +#: soliddeviceengine.cpp:309 msgid "File System Type" msgstr "फ़ाइल तंत्र प्रकार" -#: soliddeviceengine.cpp:311 +#: soliddeviceengine.cpp:310 msgid "Label" msgstr "लेबल" -#: soliddeviceengine.cpp:312 +#: soliddeviceengine.cpp:311 msgid "UUID" msgstr "UUID" -#: soliddeviceengine.cpp:313 soliddeviceengine.cpp:582 +#: soliddeviceengine.cpp:312 soliddeviceengine.cpp:581 msgid "Size" msgstr "आकार" -#: soliddeviceengine.cpp:322 +#: soliddeviceengine.cpp:321 msgid "Encrypted Container" msgstr "एनक्रिप्टेड समाहित कर्ता" -#: soliddeviceengine.cpp:334 +#: soliddeviceengine.cpp:333 msgid "OpticalDisc" msgstr "ऑप्टिकल डिस्क" -#: soliddeviceengine.cpp:340 +#: soliddeviceengine.cpp:339 msgid "Audio" msgstr "ऑडियो" -#: soliddeviceengine.cpp:343 +#: soliddeviceengine.cpp:342 msgid "Data" msgstr "डाटा" -#: soliddeviceengine.cpp:346 +#: soliddeviceengine.cpp:345 msgid "Video CD" msgstr "वीडियो सीडी" -#: soliddeviceengine.cpp:349 +#: soliddeviceengine.cpp:348 msgid "Super Video CD" msgstr "सुपर वीडियो सीडी" -#: soliddeviceengine.cpp:352 +#: soliddeviceengine.cpp:351 msgid "Video DVD" msgstr "वीडियो डीवीडी" -#: soliddeviceengine.cpp:354 +#: soliddeviceengine.cpp:353 msgid "Available Content" msgstr "उपलब्ध विषय" -#: soliddeviceengine.cpp:357 +#: soliddeviceengine.cpp:356 msgid "Unknown Disc Type" msgstr "अज्ञात डिस्क प्रकार" -#: soliddeviceengine.cpp:357 +#: soliddeviceengine.cpp:356 msgid "CD Rom" msgstr "सीडी रोम" -#: soliddeviceengine.cpp:357 +#: soliddeviceengine.cpp:356 msgid "CD Recordable" msgstr "सीडी रिकार्ड करने योग्य" -#: soliddeviceengine.cpp:358 +#: soliddeviceengine.cpp:357 msgid "CD Rewritable" msgstr "सीडी फिर लेखन योग्य" -#: soliddeviceengine.cpp:358 +#: soliddeviceengine.cpp:357 msgid "DVD Rom" msgstr "डीवीडी रोम" -#: soliddeviceengine.cpp:358 +#: soliddeviceengine.cpp:357 msgid "DVD Ram" msgstr "डीवीडी रैम" -#: soliddeviceengine.cpp:359 +#: soliddeviceengine.cpp:358 msgid "DVD Recordable" msgstr "डीवीडी रिकार्ड करने योग्य" -#: soliddeviceengine.cpp:359 +#: soliddeviceengine.cpp:358 msgid "DVD Rewritable" msgstr "डीवीडी फिर लिखने योग्य" -#: soliddeviceengine.cpp:359 +#: soliddeviceengine.cpp:358 msgid "DVD Plus Recordable" msgstr "डीवीडी प्लस रिकार्ड करने योग्य" -#: soliddeviceengine.cpp:360 +#: soliddeviceengine.cpp:359 msgid "DVD Plus Rewritable" msgstr "डीवीडी प्लस फिर लिखने योग्य" -#: soliddeviceengine.cpp:360 +#: soliddeviceengine.cpp:359 msgid "DVD Plus Recordable Duallayer" msgstr "डीवीडी प्लस रिकार्ड करने योग्य Duallayer" -#: soliddeviceengine.cpp:361 +#: soliddeviceengine.cpp:360 msgid "DVD Plus Rewritable Duallayer" msgstr "डीवीडी प्लस फिर लिखने योग्य डुला प्लेयर" -#: soliddeviceengine.cpp:361 +#: soliddeviceengine.cpp:360 msgid "Blu Ray Rom" msgstr "Blu Ray Rom" -#: soliddeviceengine.cpp:361 +#: soliddeviceengine.cpp:360 msgid "Blu Ray Recordable" msgstr "Blu Ray रिकार्ड करने योग्य" -#: soliddeviceengine.cpp:362 +#: soliddeviceengine.cpp:361 msgid "Blu Ray Rewritable" msgstr "Blu Ray फिर लिखने योग्य" -#: soliddeviceengine.cpp:362 +#: soliddeviceengine.cpp:361 msgid "HD DVD Rom" msgstr "HD DVD Rom" -#: soliddeviceengine.cpp:362 +#: soliddeviceengine.cpp:361 msgid "HD DVD Recordable" msgstr "HD DVD रिकार्ड करने योग्य" -#: soliddeviceengine.cpp:363 +#: soliddeviceengine.cpp:362 msgid "HD DVD Rewritable" msgstr "HD DVD फिर लिखने योग्य" -#: soliddeviceengine.cpp:365 +#: soliddeviceengine.cpp:364 msgid "Disc Type" msgstr "डिस्क प्रकार" -#: soliddeviceengine.cpp:366 +#: soliddeviceengine.cpp:365 msgid "Appendable" msgstr "जोड़ने योग्य" -#: soliddeviceengine.cpp:367 +#: soliddeviceengine.cpp:366 msgid "Blank" msgstr "खाली" -#: soliddeviceengine.cpp:368 +#: soliddeviceengine.cpp:367 msgid "Rewritable" msgstr "फिर लिखने योग्य" -#: soliddeviceengine.cpp:369 +#: soliddeviceengine.cpp:368 msgid "Capacity" msgstr "क्षमता:" -#: soliddeviceengine.cpp:377 +#: soliddeviceengine.cpp:376 msgid "Camera" msgstr "कैमरा" -#: soliddeviceengine.cpp:379 soliddeviceengine.cpp:394 -#: soliddeviceengine.cpp:534 +#: soliddeviceengine.cpp:378 soliddeviceengine.cpp:393 +#: soliddeviceengine.cpp:533 msgid "Supported Protocols" msgstr "समर्थित प्रोटोकॉल्स" -#: soliddeviceengine.cpp:380 soliddeviceengine.cpp:395 -#: soliddeviceengine.cpp:535 +#: soliddeviceengine.cpp:379 soliddeviceengine.cpp:394 +#: soliddeviceengine.cpp:534 msgid "Supported Drivers" msgstr "समर्थित चालक" -#: soliddeviceengine.cpp:392 +#: soliddeviceengine.cpp:391 msgid "Portable Media Player" msgstr "पोर्चेबल मीडिया प्लेयर" -#: soliddeviceengine.cpp:407 +#: soliddeviceengine.cpp:406 msgid "Network Interface" msgstr "नेटवर्क इंटरफेस" -#: soliddeviceengine.cpp:409 +#: soliddeviceengine.cpp:408 msgid "Interface Name" msgstr "अंतरफलक नाम" -#: soliddeviceengine.cpp:410 +#: soliddeviceengine.cpp:409 msgid "Wireless" msgstr "बेतार" -#: soliddeviceengine.cpp:411 +#: soliddeviceengine.cpp:410 msgid "Hardware Address" msgstr "हार्डवेयर पता" -#: soliddeviceengine.cpp:412 +#: soliddeviceengine.cpp:411 msgid "MAC Address" msgstr "मैक पता" -#: soliddeviceengine.cpp:420 +#: soliddeviceengine.cpp:419 msgid "AC Adapter" msgstr "एसी एडॉप्टर" -#: soliddeviceengine.cpp:422 soliddeviceengine.cpp:441 +#: soliddeviceengine.cpp:421 soliddeviceengine.cpp:440 msgid "Plugged In" msgstr "प्लगिन" -#: soliddeviceengine.cpp:431 +#: soliddeviceengine.cpp:430 msgid "Battery" msgstr "बैटरी" -#: soliddeviceengine.cpp:434 +#: soliddeviceengine.cpp:433 msgid "Unknown Battery" msgstr "अज्ञात बैटरी" -#: soliddeviceengine.cpp:434 +#: soliddeviceengine.cpp:433 msgid "PDA Battery" msgstr "PDA बैटरी" -#: soliddeviceengine.cpp:434 +#: soliddeviceengine.cpp:433 msgid "UPS Battery" msgstr "UPS बैटरी" -#: soliddeviceengine.cpp:435 +#: soliddeviceengine.cpp:434 msgid "Primary Battery" msgstr "प्राथमिक बैटरी" -#: soliddeviceengine.cpp:435 +#: soliddeviceengine.cpp:434 msgid "Mouse Battery" msgstr "माउस बैटरी" -#: soliddeviceengine.cpp:435 +#: soliddeviceengine.cpp:434 msgid "Keyboard Battery" msgstr "कुंजीपटल बैटरी" -#: soliddeviceengine.cpp:436 +#: soliddeviceengine.cpp:435 msgid "Keyboard Mouse Battery" msgstr "कुंजीपटल माउस बैटरी" -#: soliddeviceengine.cpp:436 +#: soliddeviceengine.cpp:435 msgid "Camera Battery" msgstr "कैमरा बैटरी" -#: soliddeviceengine.cpp:439 +#: soliddeviceengine.cpp:438 msgid "Fully Charged" msgstr "पूरी तरह चार्ज्ड" -#: soliddeviceengine.cpp:439 +#: soliddeviceengine.cpp:438 msgid "Charging" msgstr "चार्ज कर रहा है" -#: soliddeviceengine.cpp:439 +#: soliddeviceengine.cpp:438 msgid "Discharging" msgstr "डिस्चार्ज कर रहा है" -#: soliddeviceengine.cpp:442 soliddeviceengine.cpp:461 +#: soliddeviceengine.cpp:441 soliddeviceengine.cpp:460 msgid "Type" msgstr "प्रकार" -#: soliddeviceengine.cpp:443 +#: soliddeviceengine.cpp:442 msgid "Charge Percent" msgstr "चार्ज प्रतिशत" -#: soliddeviceengine.cpp:444 +#: soliddeviceengine.cpp:443 msgid "Rechargeable" msgstr "फिर चार्ज होने योग्य" -#: soliddeviceengine.cpp:445 +#: soliddeviceengine.cpp:444 msgid "Charge State" msgstr "चार्ज स्थिति" -#: soliddeviceengine.cpp:455 +#: soliddeviceengine.cpp:454 msgid "Button" msgstr "बटन" -#: soliddeviceengine.cpp:458 +#: soliddeviceengine.cpp:457 msgid "Lid Button" msgstr "लिड बटन" -#: soliddeviceengine.cpp:458 +#: soliddeviceengine.cpp:457 msgid "Power Button" msgstr "पावर बटन" -#: soliddeviceengine.cpp:458 +#: soliddeviceengine.cpp:457 msgid "Sleep Button" msgstr "स्लीप बटन" -#: soliddeviceengine.cpp:459 +#: soliddeviceengine.cpp:458 msgid "Unknown Button Type" msgstr "अज्ञात बटन प्रकार" -#: soliddeviceengine.cpp:462 +#: soliddeviceengine.cpp:461 msgid "Has State" msgstr "हैस स्थिति" -#: soliddeviceengine.cpp:463 +#: soliddeviceengine.cpp:462 msgid "State Value" msgstr "स्थिति मान" -#: soliddeviceengine.cpp:464 +#: soliddeviceengine.cpp:463 msgid "Pressed" msgstr "दबा हुआ" -#: soliddeviceengine.cpp:474 +#: soliddeviceengine.cpp:473 msgid "Audio Interface" msgstr "ऑडियो इंटरफेस" -#: soliddeviceengine.cpp:477 +#: soliddeviceengine.cpp:476 msgid "ALSA" msgstr "आल्सा (एएलएसए)" -#: soliddeviceengine.cpp:477 +#: soliddeviceengine.cpp:476 msgid "Open Sound System" msgstr "खुला ध्वनि तंत्र" -#: soliddeviceengine.cpp:477 +#: soliddeviceengine.cpp:476 msgid "Unknown Audio Driver" msgstr "अज्ञात ऑडियो ड्राइवर" -#: soliddeviceengine.cpp:479 +#: soliddeviceengine.cpp:478 msgid "Driver" msgstr "ड्राइवर" -#: soliddeviceengine.cpp:480 +#: soliddeviceengine.cpp:479 msgid "Driver Handle" msgstr "ड्राइवर हैंडल" -#: soliddeviceengine.cpp:481 +#: soliddeviceengine.cpp:480 msgid "Name" msgstr "नाम" -#: soliddeviceengine.cpp:487 +#: soliddeviceengine.cpp:486 msgid "Unknown Audio Interface Type" msgstr "अज्ञात ऑडियो इंटरफेस प्रकार" -#: soliddeviceengine.cpp:490 +#: soliddeviceengine.cpp:489 msgid "Audio Control" msgstr "ऑडियो नियंत्रण" -#: soliddeviceengine.cpp:493 +#: soliddeviceengine.cpp:492 msgid "Audio Input" msgstr "ऑडियो इनपुट" -#: soliddeviceengine.cpp:496 +#: soliddeviceengine.cpp:495 msgid "Audio Output" msgstr "ऑडियो आउटपुट" -#: soliddeviceengine.cpp:498 +#: soliddeviceengine.cpp:497 msgid "Audio Device Type" msgstr "ऑडियो उपकरण प्रकार" -#: soliddeviceengine.cpp:502 +#: soliddeviceengine.cpp:501 msgid "Internal Soundcard" msgstr "भीतरी साउंडकार्ड" -#: soliddeviceengine.cpp:502 +#: soliddeviceengine.cpp:501 msgid "USB Soundcard" msgstr "यूएसबी साउंडकार्ड" -#: soliddeviceengine.cpp:502 +#: soliddeviceengine.cpp:501 msgid "Firewire Soundcard" msgstr "फायरवॉयर साउंडकार्ड" -#: soliddeviceengine.cpp:503 +#: soliddeviceengine.cpp:502 msgid "Headset" msgstr "हेडसेट" -#: soliddeviceengine.cpp:503 +#: soliddeviceengine.cpp:502 msgid "Modem" msgstr "मॉडेम" -#: soliddeviceengine.cpp:504 +#: soliddeviceengine.cpp:503 msgid "Soundcard Type" msgstr "साउंडकार्ड प्रकार" -#: soliddeviceengine.cpp:512 +#: soliddeviceengine.cpp:511 msgid "DVB Interface" msgstr "DVB इंटरफेस" -#: soliddeviceengine.cpp:515 +#: soliddeviceengine.cpp:514 msgid "Device Adapter" msgstr "उपकरण अनुकूलक" -#: soliddeviceengine.cpp:519 +#: soliddeviceengine.cpp:518 msgid "DVB Unknown" msgstr "DVB अज्ञात" -#: soliddeviceengine.cpp:519 +#: soliddeviceengine.cpp:518 msgid "DVB Audio" msgstr "DVB ऑडिय़ो" -#: soliddeviceengine.cpp:519 +#: soliddeviceengine.cpp:518 msgid "DVB Ca" msgstr "DVB Ca" -#: soliddeviceengine.cpp:520 +#: soliddeviceengine.cpp:519 msgid "DVB Demux" msgstr "DVB Demux" -#: soliddeviceengine.cpp:520 +#: soliddeviceengine.cpp:519 msgid "DVB DVR" msgstr "DVB DVR" -#: soliddeviceengine.cpp:520 +#: soliddeviceengine.cpp:519 msgid "DVB Frontend" msgstr "DVB फ्रंटएंड" -#: soliddeviceengine.cpp:521 +#: soliddeviceengine.cpp:520 msgid "DVB Net" msgstr "DVB Net" -#: soliddeviceengine.cpp:521 +#: soliddeviceengine.cpp:520 msgid "DVB OSD" msgstr "DVB OSD" -#: soliddeviceengine.cpp:521 +#: soliddeviceengine.cpp:520 msgid "DVB Sec" msgstr "DVB Sec" -#: soliddeviceengine.cpp:521 +#: soliddeviceengine.cpp:520 msgid "DVB Video" msgstr "DVB वीडियो" -#: soliddeviceengine.cpp:523 +#: soliddeviceengine.cpp:522 msgid "DVB Device Type" msgstr "DVB उपकरण प्रकार" -#: soliddeviceengine.cpp:524 +#: soliddeviceengine.cpp:523 msgid "Device Index" msgstr "उपकरण निर्देशिका" -#: soliddeviceengine.cpp:532 +#: soliddeviceengine.cpp:531 msgid "Video" msgstr "वीडियो" -#: soliddeviceengine.cpp:541 +#: soliddeviceengine.cpp:540 msgid "Driver Handles" msgstr "ड्राइवर नियंत्रण" -#: soliddeviceengine.cpp:550 +#: soliddeviceengine.cpp:549 msgid "Type Description" msgstr "" -#: soliddeviceengine.cpp:555 +#: soliddeviceengine.cpp:554 msgid "Device Types" msgstr "उपकरण प्रकार" -#: soliddeviceengine.cpp:699 +#: soliddeviceengine.cpp:698 msgid "Temperature" msgstr "तापक्रम" -#: soliddeviceengine.cpp:700 +#: soliddeviceengine.cpp:699 msgid "Temperature Unit" msgstr "तापक्रम इकाई" -#: soliddeviceengine.cpp:744 soliddeviceengine.cpp:748 +#: soliddeviceengine.cpp:743 soliddeviceengine.cpp:747 msgid "In Use" msgstr "" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_engine_weather.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_engine_weather.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_engine_weather.po 2013-02-22 16:11:43.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_engine_weather.po 2013-11-05 12:40:10.000000000 +0000 @@ -9,7 +9,7 @@ msgstr "" "Project-Id-Version: plasma_engine_weather\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-02-22 13:00+0100\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-07-19 01:53+0530\n" "Last-Translator: G Karunakar <karunakar@indlinux.org>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasmagenericshell.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasmagenericshell.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasmagenericshell.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasmagenericshell.po 2013-12-13 06:58:09.000000000 +0000 @@ -0,0 +1,400 @@ +# translation of plasmagenericshell.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# G Karunakar <karunakar@indlinux.org>, 2008. +# Rajesh Ranjan <rranjan@redhat.com>, 2008. +# Rajesh Ranjan <rajesh672@gmail.com>, 2010. +msgid "" +msgstr "" +"Project-Id-Version: plasmagenericshell\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-12-13 06:00+0000\n" +"PO-Revision-Date: 2010-01-31 20:07+0530\n" +"Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" +"Language-Team: Hindi <indlinux>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" +"\n" +"\n" + +msgctxt "NAME OF TRANSLATORS" +msgid "Your names" +msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर, राजेश रंजन" + +msgctxt "EMAIL OF TRANSLATORS" +msgid "Your emails" +msgstr "raviratlami@aol.in, rajesh@indlinux.in" + +#: backgrounddialog.cpp:227 +#, fuzzy +#| msgid "Desktop Settings" +msgid "Settings" +msgstr "डेस्कटॉप समायोजन" + +#: backgrounddialog.cpp:227 +#, fuzzy, kde-format +#| msgid "Desktop Settings" +msgid "%1 Settings" +msgstr "डेस्कटॉप समायोजन" + +#: backgrounddialog.cpp:240 +msgid "Desktop Settings" +msgstr "डेस्कटॉप समायोजन" + +#: backgrounddialog.cpp:245 +msgid "View" +msgstr "" + +#: backgrounddialog.cpp:253 +msgid "" +"This picture of a monitor contains a preview of what the current settings " +"will look like on your desktop." +msgstr "मॉनीटर का छवि पूर्वावलोकन रखता है कि मौज़ूदा विन्यास आपके डेस्कटॉप में कैसे दिखेगा." + +#: backgrounddialog.cpp:275 +msgid "Mouse Actions" +msgstr "माउस क्रियाएं" + +#. i18n: ectx: property (text), widget (QLabel, unlockLabel) +#: BackgroundDialog.ui:44 +msgid "Widgets are currently locked, disabling some options." +msgstr "" + +#. i18n: ectx: property (text), widget (QPushButton, unlockButton) +#: BackgroundDialog.ui:72 +#, fuzzy +#| msgid "All Widgets" +msgid "Unlock Widgets" +msgstr "सभी विजेट्स" + +#. i18n: ectx: property (text), widget (QLabel, containmentLabel) +#: BackgroundDialog.ui:109 +msgid "Layout:" +msgstr "" + +#. i18n: ectx: property (text), widget (QLabel, wallpaperTypeLabel) +#: BackgroundDialog.ui:144 +#, fuzzy +#| msgid "Wallpaper" +msgid "Wallpaper:" +msgstr "वालपेपर" + +#. i18n: ectx: property (text), widget (QLabel, monitor) +#: BackgroundDialog.ui:195 +msgid "Monitor" +msgstr "मॉनीटर" + +#: mouseinputbutton.cpp:33 +msgid "Set Trigger..." +msgstr "ट्रिगर जोड़ें..." + +#: mouseinputbutton.cpp:33 +#, fuzzy +msgid "Click to change how an action is triggered" +msgstr "क्लिक को बदलें क्रिया है" + +#: mouseinputbutton.cpp:38 +msgid "Left-Button" +msgstr "बायाँ बटन" + +#: mouseinputbutton.cpp:39 +msgid "Right-Button" +msgstr "दायाँ बटन" + +#: mouseinputbutton.cpp:40 +msgid "Middle-Button" +msgstr "मध्य बटन" + +#: mouseinputbutton.cpp:42 +msgid "Vertical-Scroll" +msgstr "खड़ा स्क्राल" + +#: mouseinputbutton.cpp:43 +msgid "Horizontal-Scroll" +msgstr "क्षैतिज स्क्राल" + +#: mouseinputbutton.cpp:46 +msgid "Shift" +msgstr "शिफ्ट" + +#: mouseinputbutton.cpp:47 +msgid "Ctrl" +msgstr "कंट्रोल" + +#: mouseinputbutton.cpp:48 +msgid "Alt" +msgstr "ऑल्ट" + +#: mouseinputbutton.cpp:49 +msgid "Meta" +msgstr "मेटा" + +#: mouseinputbutton.cpp:70 mouseinputbutton.cpp:156 +msgid "Input here..." +msgstr "यहाँ इनपुट करें..." + +#: mouseinputbutton.cpp:71 +#, fuzzy +msgid "" +"Hold down the modifier keys you want, then click a mouse button or scroll a " +"mouse wheel here" +msgstr "पकड़ें नीचे क्लिक a माउस बटन या a माउस" + +#: mouseplugins.cpp:38 +msgid "Add Action..." +msgstr "जोड़ें क्रिया." + +#: mouseplugins.cpp:38 +msgid "Add another mouse action" +msgstr "दूसरी माउस क्रिया जोड़ें" + +#: mouseplugins.cpp:80 +#, fuzzy +msgid "This trigger is already assigned to another action." +msgstr "है को क्रिया." + +#: mouseplugins.cpp:80 +#, fuzzy +#| msgid "Reassign" +msgctxt "reassign to this action" +msgid "Reassign" +msgstr "फिर से आबंटित करें" + +#: mouseplugins.cpp:158 +#, fuzzy +msgid "This trigger is assigned to another plugin." +msgstr "है को प्लगइन." + +#: mouseplugins.cpp:158 +#, fuzzy +#| msgid "Reassign" +msgctxt "reassign to this plugin" +msgid "Reassign" +msgstr "फिर से आबंटित करें" + +#. i18n: ectx: property (windowTitle), widget (QWidget, MousePlugins) +#: MousePlugins.ui:14 +msgid "Mouse Plugins" +msgstr "माउस प्लगइन्स" + +#: mousepluginwidget.cpp:46 +#, fuzzy +msgid "No plugins found, check your installation." +msgstr "नहीं पाया अधिष्ठापन." + +#: mousepluginwidget.cpp:89 +msgctxt "About mouse action" +msgid "About" +msgstr "" + +#: mousepluginwidget.cpp:92 +#, fuzzy +#| msgid "Configure Plugin" +msgctxt "Configure mouse action" +msgid "Configure" +msgstr "प्लगिन विन्यस्त करें" + +#: mousepluginwidget.cpp:94 +msgctxt "Remove mouse action" +msgid "Remove" +msgstr "" + +#: mousepluginwidget.cpp:217 +msgid "Configure Plugin" +msgstr "प्लगिन विन्यस्त करें" + +#: scripting/containment.cpp:182 +msgid "widgetById requires an id" +msgstr "" + +#: scripting/containment.cpp:207 +msgid "widgetById requires a name of a widget or a widget object" +msgstr "" + +#: scripting/i18n.cpp:33 +msgid "i18n() takes at least one argument" +msgstr "" + +#: scripting/i18n.cpp:52 +msgid "i18nc() takes at least two arguments" +msgstr "" + +#: scripting/i18n.cpp:72 +msgid "i18np() takes at least two arguments" +msgstr "" + +#: scripting/i18n.cpp:97 +msgid "i18ncp() takes at least three arguments" +msgstr "" + +#: scripting/layouttemplatepackagestructure.cpp:30 +msgid "Main Script File" +msgstr "" + +#: scripting/scriptengine.cpp:80 scripting/scriptengine.cpp:201 +msgid "activityById requires an id" +msgstr "" + +#: scripting/scriptengine.cpp:97 +msgid "activityForScreen requires a screen id" +msgstr "" + +#: scripting/scriptengine.cpp:132 +#, kde-format +msgid "Could not find a plugin for %1 named %2." +msgstr "" + +#: scripting/scriptengine.cpp:290 +#, kde-format +msgid "Unable to load script file: %1" +msgstr "" + +#: scripting/scriptengine.cpp:660 +#, kde-format +msgid "" +"Error: %1 at line %2\n" +"\n" +"Backtrace:\n" +"%3" +msgstr "" + +#: widgetsexplorer/kcategorizeditemsviewmodels.cpp:72 +msgid "Filters" +msgstr "फ़िल्टर्स" + +#: widgetsexplorer/openwidgetassistant.cpp:46 +msgid "Select the type of widget to install from the list below." +msgstr "नीचे दी गई सूची में से संस्थापित करने के लिए विजेट किस्म चुनें." + +#: widgetsexplorer/openwidgetassistant.cpp:56 +msgid "Plasmoid: Native plasma widget" +msgstr "प्लाज़्माइड: नेटिव प्लाज्मा विजेट" + +#: widgetsexplorer/openwidgetassistant.cpp:77 +msgid "Install New Widget From File" +msgstr "फ़ाइल से नया विजेट संस्थापित करें" + +#: widgetsexplorer/openwidgetassistant.cpp:82 +msgid "Select File" +msgstr "फ़ाइल चुनें" + +#: widgetsexplorer/openwidgetassistant.cpp:176 +#, kde-format +msgid "Could not load the required installer %1. The error given was: %2" +msgstr "जरूरी संस्थापक %1 लोड नहीं कर सका. दी गई त्रुटि थी: %2" + +#: widgetsexplorer/openwidgetassistant.cpp:179 +#: widgetsexplorer/openwidgetassistant.cpp:191 +msgid "Installation Failure" +msgstr "संस्थापन विफलता" + +#: widgetsexplorer/openwidgetassistant.cpp:190 +#, kde-format +msgid "Installing the package %1 failed." +msgstr "पैकेज %1 का संस्थापन विफल." + +#: widgetsexplorer/package/contents/ui/main.qml:173 +#: widgetsexplorer/package/contents/ui/main.qml:239 +#, fuzzy +#| msgid "Enter Search Term" +msgid "Enter search term..." +msgstr "ढूंढा जाने वाला वाक्यांश यहां पर भरें" + +#: widgetsexplorer/package/contents/ui/main.qml:183 +#: widgetsexplorer/package/contents/ui/main.qml:253 +#, fuzzy +#| msgid "Categories:" +msgid "Categories" +msgstr "श्रेणियाँ:" + +#: widgetsexplorer/package/contents/ui/main.qml:193 +#: widgetsexplorer/package/contents/ui/main.qml:343 +#, fuzzy +#| msgid "Get New Widgets" +msgid "Get new widgets" +msgstr "नये विजेट्स लाएँ" + +#: widgetsexplorer/package/contents/ui/Tooltip.qml:109 +msgid "Author:" +msgstr "" + +#: widgetsexplorer/package/contents/ui/Tooltip.qml:123 +msgid "License:" +msgstr "" + +#: widgetsexplorer/package/contents/ui/Tooltip.qml:142 +#, fuzzy +#| msgid "Uninstall Widget" +msgid "Uninstall" +msgstr "नये विजेट्स विसंस्थापित करें" + +#: widgetsexplorer/plasmaappletitemmodel.cpp:226 +msgid "Containments" +msgstr "कंटेनमेंट" + +#: widgetsexplorer/widgetexplorer.cpp:127 +msgid "All Widgets" +msgstr "सभी विजेट्स" + +#: widgetsexplorer/widgetexplorer.cpp:131 +msgid "Running" +msgstr "चल रहा है" + +#: widgetsexplorer/widgetexplorer.cpp:135 +msgid "Categories:" +msgstr "श्रेणियाँ:" + +#: widgetsexplorer/widgetexplorer.cpp:256 +msgid "Download New Plasma Widgets" +msgstr "नया प्लाजमा विजेट्स डाउनलोड करें" + +#: widgetsexplorer/widgetexplorer.cpp:268 +#, kde-format +msgctxt "" +"%1 is a type of widgets, as defined by e.g. some plasma-packagestructure-*." +"desktop files" +msgid "Download New %1" +msgstr "नया %1 डाउनलोड करें" + +#: widgetsexplorer/widgetexplorer.cpp:280 +msgid "Install Widget From Local File..." +msgstr "स्थानीय फ़ाइल से विज़ेट संस्थापित करें" + +#~ msgid "Version %1" +#~ msgstr "संस्करण %1" + +#~ msgid "<font color=\"%1\">Author:</font>" +#~ msgstr "<font color=\"%1\"> लेखक</font>" + +#~ msgid "<font color=\"%1\">Website:</font>" +#~ msgstr "<font color=\"%1\"> वेबसाइट</font>" + +#~ msgid "<font color=\"%1\">License:</font>" +#~ msgstr "<font color=\"%1\"> लाइसेंस</font>" + +#~ msgid "Unknown Applet" +#~ msgstr "अज्ञात ऐप्लेट" + +#~ msgid "Plasma" +#~ msgstr "प्लाजमा" + +#~ msgid "(C) 2008, Aaron Seigo" +#~ msgstr "(c) 2008, एरॉन सीगो" + +#~ msgid "Activity" +#~ msgstr "क्रियाएँ" + +#~ msgid "Type:" +#~ msgstr "क़िस्मः" + +#~ msgid "Name:" +#~ msgstr "नाम:" + +#~ msgid "&Type:" +#~ msgstr "क़िस्मः (&T)" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma-netbook.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma-netbook.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma-netbook.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma-netbook.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,101 @@ +# translation of plasma-netbook.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Rajesh Ranjan <rajesh672@gmail.com>, 2010. +msgid "" +msgstr "" +"Project-Id-Version: plasma-netbook\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2010-01-31 20:08+0530\n" +"Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" +"Language-Team: Hindi <indlinux>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" +"\n" + +msgctxt "NAME OF TRANSLATORS" +msgid "Your names" +msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर" + +msgctxt "EMAIL OF TRANSLATORS" +msgid "Your emails" +msgstr "raviratlami@aol.in" + +#: main.cpp:28 +#, fuzzy +msgid "The KDE workspace application optimized for Netbook devices." +msgstr "केडीई अनुप्रयोग के लिए युक्तियां." + +#: main.cpp:34 +#, fuzzy +#| msgid "Plasma Netbook" +msgid "Plasma Netbook Shell" +msgstr "प्लाजमा नेटबुक" + +#: main.cpp:36 +msgid "Copyright 2006-2009, The KDE Team" +msgstr "Copyright 2006-2009, The KDE Team" + +#: main.cpp:37 +msgid "Aaron J. Seigo" +msgstr "एरॉन जे. सीगो" + +#: main.cpp:38 +msgid "Author and maintainer" +msgstr "लेखक तथा मेंटेनर" + +#: main.cpp:58 +#, fuzzy +msgid "Starts as a normal application instead of as the primary user interface" +msgstr "प्रारंभ होता है जैसे a सामान्य अनुप्रयोग का जैसे प्राथमिक प्रयोक्ता अतरफलक" + +#: main.cpp:59 +msgid "Use OpenGL to draw the main screen" +msgstr "" + +#: main.cpp:60 +msgid "The geometry of the screen" +msgstr "स्क्रीन की ज्यामिति" + +#: netcorona.cpp:71 +msgid "Add page" +msgstr "" + +#: netcorona.cpp:131 +#, fuzzy, kde-format +#| msgid "Page one" +msgctxt "Page number" +msgid "Page %1" +msgstr "पृष्ठ एक" + +#: netpanelcontroller.cpp:63 +msgid "Screen edge" +msgstr "स्क्रीन किनारा" + +#: netpanelcontroller.cpp:70 netpanelcontroller.cpp:138 +msgid "Height" +msgstr "ऊँचाई" + +#: netpanelcontroller.cpp:77 +msgid "Auto Hide" +msgstr "स्वतः छुपाएँ" + +#: netpanelcontroller.cpp:131 +msgid "Width" +msgstr "चौड़ाई" + +#: scripting/newspaper.cpp:48 +msgid "" +"widgetById requires a name of a widget or a widget object, with the row and " +"column coordinates" +msgstr "" + +#~ msgid "Search and launch" +#~ msgstr "ढूंढें और लान्च करें" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma-overlay.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma-overlay.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma-overlay.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma-overlay.po 2013-11-24 06:21:45.000000000 +0000 @@ -0,0 +1,142 @@ +# translation of plasma-overlay.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# G Karunakar <karunakar@indlinux.org>, 2008. +# Rajesh Ranjan <rranjan@redhat.com>, 2008. +msgid "" +msgstr "" +"Project-Id-Version: plasma-overlay\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-24 05:27+0000\n" +"PO-Revision-Date: 2008-12-04 14:11+0530\n" +"Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" + +msgctxt "NAME OF TRANSLATORS" +msgid "Your names" +msgstr "रविशंकर श्रीवास्तव, जी. करूणाकर, राजेश रंजन" + +msgctxt "EMAIL OF TRANSLATORS" +msgid "Your emails" +msgstr "karunakar@indlinux.org, rajesh@indlinux.in" + +#: backgrounddialog.cpp:45 +msgid "Background Settings" +msgstr "पृष्ठभूमि विन्यास" + +#: backgrounddialog.cpp:110 +msgid "No Wallpaper" +msgstr "वालपेपर नहीं" + +#. i18n: ectx: property (text), widget (QLabel, m_wallpaperLabel) +#: BackgroundDialog.ui:59 +msgid "Wallpaper" +msgstr "वालपेपर" + +#. i18n: ectx: property (text), widget (QLabel, m_wallpaperTypeLabel) +#: BackgroundDialog.ui:66 +msgid "Type:" +msgstr "क़िस्मः" + +#: main.cpp:31 +msgid "Plasma widgets over the screensaver" +msgstr "स्क्रीनसेवर के ऊपर प्लाजमा विजेट" + +#: main.cpp:37 +msgid "Plasma for the Screensaver" +msgstr "स्क्रीनसेवर के लिए प्लाजमा" + +#: main.cpp:39 +msgid "Copyright 2006-2008, The KDE Team" +msgstr "सर्वाधिकार सुरक्षित 2006-2008 केडीई" + +#: main.cpp:40 +msgid "Chani Armitage" +msgstr "Chani Armitage" + +#: main.cpp:41 +msgid "Author and maintainer" +msgstr "लेखक तथा मेंटेनर" + +#: main.cpp:43 +msgid "Aaron J. Seigo" +msgstr "एरॉन जे. सीगो" + +#: main.cpp:44 +msgid "Plasma Author and maintainer" +msgstr "लेखक और मेंटेनर" + +#: main.cpp:46 +msgid "John Lions" +msgstr "जॉन लॉयन्स" + +#: main.cpp:47 +msgid "In memory of his contributions, 1937-1998." +msgstr "उनके सहयोग की याद में, १९३७-१९९८" + +#: main.cpp:53 +msgid "Enables some cheats that are useful for debugging." +msgstr "कुछ चीट्स को सक्रिय करता है जो कि डिबगिंग के लिए उपयोगी है." + +#: main.cpp:54 +msgid "Start unlocked for configuration." +msgstr "विन्यास के लिए अनलॉक्ड आरंभ करें." + +#: savercorona.cpp:86 savercorona.cpp:156 +msgid "Lock Screen" +msgstr "" + +#: savercorona.cpp:86 savercorona.cpp:156 +msgid "Configure Widgets" +msgstr "" + +#: savercorona.cpp:90 savercorona.cpp:160 +#, fuzzy +#| msgid "Plasma for the Screensaver" +msgid "Leave Screensaver" +msgstr "स्क्रीनसेवर के लिए प्लाजमा" + +#: savercorona.cpp:90 savercorona.cpp:160 +msgid "Unlock" +msgstr "" + +#: savercorona.cpp:177 +msgid "Unlock widgets to configure them" +msgstr "" + +#: saverview.cpp:155 +msgid "Setup Mode - Screen is NOT locked" +msgstr "सेटअप मोड स्क्रीन तालाबंद नहीं है" + +#~ msgid "" +#~ "This picture of a monitor contains a preview of what the current settings " +#~ "will look like on your desktop." +#~ msgstr "" +#~ "मॉनीटर का छवि पूर्वावलोकन रखता है कि मौज़ूदा विन्यास आपके डेस्कटॉप में कैसे दिखेगा." + +#~ msgid "Widget Translucency" +#~ msgstr "विजेट अल्पपारदर्शिता" + +#, fuzzy +#~| msgid "User Activity:" +#~ msgid "User activity:" +#~ msgstr "उपयोक्ता क्रियाएँ:" + +#, fuzzy +#~| msgid "While Idle:" +#~ msgid "While idle:" +#~ msgstr "जब निष्क्रिय:" + +#~ msgid "Monitor" +#~ msgstr "मॉनीटर" + +#~ msgid "Add Widgets" +#~ msgstr "जोड़ें विजेट्स" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_bookmarksrunner.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_bookmarksrunner.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_bookmarksrunner.po 2014-02-25 03:54:33.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_bookmarksrunner.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: plasma_runner_bookmarksrunner\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-02-25 01:43+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-01-31 20:08+0530\n" "Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" "Language-Team: Hindi <indlinux>\n" @@ -20,20 +20,20 @@ "\n" "\n" -#: bookmarksrunner.cpp:48 +#: bookmarksrunner.cpp:44 msgid "Finds web browser bookmarks matching :q:." msgstr "" -#: bookmarksrunner.cpp:49 +#: bookmarksrunner.cpp:45 msgctxt "list of all web browser bookmarks" msgid "bookmarks" msgstr "पुस्तचिह्न" -#: bookmarksrunner.cpp:50 +#: bookmarksrunner.cpp:46 msgid "List all web browser bookmarks" msgstr "सभी वेव ब्रॉउजर पुस्तचिह्न सूचीबद्ध करें" -#: bookmarksrunner.cpp:77 +#: bookmarksrunner.cpp:73 msgctxt "list of all konqueror bookmarks" msgid "bookmarks" msgstr "पुस्तचिह्न" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_calculatorrunner.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_calculatorrunner.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_calculatorrunner.po 2014-01-08 03:15:59.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_calculatorrunner.po 2014-01-02 06:03:28.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: plasma_runner_calculatorrunner\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-01-08 01:37+0000\n" +"POT-Creation-Date: 2014-01-02 05:07+0000\n" "PO-Revision-Date: 2010-01-31 19:42+0530\n" "Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" "Language-Team: Hindi <indlinux>\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_kill.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_kill.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_kill.po 2013-02-11 21:49:05.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_kill.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: plasma_runner_kill\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2012-08-20 05:36+0200\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-01-31 20:10+0530\n" "Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" "Language-Team: Hindi <indlinux>\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_locations.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_locations.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_locations.po 2014-02-25 03:54:33.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_locations.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: krunner_locationsrunner\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-02-25 01:43+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2008-07-09 11:59+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -18,28 +18,28 @@ "X-Generator: KBabel 1.11.4\n" "Plural-Forms: nplurals=2; plural=(n!=1);\n" -#: locationrunner.cpp:46 +#: locationrunner.cpp:44 msgid "" "Finds local directories and files, network locations and Internet sites with " "paths matching :q:." msgstr "" -#: locationrunner.cpp:61 locationrunner.cpp:83 +#: locationrunner.cpp:59 locationrunner.cpp:81 #, kde-format msgid "Open %1" msgstr "खोलें %1" -#: locationrunner.cpp:103 locationrunner.cpp:116 +#: locationrunner.cpp:101 locationrunner.cpp:114 #, kde-format msgid "Go to %1" msgstr "पर जाएं %1" -#: locationrunner.cpp:110 +#: locationrunner.cpp:108 #, kde-format msgid "Send email to %1" msgstr "" -#: locationrunner.cpp:112 +#: locationrunner.cpp:110 #, kde-format msgid "Launch with %1" msgstr "%1 के साथ खोलें" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_nepomuksearchrunner.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_nepomuksearchrunner.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_nepomuksearchrunner.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_nepomuksearchrunner.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,35 @@ +# translation of plasma_runner_nepomuksearchrunner.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# Rajesh Ranjan <rajesh672@gmail.com>, 2010. +msgid "" +msgstr "" +"Project-Id-Version: plasma_runner_nepomuksearchrunner\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2010-01-31 19:42+0530\n" +"Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" +"Language-Team: Hindi <indlinux>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" +"\n" + +#: nepomuksearchrunner.cpp:92 +msgid "" +"Finds files, documents and other content that matches :q: using the desktop " +"search system." +msgstr "" + +#: nepomuksearchrunner.cpp:160 +#, kde-format +msgid "Things tagged '%1'" +msgstr "" + +#: nepomuksearchrunner.cpp:258 +msgid "Open" +msgstr "खोलें" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_placesrunner.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_placesrunner.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_placesrunner.po 2014-02-25 03:54:33.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_placesrunner.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: plasma_runner_placesrunner\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-02-25 01:43+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-01-31 20:10+0530\n" "Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" "Language-Team: Hindi <indlinux>\n" @@ -20,14 +20,14 @@ "\n" "\n" -#: placesrunner.cpp:41 placesrunner.cpp:92 +#: placesrunner.cpp:38 placesrunner.cpp:89 msgid "places" msgstr "स्थान" -#: placesrunner.cpp:41 +#: placesrunner.cpp:38 msgid "Lists all file manager locations" msgstr "सभी फ़ाइल प्रबंधक स्थान की सूची देता है" -#: placesrunner.cpp:44 +#: placesrunner.cpp:41 msgid "Finds file manager locations that match :q:" msgstr "" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_plasma-desktop.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_plasma-desktop.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_plasma-desktop.po 2012-01-29 09:41:39.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_plasma-desktop.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: plasma_runner_plasma-desktop\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2012-01-29 03:30+0100\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-01-31 20:11+0530\n" "Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" "Language-Team: Hindi <indlinux>\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_powerdevil.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_powerdevil.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_powerdevil.po 2012-01-29 09:41:39.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_powerdevil.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: plasma_runner_powerdevil\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2012-01-29 03:33+0100\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-01-31 20:14+0530\n" "Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" "Language-Team: Hindi <indlinux>\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_recentdocuments.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_recentdocuments.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_recentdocuments.po 2014-02-25 03:54:33.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_recentdocuments.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: plasma_runner_recentdocuments\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-02-25 01:43+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-01-31 20:15+0530\n" "Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" "Language-Team: Hindi <indlinux>\n" @@ -20,11 +20,11 @@ "\n" "\n" -#: recentdocuments.cpp:47 +#: recentdocuments.cpp:46 #, fuzzy msgid "Looks for documents recently used with names matching :q:." msgstr "के लिए दस्तावेज़ प्रयुक्त के साथ नाम." -#: recentdocuments.cpp:87 +#: recentdocuments.cpp:86 msgid "Recent Document" msgstr "हालिया दस्तावेज़" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_services.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_services.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_services.po 2011-09-14 00:21:35.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_services.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: plasma_runner_services\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2011-08-02 05:39+0200\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-01-31 19:43+0530\n" "Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" "Language-Team: Hindi <indlinux>\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_sessions.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_sessions.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_sessions.po 2012-08-19 09:34:25.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_sessions.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: krunner_sessions\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2012-08-19 05:50+0200\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2008-07-09 12:03+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" "Language-Team: Hindi <Indlinux-hindi@lists.sourceforge.net>\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_shell.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_shell.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_shell.po 2014-02-25 03:54:33.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_shell.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: krunner_shellrunner\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-02-25 01:43+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2008-07-09 13:37+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" "Language-Team: Hindi <Indlinux-hindi@lists.sourceforge.net>\n" @@ -71,11 +71,11 @@ msgid "Run as a different &user" msgstr "भिन्न उपयोक्ता जैसे चलाएँ (&u)" -#: shellrunner.cpp:56 +#: shellrunner.cpp:53 msgid "Finds commands that match :q:, using common shell syntax" msgstr "" -#: shellrunner.cpp:76 +#: shellrunner.cpp:73 #, kde-format msgid "Run %1" msgstr "चलाएँ %1" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_solid.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_solid.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_solid.po 2013-02-14 07:26:33.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_solid.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: plasma_runner_solid\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-02-14 03:59+0100\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-01-31 19:43+0530\n" "Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" "Language-Team: Hindi <indlinux>\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_webshortcuts.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_webshortcuts.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_webshortcuts.po 2011-09-14 00:21:35.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_webshortcuts.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: krunner_webshortcutsrunner\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2011-08-02 05:39+0200\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2008-07-09 13:38+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_windows.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_windows.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_runner_windows.po 2011-09-14 00:21:35.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_runner_windows.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: plasma_runner_windows\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2011-08-02 05:39+0200\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2010-01-31 20:16+0530\n" "Last-Translator: Rajesh Ranjan <rajesh672@gmail.com>\n" "Language-Team: Hindi <indlinux>\n" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_wallpaper_color.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_wallpaper_color.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_wallpaper_color.po 1970-01-01 00:00:00.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_wallpaper_color.po 2013-11-05 12:40:10.000000000 +0000 @@ -0,0 +1,73 @@ +# translation of plasma_wallpaper_color.po to Hindi +# Copyright (C) YEAR This_file_is_part_of_KDE +# This file is distributed under the same license as the PACKAGE package. +# +# G Karunakar <karunakar@indlinux.org>, 2008. +msgid "" +msgstr "" +"Project-Id-Version: plasma_wallpaper_color\n" +"Report-Msgid-Bugs-To: http://bugs.kde.org\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" +"PO-Revision-Date: 2008-12-02 17:02+0530\n" +"Last-Translator: G Karunakar <karunakar@indlinux.org>\n" +"Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" +"Language: hi\n" +"MIME-Version: 1.0\n" +"Content-Type: text/plain; charset=UTF-8\n" +"Content-Transfer-Encoding: 8bit\n" +"X-Generator: KBabel 1.11.4\n" +"Plural-Forms: nplurals=2; plural=(n!=1);\n" + +#: color.cpp:72 +msgid "Solid" +msgstr "" + +#: color.cpp:73 +msgid "Horizontal" +msgstr "" + +#: color.cpp:74 +msgid "Vertical" +msgstr "" + +#: color.cpp:75 +msgid "Rectangular" +msgstr "" + +#: color.cpp:76 +msgid "Radial" +msgstr "" + +#: color.cpp:77 +msgid "Top Left Diagonal" +msgstr "" + +#: color.cpp:78 +msgid "Top Right Diagonal" +msgstr "" + +#. i18n: ectx: property (windowTitle), widget (QWidget, Config) +#: config.ui:14 +msgid "Color" +msgstr "रंग" + +#. i18n: ectx: property (text), widget (KColorButton, m_color2) +#: config.ui:67 +#, fuzzy +#| msgid "&Color:" +msgid "&Second Color:" +msgstr "रंग: (&C)" + +#. i18n: ectx: property (text), widget (QLabel, label_6) +#: config.ui:131 +#, fuzzy +#| msgid "&Color:" +msgid "&Second color:" +msgstr "रंग: (&C)" + +#. i18n: ectx: property (text), widget (QLabel, label_5) +#: config.ui:150 +#, fuzzy +#| msgid "&Color:" +msgid "&First color:" +msgstr "रंग: (&C)" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_wallpaper_image.po kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_wallpaper_image.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/plasma_wallpaper_image.po 2014-02-21 04:01:56.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/plasma_wallpaper_image.po 2013-12-13 06:58:09.000000000 +0000 @@ -8,7 +8,7 @@ msgstr "" "Project-Id-Version: plasma_wallpaper_image\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-02-21 01:57+0000\n" +"POT-Creation-Date: 2013-12-13 06:00+0000\n" "PO-Revision-Date: 2008-12-04 14:23+0530\n" "Last-Translator: Rajesh Ranjan <rranjan@redhat.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -20,128 +20,162 @@ "Plural-Forms: nplurals=2; plural=(n!=1);\n" "\n" -#: backgroundlistmodel.cpp:314 -msgctxt "Unknown Author" -msgid "Unknown" -msgstr "" - -#: image.cpp:507 +#: image.cpp:100 #, fuzzy #| msgid "Select Wallpaper Image File" -msgid "Open Image" +msgid "Next Wallpaper Image" msgstr "वालपेपर छवि फ़ाइल चुनें" -#: image.cpp:509 -msgid "Image Files (*.png *.jpg *.jpeg *.bmp *.svg *.svgz *.xcf)" -msgstr "" - -#: wallpaperpackage.cpp:40 +#: image.cpp:102 #, fuzzy -#| msgid "Images" -msgid "Images" -msgstr "छवियाँ" +#| msgid "Select Wallpaper Image File" +msgid "Open Wallpaper Image" +msgstr "वालपेपर छवि फ़ाइल चुनें" -#: wallpaperpackage.cpp:47 -msgid "Screenshot" -msgstr "स्क्रीनशॉट" +#: image.cpp:170 image.cpp:230 +msgid "Scaled & Cropped" +msgstr "अनुमापित व काटा गया" + +#: image.cpp:171 image.cpp:231 +msgid "Scaled" +msgstr "स्केल्ड" + +#: image.cpp:172 image.cpp:232 +msgid "Scaled, keep proportions" +msgstr "अनुमापित, अनुपात बनाए रखें" + +#: image.cpp:173 image.cpp:233 +msgid "Centered" +msgstr "केंद्रित" + +#: image.cpp:174 image.cpp:234 +msgid "Tiled" +msgstr "टाइल्ड" + +#: image.cpp:175 image.cpp:235 +msgid "Center Tiled" +msgstr "मध्य चटाई" -#: wallpaperpackage.cpp:95 wallpaperpackage.cpp:150 -msgid "Recommended wallpaper file" -msgstr "" +#: image.cpp:693 +msgid "Select Wallpaper Image File" +msgstr "वालपेपर छवि फ़ाइल चुनें" -#: wallpaperpackage.cpp:96 -msgid "Preview" +#. i18n: ectx: property (text), widget (QLabel, m_positioningLabel) +#: imageconfig.ui:45 +msgid "P&ositioning:" +msgstr "अवस्थिति (&o):" + +#. i18n: ectx: property (text), widget (QLabel, m_colorLabel) +#. i18n: ectx: property (text), widget (QLabel, label_5) +#: imageconfig.ui:58 slideshowconfig.ui:57 +msgid "&Color:" +msgstr "रंग: (&C)" + +#. i18n: ectx: property (toolTip), widget (KColorButton, m_color) +#: imageconfig.ui:79 slideshowconfig.ui:72 +msgid "Change wallpaper frame color" msgstr "" -#, fuzzy -#~| msgid "Select Wallpaper Image File" -#~ msgid "Next Wallpaper Image" -#~ msgstr "वालपेपर छवि फ़ाइल चुनें" - -#, fuzzy -#~| msgid "Select Wallpaper Image File" -#~ msgid "Open Wallpaper Image" -#~ msgstr "वालपेपर छवि फ़ाइल चुनें" - -#~ msgid "Scaled & Cropped" -#~ msgstr "अनुमापित व काटा गया" - -#~ msgid "Scaled" -#~ msgstr "स्केल्ड" - -#~ msgid "Scaled, keep proportions" -#~ msgstr "अनुमापित, अनुपात बनाए रखें" - -#~ msgid "Centered" -#~ msgstr "केंद्रित" - -#~ msgid "Tiled" -#~ msgstr "टाइल्ड" - -#~ msgid "Center Tiled" -#~ msgstr "मध्य चटाई" - -#~ msgid "Select Wallpaper Image File" -#~ msgstr "वालपेपर छवि फ़ाइल चुनें" - -#~ msgid "P&ositioning:" -#~ msgstr "अवस्थिति (&o):" - -#~ msgid "&Color:" -#~ msgstr "रंग: (&C)" - -#, fuzzy -#~| msgid "..." -#~ msgid "Open..." -#~ msgstr "..." - -#~ msgid "Get New Wallpapers..." -#~ msgstr "नया वालपेपर पाएँ..." - -#, fuzzy -#~| msgid "&Remove Folder" -#~ msgid "Remove from list" -#~ msgstr "फ़ोल्डर मिटाएं (&R)" +#. i18n: ectx: property (whatsThis), widget (KColorButton, m_color) +#: imageconfig.ui:82 slideshowconfig.ui:75 +msgid "" +"Change the color of the frame that it may be visible when the wallpaper is " +"centered or scaled with the same proportions." +msgstr "" +#. i18n: ectx: property (text), widget (KPushButton, m_pictureUrlButton) +#: imageconfig.ui:160 #, fuzzy -#~| msgid "P&ositioning:" -#~ msgid "&Positioning:" -#~ msgstr "अवस्थिति (&o):" +#| msgid "..." +msgid "Open..." +msgstr "..." + +#. i18n: ectx: property (text), widget (QPushButton, m_newStuff) +#: imageconfig.ui:169 slideshowconfig.ui:292 +msgid "Get New Wallpapers..." +msgstr "नया वालपेपर पाएँ..." + +#: removebutton.cpp:52 +#, fuzzy +#| msgid "&Remove Folder" +msgid "Remove from list" +msgstr "फ़ोल्डर मिटाएं (&R)" + +#. i18n: ectx: property (text), widget (QLabel, label_4) +#: slideshowconfig.ui:17 +#, fuzzy +#| msgid "P&ositioning:" +msgid "&Positioning:" +msgstr "अवस्थिति (&o):" + +#. i18n: ectx: property (text), widget (QLabel, label_2) +#: slideshowconfig.ui:117 +#, fuzzy +#| msgid "&Change images every:" +msgid "C&hange images every:" +msgstr "छवि बदलें हर (&C):" + +#. i18n: ectx: property (displayFormat), widget (QTimeEdit, m_slideshowDelay) +#: slideshowconfig.ui:150 +msgctxt "" +"(qtdt-format) Please do not change the quotes (') and translate only the " +"content of the quotes." +msgid "hh 'Hours' mm 'Mins' ss 'Secs'" +msgstr "hh 'घंटे' mm 'मिनट' ss 'सेकण्ड'" +#. i18n: ectx: property (text), widget (QLabel, label_6) +#: slideshowconfig.ui:173 #, fuzzy -#~| msgid "&Change images every:" -#~ msgid "C&hange images every:" -#~ msgstr "छवि बदलें हर (&C):" - -#~ msgctxt "" -#~ "(qtdt-format) Please do not change the quotes (') and translate only the " -#~ "content of the quotes." -#~ msgid "hh 'Hours' mm 'Mins' ss 'Secs'" -#~ msgstr "hh 'घंटे' mm 'मिनट' ss 'सेकण्ड'" +#| msgid "Images" +msgid "<b>Images</b>" +msgstr "छवियाँ" +#. i18n: ectx: property (text), widget (QLabel, label) +#: slideshowconfig.ui:180 #, fuzzy -#~| msgid "Get New Wallpapers..." -#~ msgid "&System wallpapers:" -#~ msgstr "नया वालपेपर पाएँ..." +#| msgid "Get New Wallpapers..." +msgid "&System wallpapers:" +msgstr "नया वालपेपर पाएँ..." + +#. i18n: ectx: property (toolTip), widget (QCheckBox, m_systemCheckBox) +#: slideshowconfig.ui:193 +msgid "Use system-installed wallpapers in slideshow" +msgstr "" +#. i18n: ectx: property (text), widget (QLabel, label_3) +#: slideshowconfig.ui:206 #, fuzzy -#~| msgid "Download new wallpapers" -#~ msgid "&My downloaded wallpapers:" -#~ msgstr "नया वालपेपर डाउनलोड करें" +#| msgid "Download new wallpapers" +msgid "&My downloaded wallpapers:" +msgstr "नया वालपेपर डाउनलोड करें" + +#. i18n: ectx: property (toolTip), widget (QCheckBox, m_downloadedCheckBox) +#: slideshowconfig.ui:219 +msgid "" +"Use wallpapers I have downloaded with \"Get New Wallpapers...\" in slideshow" +msgstr "" +#. i18n: ectx: property (text), widget (QLabel, label_7) +#: slideshowconfig.ui:232 #, fuzzy -#~| msgid "Folders:" -#~ msgid "Custom folders:" -#~ msgstr "फ़ोल्डर:" - -#~ msgid "&Add Folder..." -#~ msgstr "फ़ोल्डर जोड़ें... (&A)" - -#~ msgid "&Remove Folder" -#~ msgstr "फ़ोल्डर मिटाएं (&R)" - -#~ msgid "Download new wallpapers" -#~ msgstr "नया वालपेपर डाउनलोड करें" +#| msgid "Folders:" +msgid "Custom folders:" +msgstr "फ़ोल्डर:" + +#. i18n: ectx: property (text), widget (KPushButton, m_addDir) +#: slideshowconfig.ui:269 +msgid "&Add Folder..." +msgstr "फ़ोल्डर जोड़ें... (&A)" + +#. i18n: ectx: property (text), widget (KPushButton, m_removeDir) +#: slideshowconfig.ui:282 +msgid "&Remove Folder" +msgstr "फ़ोल्डर मिटाएं (&R)" + +#. i18n: ectx: property (toolTip), widget (QPushButton, m_newStuff) +#: slideshowconfig.ui:289 +msgid "Download new wallpapers" +msgstr "नया वालपेपर डाउनलोड करें" #~ msgctxt "Caption to wallpaper preview, %1 author name" #~ msgid "by %1" @@ -176,3 +210,6 @@ #~ msgid "&Picture:" #~ msgstr "छविः (&P)" + +#~ msgid "Screenshot" +#~ msgstr "स्क्रीनशॉट" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/powerdevil.po kde-l10n-hi-4.13.0/messages/kde-workspace/powerdevil.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/powerdevil.po 2014-03-14 06:47:58.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/powerdevil.po 2013-11-05 12:40:10.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kde4 - powerdevil\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-14 04:59+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2008-12-02 17:49+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" "Language-Team: Indlinux <indlinux-hindi@lists.sourceforge.net>\n" @@ -25,150 +25,170 @@ msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" -msgstr "raviratlami@aol.in," +msgstr "raviratlami@aol.in" -#: actions/bundled/brightnesscontrol.cpp:57 +#: actions/bundled/brightnesscontrol.cpp:55 msgctxt "@action:inmenu Global shortcut" msgid "Increase Screen Brightness" msgstr "" -#: actions/bundled/brightnesscontrol.cpp:62 +#: actions/bundled/brightnesscontrol.cpp:60 msgctxt "@action:inmenu Global shortcut" msgid "Decrease Screen Brightness" msgstr "" -#: actions/bundled/brightnesscontrolconfig.cpp:63 +#: actions/bundled/brightnesscontrolconfig.cpp:64 msgctxt "Brightness level, label for the slider" msgid "Level" msgstr "" -#: actions/bundled/dimdisplayconfig.cpp:63 -#: actions/bundled/runscriptconfig.cpp:80 -#: actions/bundled/suspendsessionconfig.cpp:76 -#: actions/dpms/powerdevildpmsactionconfig.cpp:59 +#: actions/bundled/dimdisplayconfig.cpp:64 +#: actions/bundled/runscriptconfig.cpp:81 +#: actions/bundled/suspendsessionconfig.cpp:77 +#: actions/dpms/powerdevildpmsactionconfig.cpp:60 msgid " min" msgstr "मि." -#: actions/bundled/dimdisplayconfig.cpp:64 -#: actions/bundled/runscriptconfig.cpp:83 -#: actions/bundled/runscriptconfig.cpp:104 -#: actions/bundled/suspendsessionconfig.cpp:96 +#: actions/bundled/dimdisplayconfig.cpp:65 +#: actions/bundled/runscriptconfig.cpp:84 +#: actions/bundled/runscriptconfig.cpp:105 +#: actions/bundled/suspendsessionconfig.cpp:97 msgid "After" msgstr "" -#: actions/bundled/handlebuttonevents.cpp:61 +#: actions/bundled/handlebuttonevents.cpp:58 msgctxt "@action:inmenu Global shortcut" msgid "Sleep" msgstr "" -#: actions/bundled/handlebuttonevents.cpp:66 +#: actions/bundled/handlebuttonevents.cpp:63 msgctxt "@action:inmenu Global shortcut" msgid "Hibernate" msgstr "" -#: actions/bundled/handlebuttoneventsconfig.cpp:88 +#: actions/bundled/handlebuttoneventsconfig.cpp:89 msgid "Do nothing" msgstr "कुछ नहीं करें" -#: actions/bundled/handlebuttoneventsconfig.cpp:90 -#: actions/bundled/suspendsessionconfig.cpp:81 +#: actions/bundled/handlebuttoneventsconfig.cpp:91 +#: actions/bundled/suspendsessionconfig.cpp:82 msgid "Sleep" msgstr "" -#: actions/bundled/handlebuttoneventsconfig.cpp:93 -#: actions/bundled/suspendsessionconfig.cpp:84 +#: actions/bundled/handlebuttoneventsconfig.cpp:94 +#: actions/bundled/suspendsessionconfig.cpp:85 msgid "Hibernate" msgstr "" -#: actions/bundled/handlebuttoneventsconfig.cpp:95 -#: actions/bundled/suspendsessionconfig.cpp:86 +#: actions/bundled/handlebuttoneventsconfig.cpp:96 +#: actions/bundled/suspendsessionconfig.cpp:87 msgid "Shutdown" msgstr "बन्दकरें" -#: actions/bundled/handlebuttoneventsconfig.cpp:96 -#: actions/bundled/suspendsessionconfig.cpp:87 +#: actions/bundled/handlebuttoneventsconfig.cpp:97 +#: actions/bundled/suspendsessionconfig.cpp:88 #, fuzzy #| msgid "Lock Screen" msgid "Lock screen" msgstr "स्क्रीन पर ताला लगाएँ" -#: actions/bundled/handlebuttoneventsconfig.cpp:98 +#: actions/bundled/handlebuttoneventsconfig.cpp:99 #, fuzzy #| msgid "Prompt Log out dialog" msgid "Prompt log out dialog" msgstr "लॉग आउट संवाद पूछें" -#: actions/bundled/handlebuttoneventsconfig.cpp:100 +#: actions/bundled/handlebuttoneventsconfig.cpp:101 msgid "Turn off screen" msgstr "" -#: actions/bundled/handlebuttoneventsconfig.cpp:125 +#: actions/bundled/handlebuttoneventsconfig.cpp:126 #, fuzzy #| msgid "When Laptop Lid Closed" msgid "When laptop lid closed" msgstr "जब लैपटॉप का ढक्कन बंद हो तो" -#: actions/bundled/handlebuttoneventsconfig.cpp:132 +#: actions/bundled/handlebuttoneventsconfig.cpp:133 #, fuzzy #| msgid "When Power Button pressed" msgid "When power button pressed" msgstr "जब पावर बटन दबाया जाए" -#: actions/bundled/keyboardbrightnesscontrol.cpp:57 +#: actions/bundled/keyboardbrightnesscontrol.cpp:54 msgctxt "@action:inmenu Global shortcut" msgid "Increase Keyboard Brightness" msgstr "" -#: actions/bundled/keyboardbrightnesscontrol.cpp:62 +#: actions/bundled/keyboardbrightnesscontrol.cpp:59 msgctxt "@action:inmenu Global shortcut" msgid "Decrease Keyboard Brightness" msgstr "" -#: actions/bundled/keyboardbrightnesscontrol.cpp:67 +#: actions/bundled/keyboardbrightnesscontrol.cpp:64 msgctxt "@action:inmenu Global shortcut" msgid "Toggle Keyboard Backlight" msgstr "" -#: actions/bundled/keyboardbrightnesscontrolconfig.cpp:63 +#: actions/bundled/keyboardbrightnesscontrolconfig.cpp:64 msgctxt "@label:slider Brightness level" msgid "Level" msgstr "" -#: actions/bundled/runscriptconfig.cpp:70 +#: actions/bundled/runscriptconfig.cpp:71 msgid "Script" msgstr "" -#: actions/bundled/runscriptconfig.cpp:81 +#: actions/bundled/runscriptconfig.cpp:82 #, fuzzy #| msgid "New Profile" msgid "On Profile Load" msgstr "नया प्रोफ़ाइल" -#: actions/bundled/runscriptconfig.cpp:82 +#: actions/bundled/runscriptconfig.cpp:83 msgid "On Profile Unload" msgstr "" -#: actions/bundled/runscriptconfig.cpp:93 +#: actions/bundled/runscriptconfig.cpp:94 msgid "Run script" msgstr "" -#: actions/dpms/powerdevildpmsactionconfig.cpp:60 +#: actions/dpms/powerdevildpmsactionconfig.cpp:61 #, fuzzy #| msgid "&Power off after" msgid "Switch off after" msgstr "इतने समय के बाद बिज़ली बन्द करें (&P)" -#: backends/upower/backlighthelper.cpp:259 -msgid "Can't open file" -msgstr "" - -#: backends/upower/login1suspendjob.cpp:83 -#: backends/upower/upowersuspendjob.cpp:76 +#: backends/upower/login1suspendjob.cpp:82 +#: backends/upower/upowersuspendjob.cpp:75 #, fuzzy #| msgid "Supported suspend methods" msgid "Unsupported suspend method" msgstr "समर्थित निलंबन विधियाँ" +#: kdedpowerdevil.cpp:58 +#, fuzzy +#| msgid "A Power Management tool for KDE4" +msgid "KDE Power Management System" +msgstr "केडीई4 के लिए पावर प्रबंधन औजार" + +#: kdedpowerdevil.cpp:59 +msgid "" +"KDE Power Management System is PowerDevil, an advanced, modular and " +"lightweight Power Management daemon" +msgstr "" + +#: kdedpowerdevil.cpp:62 +msgid "(c) 2010 MetalWorkers Co." +msgstr "" + +#: kdedpowerdevil.cpp:65 +msgid "Dario Freddi" +msgstr "डेरियो फ्रेदी" + +#: kdedpowerdevil.cpp:65 +msgid "Maintainer" +msgstr "मेंटेनर" + #: powerdevilcore.cpp:74 msgid "" "No valid Power Management backend plugins are available. A new installation " @@ -364,17 +384,6 @@ msgstr "" #, fuzzy -#~| msgid "A Power Management tool for KDE4" -#~ msgid "KDE Power Management System" -#~ msgstr "केडीई4 के लिए पावर प्रबंधन औजार" - -#~ msgid "Dario Freddi" -#~ msgstr "डेरियो फ्रेदी" - -#~ msgid "Maintainer" -#~ msgstr "मेंटेनर" - -#, fuzzy #~| msgid "Lock Screen" #~ msgid "Locking Screen" #~ msgstr "स्क्रीन पर ताला लगाएँ" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/processcore.po kde-l10n-hi-4.13.0/messages/kde-workspace/processcore.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/processcore.po 2013-09-25 03:30:14.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/processcore.po 2013-11-05 12:40:10.000000000 +0000 @@ -8,7 +8,7 @@ msgstr "" "Project-Id-Version: processcore\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-09-25 01:46+0000\n" +"POT-Creation-Date: 2013-11-05 11:50+0000\n" "PO-Revision-Date: 2008-07-09 15:57+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@aol.in>\n" "Language-Team: Hindi <Indlinux-hindi@lists.sourceforge.net>\n" @@ -19,117 +19,117 @@ "X-Generator: KBabel 1.11.4\n" "Plural-Forms: nplurals=2; plural=(n!=1);\n" -#: process.cpp:38 process.cpp:48 +#: process.cpp:37 process.cpp:47 msgctxt "Process Niceness" msgid "Normal" msgstr "सामान्य" -#: process.cpp:39 process.cpp:49 +#: process.cpp:38 process.cpp:48 msgctxt "Process Niceness" msgid "Very low priority" msgstr "अति निम्न प्राथमिकता" -#: process.cpp:40 process.cpp:50 +#: process.cpp:39 process.cpp:49 msgctxt "Process Niceness" msgid "Low priority" msgstr "निम्न प्राथमिकता " -#: process.cpp:41 process.cpp:51 +#: process.cpp:40 process.cpp:50 msgctxt "Process Niceness" msgid "Very high priority" msgstr "अति उच्च प्राथमिकता" -#: process.cpp:42 process.cpp:52 +#: process.cpp:41 process.cpp:51 msgctxt "Process Niceness" msgid "High priority" msgstr "उच्च प्राथमिकता " -#: process.cpp:59 +#: process.cpp:58 msgctxt "Priority Class" msgid "None" msgstr "कुछ नहीं" -#: process.cpp:60 +#: process.cpp:59 msgctxt "Priority Class" msgid "Real Time" msgstr "रीयल टाइम" -#: process.cpp:61 +#: process.cpp:60 msgctxt "Priority Class" msgid "Best Effort" msgstr "सर्वोत्तम प्रयास" -#: process.cpp:62 +#: process.cpp:61 msgctxt "Priority Class" msgid "Idle" msgstr "निष्क्रिय" -#: process.cpp:63 +#: process.cpp:62 msgctxt "Priority Class" msgid "Unknown" msgstr "अज्ञात" -#: process.cpp:69 +#: process.cpp:68 msgctxt "process status" msgid "running" msgstr "चल रहा है" -#: process.cpp:70 +#: process.cpp:69 msgctxt "process status" msgid "sleeping" msgstr "सो रहा है" -#: process.cpp:71 +#: process.cpp:70 msgctxt "process status" msgid "disk sleep" msgstr "डिस्क स्लीप" -#: process.cpp:72 +#: process.cpp:71 msgctxt "process status" msgid "zombie" msgstr "जॉम्बी" -#: process.cpp:73 +#: process.cpp:72 msgctxt "process status" msgid "stopped" msgstr "रुका हुआ है" -#: process.cpp:74 +#: process.cpp:73 msgctxt "process status" msgid "paging" msgstr "पेजिंग" -#: process.cpp:75 +#: process.cpp:74 msgctxt "process status" msgid "finished" msgstr "" -#: process.cpp:76 +#: process.cpp:75 msgctxt "process status" msgid "unknown" msgstr "अज्ञात" -#: process.cpp:82 +#: process.cpp:81 msgctxt "Scheduler" msgid "FIFO" msgstr "फीफो" -#: process.cpp:83 +#: process.cpp:82 msgctxt "Scheduler" msgid "Round Robin" msgstr "राउण्ड रॉबिन" -#: process.cpp:84 +#: process.cpp:83 msgctxt "Scheduler" msgid "Interactive" msgstr "" -#: process.cpp:85 +#: process.cpp:84 msgctxt "Scheduler" msgid "Batch" msgstr "बैच" -#: process.cpp:86 +#: process.cpp:85 #, fuzzy #| msgctxt "Priority Class" #| msgid "Idle" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/processui.po kde-l10n-hi-4.13.0/messages/kde-workspace/processui.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/processui.po 2013-11-30 03:11:22.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/processui.po 2014-03-27 07:22:19.000000000 +0000 @@ -8,7 +8,7 @@ msgstr "" "Project-Id-Version: processui\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2013-11-30 01:37+0000\n" +"POT-Creation-Date: 2014-03-27 06:16+0000\n" "PO-Revision-Date: 2010-02-01 01:25+0530\n" "Last-Translator: G Karunakar <karunakar@Indlinux.org>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -19,7 +19,7 @@ "Plural-Forms: nplurals=2; plural=(n!=1);\n" "X-Generator: KBabel 1.11.4\n" -#: ksysguardprocesslist.cpp:157 ksysguardprocesslist.cpp:413 +#: ksysguardprocesslist.cpp:158 ksysguardprocesslist.cpp:414 #, fuzzy #| msgid "Low Priority" msgid "Set Priority..." @@ -27,23 +27,23 @@ msgstr[0] "निम्न प्राथमिकता" msgstr[1] "निम्न प्राथमिकता" -#: ksysguardprocesslist.cpp:159 ksysguardprocesslist.cpp:508 +#: ksysguardprocesslist.cpp:160 ksysguardprocesslist.cpp:509 msgid "Jump to Parent Process" msgstr "पैरेन्ट प्रक्रिया में जाएँ" -#: ksysguardprocesslist.cpp:161 +#: ksysguardprocesslist.cpp:162 msgid "Jump to Process Debugging This One" msgstr "इस प्रक्रिया को डिबगिंग करने के लिए जाएँ" -#: ksysguardprocesslist.cpp:162 +#: ksysguardprocesslist.cpp:163 msgid "Show Application Window" msgstr "अनुप्रयोग विंडो दिखाएँ" -#: ksysguardprocesslist.cpp:163 +#: ksysguardprocesslist.cpp:164 msgid "Resume Stopped Process" msgstr "बन्द प्रक्रियाओं को फिर से चालू करें" -#: ksysguardprocesslist.cpp:164 +#: ksysguardprocesslist.cpp:165 #, fuzzy #| msgid "Own Processes" msgid "End Process" @@ -51,7 +51,7 @@ msgstr[0] "निजी प्रक्रियाएँ" msgstr[1] "निजी प्रक्रियाएँ" -#: ksysguardprocesslist.cpp:167 ksysguardprocesslist.cpp:414 +#: ksysguardprocesslist.cpp:168 ksysguardprocesslist.cpp:415 #, fuzzy #| msgid "Kill Process" #| msgid_plural "Kill Processes" @@ -60,43 +60,43 @@ msgstr[0] "प्रक्रिया बन्द करें" msgstr[1] "प्रक्रियाएँ बन्द करें" -#: ksysguardprocesslist.cpp:171 +#: ksysguardprocesslist.cpp:172 msgid "Suspend (STOP)" msgstr "निलंबित (STOP)" -#: ksysguardprocesslist.cpp:172 +#: ksysguardprocesslist.cpp:173 msgid "Continue (CONT)" msgstr "जारी (CONT)" -#: ksysguardprocesslist.cpp:173 +#: ksysguardprocesslist.cpp:174 msgid "Hangup (HUP)" msgstr "हैंगअप (HUP)" -#: ksysguardprocesslist.cpp:174 +#: ksysguardprocesslist.cpp:175 msgid "Interrupt (INT)" msgstr "इंटरप्ट (INT)" -#: ksysguardprocesslist.cpp:175 +#: ksysguardprocesslist.cpp:176 msgid "Terminate (TERM)" msgstr "बन्द (टर्मि)" -#: ksysguardprocesslist.cpp:176 +#: ksysguardprocesslist.cpp:177 msgid "Kill (KILL)" msgstr "किल (किल)" -#: ksysguardprocesslist.cpp:177 +#: ksysguardprocesslist.cpp:178 msgid "User 1 (USR1)" msgstr "उपयोक्ता १ (उपयोक्ता१)" -#: ksysguardprocesslist.cpp:178 +#: ksysguardprocesslist.cpp:179 msgid "User 2 (USR2)" msgstr "उपयोक्ता २ (उपयोक्ता२)" -#: ksysguardprocesslist.cpp:181 +#: ksysguardprocesslist.cpp:182 msgid "Focus on Quick Search" msgstr "त्वरित खोज पर ध्यान" -#: ksysguardprocesslist.cpp:335 +#: ksysguardprocesslist.cpp:336 msgid "" "<qt>End the selected process. Warning - you may lose unsaved work.<br>Right " "click on a process to send other signals.<br>See What's This for technical " @@ -104,7 +104,7 @@ "any time." msgstr "" -#: ksysguardprocesslist.cpp:415 +#: ksysguardprocesslist.cpp:416 #, fuzzy #| msgid "Own Processes" msgctxt "Context menu" @@ -113,94 +113,94 @@ msgstr[0] "निजी प्रक्रियाएँ" msgstr[1] "निजी प्रक्रियाएँ" -#: ksysguardprocesslist.cpp:451 +#: ksysguardprocesslist.cpp:452 msgid "Send Signal" msgstr "संकेत भेजें" -#: ksysguardprocesslist.cpp:471 +#: ksysguardprocesslist.cpp:472 #, kde-format msgid "Jump to Parent Process (%1)" msgstr "पैरेन्ट प्रक्रिया (%1) पर जाएँ" -#: ksysguardprocesslist.cpp:609 +#: ksysguardprocesslist.cpp:610 #, kde-format msgid "Hide Column '%1'" msgstr "स्तम्भ '%1' को छुपाएं" -#: ksysguardprocesslist.cpp:625 +#: ksysguardprocesslist.cpp:626 #, kde-format msgid "Show Column '%1'" msgstr "स्तम्भ '%1' को दिखाएँ" -#: ksysguardprocesslist.cpp:653 +#: ksysguardprocesslist.cpp:654 msgid "Display Units" msgstr "प्रदर्शक इकाई" -#: ksysguardprocesslist.cpp:657 +#: ksysguardprocesslist.cpp:658 msgid "Mixed" msgstr "" -#: ksysguardprocesslist.cpp:663 +#: ksysguardprocesslist.cpp:664 msgid "Kilobytes per second" msgstr "किलोबाइट्स प्रति क्षण" -#: ksysguardprocesslist.cpp:663 +#: ksysguardprocesslist.cpp:664 msgid "Kilobytes" msgstr "किलोबाइट्स" -#: ksysguardprocesslist.cpp:669 +#: ksysguardprocesslist.cpp:670 msgid "Megabytes per second" msgstr "मेगाबाइट्स प्रति क्षण" -#: ksysguardprocesslist.cpp:669 +#: ksysguardprocesslist.cpp:670 msgid "Megabytes" msgstr "मेगाबाइट्स" -#: ksysguardprocesslist.cpp:675 +#: ksysguardprocesslist.cpp:676 msgid "Gigabytes per second" msgstr "गीगाबाइट्स प्रति क्षण" -#: ksysguardprocesslist.cpp:675 +#: ksysguardprocesslist.cpp:676 msgid "Gigabytes" msgstr "गीगाबाइट्स" -#: ksysguardprocesslist.cpp:684 +#: ksysguardprocesslist.cpp:685 msgid "Percentage" msgstr "" -#: ksysguardprocesslist.cpp:713 +#: ksysguardprocesslist.cpp:714 msgid "Display command line options" msgstr "" -#: ksysguardprocesslist.cpp:720 +#: ksysguardprocesslist.cpp:721 msgid "Divide CPU usage by number of CPUs" msgstr "" -#: ksysguardprocesslist.cpp:727 +#: ksysguardprocesslist.cpp:728 msgid "Displayed Information" msgstr "" -#: ksysguardprocesslist.cpp:730 +#: ksysguardprocesslist.cpp:731 msgid "Characters read/written" msgstr "अक्षर पढे/लिखे" -#: ksysguardprocesslist.cpp:735 +#: ksysguardprocesslist.cpp:736 msgid "Number of Read/Write operations" msgstr "" -#: ksysguardprocesslist.cpp:740 +#: ksysguardprocesslist.cpp:741 msgid "Bytes actually read/written" msgstr "" -#: ksysguardprocesslist.cpp:746 +#: ksysguardprocesslist.cpp:747 msgid "Show I/O rate" msgstr "" -#: ksysguardprocesslist.cpp:773 +#: ksysguardprocesslist.cpp:774 msgid "Show Tooltips" msgstr "" -#: ksysguardprocesslist.cpp:1035 +#: ksysguardprocesslist.cpp:1036 #, kde-format msgid "" "You do not have the permission to renice the process and there was a problem " @@ -209,11 +209,11 @@ "आपके पास प्रक्रिया को बन्द करने के लिए अनुमतियाँ नहीं हैं, और यहां पर इसे रूट के रूप में चलाने " "में समस्या हुई. त्रुटि %1 %2" -#: ksysguardprocesslist.cpp:1065 ksysguardprocesslist.cpp:1310 +#: ksysguardprocesslist.cpp:1065 ksysguardprocesslist.cpp:1301 msgid "You must select a process first." msgstr "आपको पहले कोई प्रक्रिया चुनना होगा." -#: ksysguardprocesslist.cpp:1204 +#: ksysguardprocesslist.cpp:1202 #, kde-format msgid "" "You do not have the permission to change the I/O priority of the process and " @@ -222,7 +222,7 @@ "आपके पास प्रक्रिया को बन्द करने के लिए अनुमतियाँ नहीं हैं, और यहां पर इसे रूट के रूप में चलाने " "में समस्या हुई. त्रुटि %1 %2" -#: ksysguardprocesslist.cpp:1239 +#: ksysguardprocesslist.cpp:1234 #, kde-format msgid "" "You do not have the permission to change the CPU Scheduler for the process " @@ -231,7 +231,7 @@ "आपके पास प्रक्रिया को बन्द करने के लिए अनुमतियाँ नहीं हैं, और यहां पर इसे रूट के रूप में चलाने " "में समस्या हुई. त्रुटि %1 %2" -#: ksysguardprocesslist.cpp:1274 +#: ksysguardprocesslist.cpp:1266 #, fuzzy, kde-format #| msgid "" #| "You do not have the permission to kill the process and there was a " @@ -243,7 +243,7 @@ "आपके पास प्रक्रिया को बन्द करने के लिए अनुमतियाँ नहीं हैं, और यहां पर इसे रूट के रूप में चलाने " "में समस्या हुई. त्रुटि %1 %2" -#: ksysguardprocesslist.cpp:1278 +#: ksysguardprocesslist.cpp:1270 #, kde-format msgid "" "You do not have the permission to kill the process and there was a problem " @@ -252,7 +252,7 @@ "आपके पास प्रक्रिया को बन्द करने के लिए अनुमतियाँ नहीं हैं, और यहां पर इसे रूट के रूप में चलाने " "में समस्या हुई. त्रुटि %1 %2" -#: ksysguardprocesslist.cpp:1319 +#: ksysguardprocesslist.cpp:1310 #, fuzzy, kde-format #| msgid "Do you want to kill the selected process?" #| msgid_plural "Do you want to kill the %1 selected processes?" @@ -264,7 +264,7 @@ msgstr[0] "क्या आप चयनित प्रक्रिया को बन्द करना चाहते हैं?" msgstr[1] "क्या आप इन %1 चयनित प्रक्रियाओं को बन्द करना चाहते हैं?" -#: ksysguardprocesslist.cpp:1322 +#: ksysguardprocesslist.cpp:1313 #, fuzzy, kde-format #| msgid "Own Processes" msgctxt "Dialog title" @@ -273,11 +273,11 @@ msgstr[0] "निजी प्रक्रियाएँ" msgstr[1] "निजी प्रक्रियाएँ" -#: ksysguardprocesslist.cpp:1324 +#: ksysguardprocesslist.cpp:1315 msgid "End" msgstr "" -#: ksysguardprocesslist.cpp:1326 +#: ksysguardprocesslist.cpp:1317 #, fuzzy, kde-format #| msgid "Do you want to kill the selected process?" #| msgid_plural "Do you want to kill the %1 selected processes?" @@ -290,7 +290,7 @@ msgstr[0] "क्या आप चयनित प्रक्रिया को बन्द करना चाहते हैं?" msgstr[1] "क्या आप इन %1 चयनित प्रक्रियाओं को बन्द करना चाहते हैं?" -#: ksysguardprocesslist.cpp:1329 +#: ksysguardprocesslist.cpp:1320 #, fuzzy, kde-format #| msgid "Kill Process" #| msgid_plural "Kill Processes" @@ -300,7 +300,7 @@ msgstr[0] "प्रक्रिया बन्द करें" msgstr[1] "प्रक्रियाएँ बन्द करें" -#: ksysguardprocesslist.cpp:1331 +#: ksysguardprocesslist.cpp:1322 msgid "Kill" msgstr "बन्द करें" @@ -331,38 +331,38 @@ msgid "%1 P" msgstr "%1 कि" -#: ProcessModel.cpp:583 +#: ProcessModel.cpp:593 msgid "- Process is doing some work." msgstr "- प्रक्रिया कुछ काम कर रहा है." -#: ProcessModel.cpp:585 +#: ProcessModel.cpp:595 msgid "- Process is waiting for something to happen." msgstr "- प्रक्रिया कुछ होने के लिए इंतजार कर रहा है." -#: ProcessModel.cpp:587 +#: ProcessModel.cpp:597 msgid "" "- Process has been stopped. It will not respond to user input at the moment." msgstr "- प्रक्रिया बन्द है. इस वक्त यह उपयोक्ता को इससे कोई प्रतिक्रिया नहीं मिलेगी." -#: ProcessModel.cpp:589 +#: ProcessModel.cpp:599 msgid "" "- Process has finished and is now dead, but the parent process has not " "cleaned up." msgstr "- प्रक्रिया पूरी हो चुकी है और अब मृत है, परंतु अभिभावक प्रक्रिया साफ नहीं हुई है." -#: ProcessModel.cpp:938 +#: ProcessModel.cpp:948 msgid "The process name." msgstr "प्रक्रिया नाम." -#: ProcessModel.cpp:940 +#: ProcessModel.cpp:950 msgid "The user who owns this process." msgstr "उपयोक्ता जो इस प्रक्रिया का मालिक है." -#: ProcessModel.cpp:942 +#: ProcessModel.cpp:952 msgid "The controlling terminal on which this process is running." msgstr "नियंत्रक टर्मिनल जिसमें यह प्रक्रिया चल रही है." -#: ProcessModel.cpp:944 +#: ProcessModel.cpp:954 #, fuzzy #| msgid "" #| "The priority with which this process is being run. Ranges from 19 (very " @@ -374,11 +374,11 @@ "प्राथमिकता जिसमें यह प्रक्रिया चलेगी. इसकी सीमा १९ (बहुत ही नाइस, सबसे कम प्राथमिकता) " "से -१९ (सर्वोच्च प्राथमिकता) होती है" -#: ProcessModel.cpp:947 +#: ProcessModel.cpp:957 msgid "The current CPU usage of the process." msgstr "प्रक्रिया का वर्तमान सीपीयू उपयोग" -#: ProcessModel.cpp:952 +#: ProcessModel.cpp:962 #, kde-format msgid "" "The current total CPU usage of the process, divided by the %1 processor core " @@ -391,24 +391,24 @@ msgstr[1] "" "प्रक्रिया का वर्तमान सीपीयू उपयोग, मशीन के %1 प्रोसेसर कोर की संख्या से विभाजित" -#: ProcessModel.cpp:954 +#: ProcessModel.cpp:964 msgid "The current total CPU usage of the process." msgstr "प्रक्रिया का वर्तमान कुल सीपीयू उपयोग" -#: ProcessModel.cpp:956 +#: ProcessModel.cpp:966 msgid "" "<qt>The total user and system time that this process has been running for, " "displayed as minutes:seconds." msgstr "" -#: ProcessModel.cpp:958 +#: ProcessModel.cpp:968 msgid "" "<qt>This is the amount of virtual memory space that the process is using, " "included shared libraries, graphics memory, files on disk, and so on. This " "number is almost meaningless.</qt>" msgstr "" -#: ProcessModel.cpp:960 +#: ProcessModel.cpp:970 msgid "" "<qt>This is the amount of real physical memory that this process is using by " "itself, and approximates the Private memory usage of the process.<br>It does " @@ -417,40 +417,40 @@ "of a program. See What's This for more information.</qt>" msgstr "" -#: ProcessModel.cpp:962 +#: ProcessModel.cpp:972 msgid "" "<qt>This is approximately the amount of real physical memory that this " "process's shared libraries are using.<br>This memory is shared among all " "processes that use this library.</qt>" msgstr "" -#: ProcessModel.cpp:964 +#: ProcessModel.cpp:974 msgid "<qt>The command with which this process was launched.</qt>" msgstr "<qt>कमांड जिसके द्वारा यह प्रक्रिया चालू की गई है</qt>" -#: ProcessModel.cpp:966 +#: ProcessModel.cpp:976 #, fuzzy #| msgid "<qt>The title of any windows that this process is showing.</qt>" msgid "<qt>The amount of pixmap memory that this process is using.</qt>" msgstr "<qt>विंडो का शीर्षक जो यह प्रक्रिया दर्शा रहा है</qt>" -#: ProcessModel.cpp:968 +#: ProcessModel.cpp:978 msgid "<qt>The title of any windows that this process is showing.</qt>" msgstr "<qt>विंडो का शीर्षक जो यह प्रक्रिया दर्शा रहा है</qt>" -#: ProcessModel.cpp:970 +#: ProcessModel.cpp:980 msgid "The unique Process ID that identifies this process." msgstr "इस प्रक्रिया की पहचान के लिए विशिष्ट प्रक्रिया आईडी" -#: ProcessModel.cpp:972 +#: ProcessModel.cpp:982 msgid "The number of bytes read. See What's This for more information." msgstr "" -#: ProcessModel.cpp:974 +#: ProcessModel.cpp:984 msgid "The number of bytes written. See What's This for more information." msgstr "" -#: ProcessModel.cpp:983 +#: ProcessModel.cpp:993 msgid "" "<qt><i>Technical information: </i>The kernel process name is a maximum of 8 " "characters long, so the full command is examined. If the first word in the " @@ -458,7 +458,7 @@ "command line is shown, otherwise the process name is used." msgstr "" -#: ProcessModel.cpp:985 +#: ProcessModel.cpp:995 msgid "" "<qt>The user who owns this process. If the effective, setuid etc user is " "different, the user who owns the process will be shown, followed by the " @@ -474,7 +474,7 @@ "more information.</td></tr></table>" msgstr "" -#: ProcessModel.cpp:995 +#: ProcessModel.cpp:1005 msgid "" "<qt>This is the size of allocated address space - not memory, but address " "space. This value in practice means next to nothing. When a process requests " @@ -483,7 +483,7 @@ "i>This is VmSize in proc/*/status and VIRT in top." msgstr "" -#: ProcessModel.cpp:997 +#: ProcessModel.cpp:1007 msgid "" "<qt><i>Technical information: </i>This is an approximation of the Private " "memory usage, calculated as VmRSS - Shared, from /proc/*/statm. This tends " @@ -494,18 +494,18 @@ "accurate, but slower, calculation of the true Private memory usage." msgstr "" -#: ProcessModel.cpp:999 +#: ProcessModel.cpp:1009 msgid "The CPU usage of a process and all of its threads." msgstr "" -#: ProcessModel.cpp:1001 +#: ProcessModel.cpp:1011 msgid "" "<qt>The total system and user time that a process and all of its threads " "have been running on the CPU for. This can be greater than the wall clock " "time if the process has been across multiple CPU cores." msgstr "" -#: ProcessModel.cpp:1003 +#: ProcessModel.cpp:1013 msgid "" "<qt><i>Technical information: </i>This is an approximation of the Shared " "memory, called SHR in top. It is the number of pages that are backed by a " @@ -514,11 +514,11 @@ "slower, calculation of the true Shared memory usage." msgstr "" -#: ProcessModel.cpp:1005 +#: ProcessModel.cpp:1015 msgid "<qt><i>Technical information: </i>This is from /proc/*/cmdline" msgstr "" -#: ProcessModel.cpp:1007 +#: ProcessModel.cpp:1017 msgid "" "<qt><i>Technical information: </i>This is the amount of memory used by the " "Xorg process for images for this process. This is memory used in addition " @@ -528,14 +528,14 @@ "more detailed breakdown." msgstr "" -#: ProcessModel.cpp:1009 +#: ProcessModel.cpp:1019 msgid "" "<qt><i>Technical information: </i>For each X11 window, the X11 property " "_NET_WM_PID is used to map the window to a PID. If a process' windows are " "not shown, then that application incorrectly is not setting _NET_WM_PID." msgstr "" -#: ProcessModel.cpp:1011 +#: ProcessModel.cpp:1021 msgid "" "<qt><i>Technical information: </i>This is the Process ID. A multi-threaded " "application is treated a single process, with all threads sharing the same " @@ -543,7 +543,7 @@ "threads." msgstr "" -#: ProcessModel.cpp:1014 +#: ProcessModel.cpp:1024 msgid "" "<qt>This column shows the IO statistics for each process. The tooltip " "provides the following information:<br><table><tr><td>Characters Read</" @@ -571,146 +571,146 @@ "filesystems/proc.txt in the kernel source." msgstr "" -#: ProcessModel.cpp:1101 +#: ProcessModel.cpp:1111 #, kde-format msgid "Login Name: %1<br/>" msgstr "लॉगिन नाम: %1<br/>" -#: ProcessModel.cpp:1105 +#: ProcessModel.cpp:1115 msgid "This user is not recognized for some reason." msgstr "यह उपयोक्ता कुछ कारणों से पहचाना नहीं गया" -#: ProcessModel.cpp:1108 +#: ProcessModel.cpp:1118 #, kde-format msgid "<b>%1</b><br/>" msgstr "<b>%1</b><br/>" -#: ProcessModel.cpp:1109 +#: ProcessModel.cpp:1119 #, kde-format msgid "Login Name: %1 (uid: %2)<br/>" msgstr "लॉगिन नाम: %1 (उपयोक्ता पहचान: %2)<br/>" -#: ProcessModel.cpp:1111 +#: ProcessModel.cpp:1121 #, kde-format msgid " Room Number: %1<br/>" msgstr " कमरा नंबर: %1<br/>" -#: ProcessModel.cpp:1113 +#: ProcessModel.cpp:1123 #, kde-format msgid " Work Phone: %1<br/>" msgstr " ऑफ़िस फ़ोन: %1<br/>" -#: ProcessModel.cpp:1120 +#: ProcessModel.cpp:1130 #, kde-format msgid "Effective User: %1<br/>" msgstr "प्रभावी उपयोक्ता: %1<br/>" -#: ProcessModel.cpp:1122 +#: ProcessModel.cpp:1132 #, kde-format msgid "Setuid User: %1<br/>" msgstr "सेटयूआईडी उपयोक्ता: %1<br/>" -#: ProcessModel.cpp:1124 +#: ProcessModel.cpp:1134 #, kde-format msgid "File System User: %1<br/>" msgstr "फ़ाइल तंत्र उपयोक्ता: %1<br/>" -#: ProcessModel.cpp:1128 +#: ProcessModel.cpp:1138 #, kde-format msgid "Group: %1" msgstr "समूह: %1" -#: ProcessModel.cpp:1133 +#: ProcessModel.cpp:1143 #, kde-format msgid "<br/>Effective Group: %1" msgstr "<br/>प्रभावी समूह: %1" -#: ProcessModel.cpp:1135 +#: ProcessModel.cpp:1145 #, kde-format msgid "<br/>Setuid Group: %1" msgstr "<br/>सेटयूआईडी समूह: %1" -#: ProcessModel.cpp:1137 +#: ProcessModel.cpp:1147 #, kde-format msgid "<br/>File System Group: %1" msgstr "<br/>फ़ाइल तंत्र समूह: %1" -#: ProcessModel.cpp:1144 +#: ProcessModel.cpp:1154 #, fuzzy, kde-format #| msgid "<numid>%1</numid>: %2, owned by user %3" msgctxt "Short description of a process. PID, name, user" msgid "<numid>%1</numid>: %2, owned by user %3" msgstr "<numid>%1</numid>: %2, उपयोक्ता %3 के स्वामित्व में" -#: ProcessModel.cpp:1151 +#: ProcessModel.cpp:1161 #, kde-format msgid "%1 (gid: <numid>%2</numid>)" msgstr "%1 (gid: <numid>%2</numid>)" -#: ProcessModel.cpp:1172 +#: ProcessModel.cpp:1182 #, kde-format msgid "%1 (uid: %2)" msgstr "%1 (uid: %2)" -#: ProcessModel.cpp:1210 +#: ProcessModel.cpp:1220 #, fuzzy #| msgid "Idle" msgctxt "scheduler" msgid "Idle" msgstr "निष्क्रिय" -#: ProcessModel.cpp:1212 +#: ProcessModel.cpp:1222 #, fuzzy, kde-format #| msgid "Batch" msgctxt "scheduler" msgid "(Batch) %1" msgstr "बैच" -#: ProcessModel.cpp:1214 +#: ProcessModel.cpp:1224 #, kde-format msgctxt "Round robin scheduler" msgid "RR %1" msgstr "" -#: ProcessModel.cpp:1217 +#: ProcessModel.cpp:1227 msgctxt "Real Time scheduler" msgid "RT" msgstr "" -#: ProcessModel.cpp:1219 +#: ProcessModel.cpp:1229 #, fuzzy, kde-format #| msgid "FIFO" msgctxt "First in first out scheduler" msgid "FIFO %1" msgstr "फीफो" -#: ProcessModel.cpp:1221 +#: ProcessModel.cpp:1231 #, kde-format msgctxt "scheduler" msgid "(IA) %1" msgstr "" -#: ProcessModel.cpp:1278 ProcessModel.cpp:1286 ProcessModel.cpp:1304 -#: ProcessModel.cpp:1312 +#: ProcessModel.cpp:1288 ProcessModel.cpp:1296 ProcessModel.cpp:1314 +#: ProcessModel.cpp:1322 #, kde-format msgid "%1/s" msgstr "%1/s" -#: ProcessModel.cpp:1345 +#: ProcessModel.cpp:1355 #, fuzzy, kde-format #| msgid "This process is being debugged by %1 (<numid>%2</numid>)" msgctxt "tooltip. name,pid " msgid "This process is being debugged by %1 (<numid>%2</numid>)" msgstr "प्रक्रिया %1 के द्वारा डीबग किया जा रहा है (<numid>%2</numid>)" -#: ProcessModel.cpp:1366 +#: ProcessModel.cpp:1376 msgid "" "<b>Init</b> is the parent of all other processes and cannot be killed.<br/>" msgstr "" "<b>इनिट</b> सभी अन्य प्रक्रियाओं का अभिभावक है और इसीलिए बन्द नहीं किया जा सकता.<br/" ">" -#: ProcessModel.cpp:1368 +#: ProcessModel.cpp:1378 msgid "" "<b>KThreadd</b> manages kernel threads. The children processes run in the " "kernel, controlling hard disk access, etc.<br/>" @@ -718,13 +718,13 @@ "<b>केथ्रेड</b> कर्नेल थ्रेड का प्रबंधन करता है. शिशु प्रक्रियाएँ कर्नेल में चलती हैं, जो हार्ड " "डिस्क पर पहुँच इत्यादि को नियंत्रित करती हैं<br/>" -#: ProcessModel.cpp:1370 +#: ProcessModel.cpp:1380 #, kde-format msgctxt "name column tooltip. first item is the name" msgid "<b>%1</b><br />Process ID: <numid>%2</numid>" msgstr "<b>%1</b><br />प्रक्रिया आईडी: <numid>%2</numid>" -#: ProcessModel.cpp:1375 +#: ProcessModel.cpp:1385 #, kde-format msgctxt "name column tooltip. first item is the name" msgid "" @@ -734,7 +734,7 @@ "<b>%1</b><br />प्रक्रिया आईडी: <numid>%2</numid><br />अभिभावक: %3 <br /> " "अभिभावकआईडी : <numid>%4</numid>" -#: ProcessModel.cpp:1377 +#: ProcessModel.cpp:1387 #, kde-format msgctxt "name column tooltip. first item is the name" msgid "" @@ -744,57 +744,57 @@ "<b>%1</b><br />प्रक्रिया आईडी: <numid>%2</numid><br />अभिभावक आईडी: <numid>%3</" "numid>" -#: ProcessModel.cpp:1381 ProcessModel.cpp:1445 +#: ProcessModel.cpp:1391 ProcessModel.cpp:1455 #, kde-format msgid "<br/>Number of threads: %1" msgstr "" -#: ProcessModel.cpp:1383 +#: ProcessModel.cpp:1393 #, kde-format msgid "<br/>Command: %1" msgstr "<br/>आदेश: %1" -#: ProcessModel.cpp:1386 +#: ProcessModel.cpp:1396 #, kde-format msgid "<br />Running on: %1" msgstr "<br />पर चल रहा है: %1" -#: ProcessModel.cpp:1394 +#: ProcessModel.cpp:1404 #, kde-format msgid "<qt>This process was run with the following command:<br />%1" msgstr "<qt>इस प्रक्रिया को निम्न कमांड के साथ चलाया गया है:<br />%1" -#: ProcessModel.cpp:1396 +#: ProcessModel.cpp:1406 #, kde-format msgid "<br /><br />Running on: %1" msgstr "<br /><br />पर चल रहा है: %1" -#: ProcessModel.cpp:1411 +#: ProcessModel.cpp:1421 #, kde-format msgid "Nice level: %1 (%2)" msgstr "नाइस स्तर: %1 (%2)" -#: ProcessModel.cpp:1415 +#: ProcessModel.cpp:1425 #, kde-format msgid "This is a real time process.<br>Scheduler priority: %1" msgstr "" -#: ProcessModel.cpp:1421 +#: ProcessModel.cpp:1431 #, kde-format msgid "<br/>Scheduler: %1" msgstr "<br/>शेड्यूलर: %1" -#: ProcessModel.cpp:1425 ProcessModel.cpp:1467 +#: ProcessModel.cpp:1435 ProcessModel.cpp:1477 #, kde-format msgid "<br/>I/O Nice level: %1 (%2)" msgstr "<br />आई/ओ नाइस स्तर: %1 (%2)" -#: ProcessModel.cpp:1426 ProcessModel.cpp:1468 +#: ProcessModel.cpp:1436 ProcessModel.cpp:1478 #, kde-format msgid "<br/>I/O Class: %1" msgstr "<br/>आई/ओ क्लास: %1" -#: ProcessModel.cpp:1434 +#: ProcessModel.cpp:1444 #, fuzzy, kde-format #| msgid "" #| "<qt>Process status: %1 %2<br />User CPU usage: %3%<br />System CPU usage: " @@ -806,7 +806,7 @@ "<qt>प्रक्रिया स्थिति: %1 %2<br />उपयोक्ता सीपीयू उपयोग: %3%<br />तंत्र सीपीयू उपयोग: " "%4%</qt>" -#: ProcessModel.cpp:1447 +#: ProcessModel.cpp:1457 #, kde-format msgid "" "<br />Number of children: %1<br />Total User CPU usage: %2%<br />Total " @@ -815,57 +815,57 @@ "<br />बच्चों की संख्या: %1<br />कुल उपयोक्ता सीपीयू उपयोग: %2%<br />कुल तंत्र सीपीयू " "उपयोग: %3%<br />कुल सीपीयू उपयोग: %4%" -#: ProcessModel.cpp:1456 +#: ProcessModel.cpp:1466 #, kde-format msgid "<br /><br />CPU time spent running as user: %1 seconds" msgstr "<br /><br />उपयोक्ता के रूप में चलाते हुए सीपीयू समय: %1 समय" -#: ProcessModel.cpp:1460 +#: ProcessModel.cpp:1470 #, kde-format msgid "<br />CPU time spent running in kernel: %1 seconds" msgstr "<br />कर्नेल में सीपीयू चलाते हुए समय: %1 सेकण्ड" -#: ProcessModel.cpp:1464 +#: ProcessModel.cpp:1474 #, kde-format msgid "<br />Nice level: %1 (%2)" msgstr "<br />नाइस स्तर: %1 (%2)" -#: ProcessModel.cpp:1483 +#: ProcessModel.cpp:1493 #, kde-format msgid "Memory usage: %1 out of %2 (%3 %)<br />" msgstr "मेमोरी उपयोग: %2 में से %1 (%3 %)<br />" -#: ProcessModel.cpp:1485 +#: ProcessModel.cpp:1495 #, kde-format msgid "Memory usage: %1<br />" msgstr "मेमोरी उपयोग: %1<br />" -#: ProcessModel.cpp:1488 +#: ProcessModel.cpp:1498 #, kde-format msgid "RSS Memory usage: %1 out of %2 (%3 %)" msgstr "आरएसएस मेमोरी उपयोग: %2 में से %1 (%3 %)" -#: ProcessModel.cpp:1490 +#: ProcessModel.cpp:1500 #, kde-format msgid "RSS Memory usage: %1" msgstr "आरएसएस मेमोरी उपयोग: %1" -#: ProcessModel.cpp:1496 +#: ProcessModel.cpp:1506 msgid "" "Your system does not seem to have this information available to be read." msgstr "प्रतीत होता है कि आपके तंत्र में इसे पढ़ने के लिए कोई जानकारी नहीं है" -#: ProcessModel.cpp:1500 +#: ProcessModel.cpp:1510 #, kde-format msgid "Shared library memory usage: %1 out of %2 (%3 %)" msgstr "साझा लाइब्रेरी मेमोरी उपयोग: %2 में से %1 (%3 %)" -#: ProcessModel.cpp:1502 +#: ProcessModel.cpp:1512 #, kde-format msgid "Shared library memory usage: %1" msgstr "साझा लाइब्रेरी मेमोरी उपयोग: %1" -#: ProcessModel.cpp:1510 +#: ProcessModel.cpp:1520 #, kde-format msgid "" "Characters read: %1 (%2 KiB/s)<br>Characters written: %3 (%4 KiB/s)<br>Read " @@ -873,38 +873,38 @@ "%9 (%10 KiB/s)<br>Actual bytes written: %11 (%12 KiB/s)" msgstr "" -#: ProcessModel.cpp:1802 +#: ProcessModel.cpp:1810 msgctxt "process heading" msgid "Name" msgstr "नाम" -#: ProcessModel.cpp:1803 +#: ProcessModel.cpp:1811 msgctxt "process heading" msgid "Username" msgstr "उपयोक्ता नाम" -#: ProcessModel.cpp:1804 +#: ProcessModel.cpp:1812 msgctxt "process heading" msgid "PID" msgstr "PID" -#: ProcessModel.cpp:1805 +#: ProcessModel.cpp:1813 msgctxt "process heading" msgid "TTY" msgstr "TTY" -#: ProcessModel.cpp:1806 +#: ProcessModel.cpp:1814 msgctxt "process heading" msgid "Niceness" msgstr "नाइसनेस" -#: ProcessModel.cpp:1808 +#: ProcessModel.cpp:1816 #, no-c-format msgctxt "process heading" msgid "CPU %" msgstr "सीपीयू %" -#: ProcessModel.cpp:1809 +#: ProcessModel.cpp:1817 #, fuzzy #| msgctxt "process heading" #| msgid "CPU %" @@ -912,37 +912,37 @@ msgid "CPU Time" msgstr "सीपीयू %" -#: ProcessModel.cpp:1810 +#: ProcessModel.cpp:1818 msgctxt "process heading" msgid "IO Read" msgstr "IO पढा" -#: ProcessModel.cpp:1811 +#: ProcessModel.cpp:1819 msgctxt "process heading" msgid "IO Write" msgstr "IO लिखा" -#: ProcessModel.cpp:1812 +#: ProcessModel.cpp:1820 msgctxt "process heading" msgid "Virtual Size" msgstr "आभासी आकार" -#: ProcessModel.cpp:1813 +#: ProcessModel.cpp:1821 msgctxt "process heading" msgid "Memory" msgstr "मेमोरी" -#: ProcessModel.cpp:1814 +#: ProcessModel.cpp:1822 msgctxt "process heading" msgid "Shared Mem" msgstr "साझा मेमोरी" -#: ProcessModel.cpp:1815 +#: ProcessModel.cpp:1823 msgctxt "process heading" msgid "Command" msgstr "कमांड" -#: ProcessModel.cpp:1817 +#: ProcessModel.cpp:1825 #, fuzzy #| msgctxt "process heading" #| msgid "Memory" @@ -950,12 +950,12 @@ msgid "X11 Memory" msgstr "मेमोरी" -#: ProcessModel.cpp:1818 +#: ProcessModel.cpp:1826 msgctxt "process heading" msgid "Window Title" msgstr "विंडो शीर्षक" -#: ProcessModel.cpp:1937 +#: ProcessModel.cpp:1945 #, kde-format msgid "%1%" msgstr "%1%" @@ -1073,13 +1073,13 @@ msgid "Programs Only" msgstr "सिर्फ प्रोग्राम" -#: ReniceDlg.cpp:40 +#: ReniceDlg.cpp:39 #, fuzzy #| msgid "Low Priority" msgid "Set Priority" msgstr "निम्न प्राथमिकता" -#: ReniceDlg.cpp:70 +#: ReniceDlg.cpp:69 msgctxt "Scheduler" msgid "Interactive" msgstr "" diff -Nru kde-l10n-hi-4.12.97/messages/kde-workspace/systemsettings.po kde-l10n-hi-4.13.0/messages/kde-workspace/systemsettings.po --- kde-l10n-hi-4.12.97/messages/kde-workspace/systemsettings.po 2014-03-20 03:51:10.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/kde-workspace/systemsettings.po 2013-11-20 06:15:16.000000000 +0000 @@ -8,7 +8,7 @@ msgstr "" "Project-Id-Version: systemsettings\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" -"POT-Creation-Date: 2014-03-20 01:50+0000\n" +"POT-Creation-Date: 2013-11-20 05:22+0000\n" "PO-Revision-Date: 2007-11-02 14:59+0530\n" "Last-Translator: G Karunakar <karunakar@indlinux.org>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -37,7 +37,7 @@ msgid "Show detailed tooltips" msgstr "" -#: app/main.cpp:36 app/SettingsBase.cpp:54 classic/CategoryList.cpp:38 +#: app/main.cpp:36 classic/CategoryList.cpp:38 msgid "System Settings" msgstr "तंत्र विन्यास" @@ -45,11 +45,11 @@ msgid "Central configuration center for KDE." msgstr "" -#: app/main.cpp:36 classic/ClassicMode.cpp:74 icons/IconMode.cpp:63 +#: app/main.cpp:36 classic/ClassicMode.cpp:70 icons/IconMode.cpp:64 msgid "(c) 2009, Ben Cooksley" msgstr "(c) 2009, बेन कूक्सले" -#: app/main.cpp:37 classic/ClassicMode.cpp:75 icons/IconMode.cpp:64 +#: app/main.cpp:37 classic/ClassicMode.cpp:71 icons/IconMode.cpp:65 msgid "Ben Cooksley" msgstr "बेन कूक्सले" @@ -57,11 +57,11 @@ msgid "Maintainer" msgstr "मेनटेनर" -#: app/main.cpp:38 classic/ClassicMode.cpp:76 icons/IconMode.cpp:65 +#: app/main.cpp:38 classic/ClassicMode.cpp:72 icons/IconMode.cpp:66 msgid "Mathias Soeken" msgstr "मथियस सोकेन" -#: app/main.cpp:38 classic/ClassicMode.cpp:76 icons/IconMode.cpp:65 +#: app/main.cpp:38 classic/ClassicMode.cpp:72 icons/IconMode.cpp:66 msgid "Developer" msgstr "डेवेलपर" @@ -73,49 +73,49 @@ msgid "Internal module representation, internal module model" msgstr "" -#: app/SettingsBase.cpp:61 +#: app/SettingsBase.cpp:58 msgctxt "Search through a list of control modules" msgid "Search" msgstr "ढूंढें:" -#: app/SettingsBase.cpp:133 +#: app/SettingsBase.cpp:130 msgid "Configure" msgstr "कॉन्फ़िगर" -#: app/SettingsBase.cpp:159 +#: app/SettingsBase.cpp:156 msgid "Help" msgstr "सहायता" -#: app/SettingsBase.cpp:164 app/SettingsBase.cpp:353 +#: app/SettingsBase.cpp:161 app/SettingsBase.cpp:350 msgid "About Active Module" msgstr "सक्रिय मॉड्यूल के बारे में" -#: app/SettingsBase.cpp:178 +#: app/SettingsBase.cpp:175 msgctxt "General config for System Settings" msgid "General" msgstr "साधारण" -#: app/SettingsBase.cpp:265 +#: app/SettingsBase.cpp:262 msgid "" "System Settings was unable to find any views, and hence nothing is available " "to configure." msgstr "" -#: app/SettingsBase.cpp:265 app/SettingsBase.cpp:303 +#: app/SettingsBase.cpp:262 app/SettingsBase.cpp:300 msgid "No views found" msgstr "कोई दृश्य नहीं मिले" -#: app/SettingsBase.cpp:303 +#: app/SettingsBase.cpp:300 msgid "" "System Settings was unable to find any views, and hence has nothing to " "display." msgstr "" -#: app/SettingsBase.cpp:335 +#: app/SettingsBase.cpp:332 msgid "About Active View" msgstr "सक्रिय दृश्य के बारे में" -#: app/SettingsBase.cpp:394 +#: app/SettingsBase.cpp:391 #, kde-format msgid "About %1" msgstr "%1 के बारे में" @@ -137,7 +137,7 @@ msgid "About System Settings" msgstr "तंत्र विन्यास" -#: app/ToolTips/tooltipmanager.cpp:224 +#: app/ToolTips/tooltipmanager.cpp:228 #, kde-format msgid "<i>Contains 1 item</i>" msgid_plural "<i>Contains %1 items</i>" @@ -156,15 +156,15 @@ "system." msgstr "" -#: classic/ClassicMode.cpp:70 classic/ClassicMode.cpp:246 +#: classic/ClassicMode.cpp:68 classic/ClassicMode.cpp:242 msgid "Tree View" msgstr "" -#: classic/ClassicMode.cpp:72 +#: classic/ClassicMode.cpp:69 msgid "Provides a classic tree-based view of control modules." msgstr "" -#: classic/ClassicMode.cpp:75 icons/IconMode.cpp:64 +#: classic/ClassicMode.cpp:71 icons/IconMode.cpp:65 msgid "Author" msgstr "लेखक" @@ -188,11 +188,11 @@ msgid "Dialog" msgstr "डायलॉग" -#: core/ModuleView.cpp:85 +#: core/ModuleView.cpp:83 msgid "Reset all current changes to previous values" msgstr "" -#: core/ModuleView.cpp:243 +#: core/ModuleView.cpp:238 #, fuzzy #| msgid "" #| "There are unsaved changes in the active module.\n" @@ -204,27 +204,27 @@ "सक्रिय मॉड्यूल में बिना सहेजे गए परिवर्तन हैं.\n" "क्या आप परिवर्तनों को लागू करना चाहते हैं या उन्हें त्यागें?" -#: core/ModuleView.cpp:245 +#: core/ModuleView.cpp:240 #, fuzzy #| msgid "System Settings" msgid "Apply Settings" msgstr "तंत्र विन्यास" -#: icons/IconMode.cpp:61 +#: icons/IconMode.cpp:62 msgid "Icon View" msgstr "प्रतीक दृश्य" -#: icons/IconMode.cpp:62 +#: icons/IconMode.cpp:63 msgid "Provides a categorized icons view of control modules." msgstr "" -#: icons/IconMode.cpp:69 +#: icons/IconMode.cpp:70 #, fuzzy #| msgid "Overview" msgid "Overview" msgstr "ओवरव्यू" -#: icons/IconMode.cpp:70 +#: icons/IconMode.cpp:71 #, kde-format msgid "Keyboard Shortcut: %1" msgstr "कुंजीपट शार्टकट: %1" diff -Nru kde-l10n-hi-4.12.97/messages/qt/kdeqt.po kde-l10n-hi-4.13.0/messages/qt/kdeqt.po --- kde-l10n-hi-4.12.97/messages/qt/kdeqt.po 2014-03-20 03:51:10.000000000 +0000 +++ kde-l10n-hi-4.13.0/messages/qt/kdeqt.po 2014-04-08 10:13:54.000000000 +0000 @@ -7,7 +7,7 @@ msgstr "" "Project-Id-Version: kdeqt\n" "Report-Msgid-Bugs-To: qt-bugs@trolltech.com\n" -"POT-Creation-Date: 2014-03-20 01:58+0000\n" +"POT-Creation-Date: 2014-04-08 08:27+0000\n" "PO-Revision-Date: 2008-02-11 19:04+0530\n" "Last-Translator: Ravishankar Shrivastava <raviratlami@yahoo.com>\n" "Language-Team: Hindi <indlinux-hindi@lists.sourceforge.net>\n" @@ -5935,14 +5935,14 @@ msgid "Unable to begin transaction" msgstr "ट्रांजेक्शन शुरू करने में अक्षम" -#: sql/drivers/sqlite/qsql_sqlite.cpp:625 sql/drivers/odbc/qsql_odbc.cpp:2198 +#: sql/drivers/sqlite/qsql_sqlite.cpp:625 sql/drivers/odbc/qsql_odbc.cpp:2193 #: sql/drivers/sqlite2/qsql_sqlite2.cpp:457 #: sql/drivers/symsql/qsql_symsql.cpp:1056 #: sql/drivers/mysql/qsql_mysql.cpp:1474 sql/drivers/db2/qsql_db2.cpp:1551 msgid "Unable to commit transaction" msgstr "ट्रांजेक्शन कमिट करने में अक्षम" -#: sql/drivers/sqlite/qsql_sqlite.cpp:640 sql/drivers/odbc/qsql_odbc.cpp:2215 +#: sql/drivers/sqlite/qsql_sqlite.cpp:640 sql/drivers/odbc/qsql_odbc.cpp:2210 #: sql/drivers/sqlite2/qsql_sqlite2.cpp:474 #: sql/drivers/symsql/qsql_symsql.cpp:1071 #: sql/drivers/mysql/qsql_mysql.cpp:1491 sql/drivers/db2/qsql_db2.cpp:1568 @@ -5972,7 +5972,7 @@ msgid "Unable to prepare statement" msgstr "कथन तैयार करने में अक्षम" -#: sql/drivers/psql/qsql_psql.cpp:866 sql/drivers/odbc/qsql_odbc.cpp:1888 +#: sql/drivers/psql/qsql_psql.cpp:866 sql/drivers/odbc/qsql_odbc.cpp:1883 #: sql/drivers/mysql/qsql_mysql.cpp:1303 sql/drivers/db2/qsql_db2.cpp:1253 msgid "Unable to connect" msgstr "जुड़ने में अक्षम" @@ -6008,7 +6008,7 @@ "क्यूओडीबीसी-परिणाम::रीसेट: 'SQL_CURSOR_STATIC' को स्टेटमेंट गुण के रूप में सेट करने में " "अक्षम. कृपया अपना ओडीबीसी ड्राइवर कॉन्फ़िगुरेशन जाँचें" -#: sql/drivers/odbc/qsql_odbc.cpp:965 sql/drivers/odbc/qsql_odbc.cpp:1598 +#: sql/drivers/odbc/qsql_odbc.cpp:965 sql/drivers/odbc/qsql_odbc.cpp:1593 msgctxt "QODBCResult" msgid "Unable to execute statement" msgstr "कथन चलाने में अक्षम" @@ -6036,7 +6036,7 @@ msgid "Unable to fetch previous" msgstr "परिणामों को लाने में अक्षम" -#: sql/drivers/odbc/qsql_odbc.cpp:1113 sql/drivers/odbc/qsql_odbc.cpp:1702 +#: sql/drivers/odbc/qsql_odbc.cpp:1113 sql/drivers/odbc/qsql_odbc.cpp:1697 #: sql/drivers/db2/qsql_db2.cpp:1102 #, fuzzy msgctxt "QODBCResult" @@ -6048,22 +6048,22 @@ msgid "Unable to prepare statement" msgstr "कथन तैयार करने में अक्षम" -#: sql/drivers/odbc/qsql_odbc.cpp:1590 +#: sql/drivers/odbc/qsql_odbc.cpp:1585 msgctxt "QODBCResult" msgid "Unable to bind variable" msgstr "वेरिएबल बाइंड करने में अक्षम" -#: sql/drivers/odbc/qsql_odbc.cpp:1894 +#: sql/drivers/odbc/qsql_odbc.cpp:1889 #, fuzzy #| msgid "Unable to connect - Driver doesn't support all needed functionality" msgid "Unable to connect - Driver doesn't support all functionality required" msgstr "कनेक्ट होने में अक्षम- ड्राइवर सभी समर्थित फंक्शनलिटी को समर्थित नहीं करता है" -#: sql/drivers/odbc/qsql_odbc.cpp:2181 +#: sql/drivers/odbc/qsql_odbc.cpp:2176 msgid "Unable to disable autocommit" msgstr "ऑटोकमिट करने में अक्षम" -#: sql/drivers/odbc/qsql_odbc.cpp:2230 +#: sql/drivers/odbc/qsql_odbc.cpp:2225 msgid "Unable to enable autocommit" msgstr "ऑटोकमिट सक्षम करने में अक्षम" @@ -8056,7 +8056,7 @@ "terms of the GNU GPL version 3.0 or where you are otherwise willing to " "comply with the terms of the GNU GPL version 3.0.</p><p>Please see <a href=" "\"http://qt.digia.com/product/licensing\">qt.digia.com/product/licensing</a> " -"for an overview of Qt licensing.</p><p>Copyright (C) 2013 Digia Plc and/or " +"for an overview of Qt licensing.</p><p>Copyright (C) 2014 Digia Plc and/or " "its subsidiary(-ies).</p><p>Qt is a Digia product. See <a href=\"http://qt." "digia.com/\">qt.digia.com</a> for more information.</p>" msgstr ""