https://launchpad.net/ubuntu/+source/fasta3/36.3.8h.2020-02-11-4/+build/22293618 RUN: /usr/share/launchpad-buildd/bin/builder-prep Kernel version: Linux lcy01-amd64-019 4.15.0-159-generic #167-Ubuntu SMP Tue Sep 21 08:55:05 UTC 2021 x86_64 Buildd toolchain package versions: launchpad-buildd_203~505~ubuntu18.04.1 python3-lpbuildd_203~505~ubuntu18.04.1 sbuild_0.75.0-1ubuntu1 bzr-builder_0.7.3+bzr174~ppa13~ubuntu16.04.1 bzr_2.7.0+bzr6622-10 git-build-recipe_0.3.6~git201906051340.ff11471~ubuntu18.04.1 git_1:2.17.1-1ubuntu0.9 dpkg-dev_1.19.0.5ubuntu2.3 python-debian_0.1.32 python3-debian_0.1.32. Syncing the system clock with the buildd NTP service... 19 Oct 19:07:38 ntpdate[1761]: adjust time server 10.211.37.1 offset 0.007947 sec RUN: /usr/share/launchpad-buildd/bin/in-target unpack-chroot --backend=chroot --series=jammy --arch=amd64 PACKAGEBUILD-22293618 --image-type chroot /home/buildd/filecache-default/cfae87993459679a6aa555d9d98919b1d8858654 Creating target for build PACKAGEBUILD-22293618 RUN: /usr/share/launchpad-buildd/bin/in-target mount-chroot --backend=chroot --series=jammy --arch=amd64 PACKAGEBUILD-22293618 Starting target for build PACKAGEBUILD-22293618 RUN: /usr/share/launchpad-buildd/bin/in-target override-sources-list --backend=chroot --series=jammy --arch=amd64 PACKAGEBUILD-22293618 'deb http://ftpmaster.internal/ubuntu jammy main restricted universe multiverse' 'deb http://ftpmaster.internal/ubuntu jammy-security main restricted universe multiverse' 'deb http://ftpmaster.internal/ubuntu jammy-updates main restricted universe multiverse' 'deb http://ftpmaster.internal/ubuntu jammy-proposed main restricted universe multiverse' Overriding sources.list in build-PACKAGEBUILD-22293618 RUN: /usr/share/launchpad-buildd/bin/in-target update-debian-chroot --backend=chroot --series=jammy --arch=amd64 PACKAGEBUILD-22293618 Updating target for build PACKAGEBUILD-22293618 Get:1 http://ftpmaster.internal/ubuntu jammy InRelease [224 kB] Get:2 http://ftpmaster.internal/ubuntu jammy-security InRelease [74.9 kB] Get:3 http://ftpmaster.internal/ubuntu jammy-updates InRelease [74.9 kB] Get:4 http://ftpmaster.internal/ubuntu jammy-proposed InRelease [74.9 kB] Get:5 http://ftpmaster.internal/ubuntu jammy/main amd64 Packages [1400 kB] Get:6 http://ftpmaster.internal/ubuntu jammy/main Translation-en [512 kB] Get:7 http://ftpmaster.internal/ubuntu jammy/restricted amd64 Packages [90.3 kB] Get:8 http://ftpmaster.internal/ubuntu jammy/restricted Translation-en [13.0 kB] Get:9 http://ftpmaster.internal/ubuntu jammy/universe amd64 Packages [13.1 MB] Get:10 http://ftpmaster.internal/ubuntu jammy/universe Translation-en [5463 kB] Get:11 http://ftpmaster.internal/ubuntu jammy/multiverse amd64 Packages [209 kB] Get:12 http://ftpmaster.internal/ubuntu jammy/multiverse Translation-en [108 kB] Get:13 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 Packages [255 kB] Get:14 http://ftpmaster.internal/ubuntu jammy-proposed/main Translation-en [99.8 kB] Get:15 http://ftpmaster.internal/ubuntu jammy-proposed/restricted amd64 Packages [7332 B] Get:16 http://ftpmaster.internal/ubuntu jammy-proposed/restricted Translation-en [2172 B] Get:17 http://ftpmaster.internal/ubuntu jammy-proposed/universe amd64 Packages [2113 kB] Get:18 http://ftpmaster.internal/ubuntu jammy-proposed/universe Translation-en [1038 kB] Get:19 http://ftpmaster.internal/ubuntu jammy-proposed/multiverse amd64 Packages [7160 B] Get:20 http://ftpmaster.internal/ubuntu jammy-proposed/multiverse Translation-en [6000 B] Fetched 24.9 MB in 11s (2198 kB/s) Reading package lists... Reading package lists... Building dependency tree... Reading state information... Calculating upgrade... The following packages will be upgraded: apt base-files base-passwd bsdutils bzip2 ca-certificates coreutils debianutils fakeroot gzip libapparmor1 libapt-pkg6.0 libargon2-1 libattr1 libaudit-common libaudit1 libblkid1 libbz2-1.0 libcap-ng0 libcap2 libcrypt-dev libcrypt1 libdb5.3 libdebconfclient0 libfakeroot libgdbm-compat4 libgdbm6 libgmp10 libgpg-error0 libgssapi-krb5-2 libhogweed6 libidn2-0 libip4tc2 libisl23 libjson-c5 libk5crypto3 libkeyutils1 libkrb5-3 libkrb5support0 liblz4-1 liblzma5 libmount1 libmpc3 libmpfr6 libncurses6 libncursesw6 libnettle8 libnpth0 libp11-kit0 libpcre3 libreadline8 libseccomp2 libselinux1 libsemanage-common libsemanage1 libsmartcols1 libsqlite3-0 libtasn1-6 libtinfo6 libuuid1 libzstd1 lockfile-progs make mawk mount ncurses-base ncurses-bin optipng patch pinentry-curses readline-common sed sensible-utils sysvinit-utils tar util-linux xz-utils 77 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. Need to get 14.4 MB of archives. After this operation, 1190 kB disk space will be freed. Get:1 http://ftpmaster.internal/ubuntu jammy/main amd64 libcrypt-dev amd64 1:4.4.18-4ubuntu2 [111 kB] Get:2 http://ftpmaster.internal/ubuntu jammy/main amd64 libcrypt1 amd64 1:4.4.18-4ubuntu2 [82.0 kB] Get:3 http://ftpmaster.internal/ubuntu jammy/main amd64 base-files amd64 12ubuntu1 [63.3 kB] Get:4 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 bsdutils amd64 1:2.36.1-8ubuntu2 [82.8 kB] Get:5 http://ftpmaster.internal/ubuntu jammy/main amd64 coreutils amd64 8.32-4ubuntu3 [1436 kB] Get:6 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 debianutils amd64 5.5-1 [77.5 kB] Get:7 http://ftpmaster.internal/ubuntu jammy/main amd64 gzip amd64 1.10-4ubuntu2 [95.6 kB] Get:8 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libncurses6 amd64 6.2+20210905-1 [110 kB] Get:9 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libncursesw6 amd64 6.2+20210905-1 [147 kB] Get:10 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libtinfo6 amd64 6.2+20210905-1 [104 kB] Get:11 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 ncurses-bin amd64 6.2+20210905-1 [181 kB] Get:12 http://ftpmaster.internal/ubuntu jammy/main amd64 sed amd64 4.7-1ubuntu2 [187 kB] Get:13 http://ftpmaster.internal/ubuntu jammy/main amd64 tar amd64 1.34+dfsg-1build2 [295 kB] Get:14 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 util-linux amd64 2.36.1-8ubuntu2 [1014 kB] Get:15 http://ftpmaster.internal/ubuntu jammy/main amd64 libdebconfclient0 amd64 0.256ubuntu4 [6306 B] Get:16 http://ftpmaster.internal/ubuntu jammy/main amd64 base-passwd amd64 3.5.52 [49.0 kB] Get:17 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 ncurses-base all 6.2+20210905-1 [19.9 kB] Get:18 http://ftpmaster.internal/ubuntu jammy/main amd64 sysvinit-utils amd64 2.96-7ubuntu2 [20.8 kB] Get:19 http://ftpmaster.internal/ubuntu jammy/main amd64 bzip2 amd64 1.0.8-4ubuntu4 [34.8 kB] Get:20 http://ftpmaster.internal/ubuntu jammy/main amd64 libbz2-1.0 amd64 1.0.8-4ubuntu4 [34.1 kB] Get:21 http://ftpmaster.internal/ubuntu jammy/main amd64 liblz4-1 amd64 1.9.3-2build1 [57.1 kB] Get:22 http://ftpmaster.internal/ubuntu jammy/main amd64 liblzma5 amd64 5.2.5-2build1 [99.8 kB] Get:23 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libzstd1 amd64 1.4.8+dfsg-3 [324 kB] Get:24 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libapt-pkg6.0 amd64 2.3.10 [903 kB] Get:25 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libseccomp2 amd64 2.5.1-1ubuntu2 [48.2 kB] Get:26 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 apt amd64 2.3.10 [1389 kB] Get:27 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 mount amd64 2.36.1-8ubuntu2 [110 kB] Get:28 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libattr1 amd64 1:2.5.1-1 [13.3 kB] Get:29 http://ftpmaster.internal/ubuntu jammy/main amd64 libaudit-common all 1:3.0-2ubuntu3 [4688 B] Get:30 http://ftpmaster.internal/ubuntu jammy/main amd64 libcap-ng0 amd64 0.7.9-2.2build2 [11.6 kB] Get:31 http://ftpmaster.internal/ubuntu jammy/main amd64 libaudit1 amd64 1:3.0-2ubuntu3 [45.9 kB] Get:32 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libblkid1 amd64 2.36.1-8ubuntu2 [98.2 kB] Get:33 http://ftpmaster.internal/ubuntu jammy/main amd64 libcap2 amd64 1:2.44-1build2 [18.1 kB] Get:34 http://ftpmaster.internal/ubuntu jammy/main amd64 libdb5.3 amd64 5.3.28+dfsg1-0.8ubuntu2 [721 kB] Get:35 http://ftpmaster.internal/ubuntu jammy/main amd64 libgmp10 amd64 2:6.2.1+dfsg-1ubuntu3 [253 kB] Get:36 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libgpg-error0 amd64 1.42-3 [68.1 kB] Get:37 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libk5crypto3 amd64 1.18.3-7 [86.2 kB] Get:38 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libkrb5support0 amd64 1.18.3-7 [32.2 kB] Get:39 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libkrb5-3 amd64 1.18.3-7 [355 kB] Get:40 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libgssapi-krb5-2 amd64 1.18.3-7 [143 kB] Get:41 http://ftpmaster.internal/ubuntu jammy/main amd64 libkeyutils1 amd64 1.6.1-2ubuntu2 [10.3 kB] Get:42 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libselinux1 amd64 3.1-3build3 [74.2 kB] Get:43 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libmount1 amd64 2.36.1-8ubuntu2 [116 kB] Get:44 http://ftpmaster.internal/ubuntu jammy/main amd64 libpcre3 amd64 2:8.39-13build4 [245 kB] Get:45 http://ftpmaster.internal/ubuntu jammy/main amd64 libsemanage-common all 3.1-1ubuntu3 [9606 B] Get:46 http://ftpmaster.internal/ubuntu jammy/main amd64 libsemanage1 amd64 3.1-1ubuntu3 [96.5 kB] Get:47 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libsmartcols1 amd64 2.36.1-8ubuntu2 [49.6 kB] Get:48 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libuuid1 amd64 2.36.1-8ubuntu2 [23.3 kB] Get:49 http://ftpmaster.internal/ubuntu jammy/main amd64 libnettle8 amd64 3.7.3-1build1 [159 kB] Get:50 http://ftpmaster.internal/ubuntu jammy/main amd64 libhogweed6 amd64 3.7.3-1build1 [199 kB] Get:51 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libidn2-0 amd64 2.3.2-2 [66.5 kB] Get:52 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libp11-kit0 amd64 0.24.0-5 [252 kB] Get:53 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libtasn1-6 amd64 4.17.0-2 [43.2 kB] Get:54 http://ftpmaster.internal/ubuntu jammy/main amd64 mawk amd64 1.3.4.20200120-2build1 [103 kB] Get:55 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 sensible-utils all 0.0.17 [20.1 kB] Get:56 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 ca-certificates all 20211016 [148 kB] Get:57 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libapparmor1 amd64 3.0.3-0ubuntu2 [37.8 kB] Get:58 http://ftpmaster.internal/ubuntu jammy/main amd64 libargon2-1 amd64 0~20171227-0.2build22 [19.4 kB] Get:59 http://ftpmaster.internal/ubuntu jammy/main amd64 libip4tc2 amd64 1.8.7-1ubuntu3 [19.7 kB] Get:60 http://ftpmaster.internal/ubuntu jammy/main amd64 libjson-c5 amd64 0.15-2build3 [33.3 kB] Get:61 http://ftpmaster.internal/ubuntu jammy/main amd64 readline-common all 8.1-2build1 [53.6 kB] Get:62 http://ftpmaster.internal/ubuntu jammy/main amd64 libreadline8 amd64 8.1-2build1 [153 kB] Get:63 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libsqlite3-0 amd64 3.36.0-2 [641 kB] Get:64 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libgdbm6 amd64 1.21-1 [35.1 kB] Get:65 http://ftpmaster.internal/ubuntu jammy/main amd64 xz-utils amd64 5.2.5-2build1 [84.7 kB] Get:66 http://ftpmaster.internal/ubuntu jammy/main amd64 libfakeroot amd64 1.25.3-1.1ubuntu3 [31.7 kB] Get:67 http://ftpmaster.internal/ubuntu jammy/main amd64 fakeroot amd64 1.25.3-1.1ubuntu3 [60.3 kB] Get:68 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libgdbm-compat4 amd64 1.21-1 [6500 B] Get:69 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libisl23 amd64 0.24-2 [728 kB] Get:70 http://ftpmaster.internal/ubuntu jammy/main amd64 libmpfr6 amd64 4.1.0-3build2 [1425 kB] Get:71 http://ftpmaster.internal/ubuntu jammy/main amd64 libnpth0 amd64 1.6-3build1 [8686 B] Get:72 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 lockfile-progs amd64 0.1.19 [10.0 kB] Get:73 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 make amd64 4.3-4ubuntu2 [179 kB] Get:74 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 optipng amd64 0.7.7-2 [84.7 kB] Get:75 http://ftpmaster.internal/ubuntu jammy/main amd64 patch amd64 2.7.6-7build1 [109 kB] Get:76 http://ftpmaster.internal/ubuntu jammy/main amd64 pinentry-curses amd64 1.1.1-1build1 [34.3 kB] Get:77 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libmpc3 amd64 1.2.1-1 [46.9 kB] debconf: delaying package configuration, since apt-utils is not installed Fetched 14.4 MB in 0s (45.8 MB/s) (Reading database ... 13258 files and directories currently installed.) Preparing to unpack .../libcrypt-dev_1%3a4.4.18-4ubuntu2_amd64.deb ... Unpacking libcrypt-dev:amd64 (1:4.4.18-4ubuntu2) over (1:4.4.18-4ubuntu1) ... Preparing to unpack .../libcrypt1_1%3a4.4.18-4ubuntu2_amd64.deb ... Unpacking libcrypt1:amd64 (1:4.4.18-4ubuntu2) over (1:4.4.18-4ubuntu1) ... Setting up libcrypt1:amd64 (1:4.4.18-4ubuntu2) ... (Reading database ... 13258 files and directories currently installed.) Preparing to unpack .../base-files_12ubuntu1_amd64.deb ... Unpacking base-files (12ubuntu1) over (11.1ubuntu5) ... Setting up base-files (12ubuntu1) ... Installing new version of config file /etc/debian_version ... Installing new version of config file /etc/issue ... Installing new version of config file /etc/issue.net ... Installing new version of config file /etc/lsb-release ... (Reading database ... 13258 files and directories currently installed.) Preparing to unpack .../bsdutils_1%3a2.36.1-8ubuntu2_amd64.deb ... Unpacking bsdutils (1:2.36.1-8ubuntu2) over (1:2.36.1-8ubuntu1) ... Setting up bsdutils (1:2.36.1-8ubuntu2) ... (Reading database ... 13258 files and directories currently installed.) Preparing to unpack .../coreutils_8.32-4ubuntu3_amd64.deb ... Unpacking coreutils (8.32-4ubuntu3) over (8.32-4ubuntu2) ... Setting up coreutils (8.32-4ubuntu3) ... (Reading database ... 13258 files and directories currently installed.) Preparing to unpack .../debianutils_5.5-1_amd64.deb ... Unpacking debianutils (5.5-1) over (4.11.2) ... Setting up debianutils (5.5-1) ... update-alternatives: using /usr/bin/which.debianutils to provide /usr/bin/which (which) in auto mode (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../gzip_1.10-4ubuntu2_amd64.deb ... Unpacking gzip (1.10-4ubuntu2) over (1.10-4ubuntu1) ... Setting up gzip (1.10-4ubuntu2) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libncurses6_6.2+20210905-1_amd64.deb ... Unpacking libncurses6:amd64 (6.2+20210905-1) over (6.2+20201114-2build1) ... Preparing to unpack .../libncursesw6_6.2+20210905-1_amd64.deb ... Unpacking libncursesw6:amd64 (6.2+20210905-1) over (6.2+20201114-2build1) ... Preparing to unpack .../libtinfo6_6.2+20210905-1_amd64.deb ... Unpacking libtinfo6:amd64 (6.2+20210905-1) over (6.2+20201114-2build1) ... Setting up libtinfo6:amd64 (6.2+20210905-1) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../ncurses-bin_6.2+20210905-1_amd64.deb ... Unpacking ncurses-bin (6.2+20210905-1) over (6.2+20201114-2build1) ... Setting up ncurses-bin (6.2+20210905-1) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../sed_4.7-1ubuntu2_amd64.deb ... Unpacking sed (4.7-1ubuntu2) over (4.7-1ubuntu1) ... Setting up sed (4.7-1ubuntu2) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../tar_1.34+dfsg-1build2_amd64.deb ... Unpacking tar (1.34+dfsg-1build2) over (1.34+dfsg-1build1) ... Setting up tar (1.34+dfsg-1build2) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../util-linux_2.36.1-8ubuntu2_amd64.deb ... Unpacking util-linux (2.36.1-8ubuntu2) over (2.36.1-8ubuntu1) ... Setting up util-linux (2.36.1-8ubuntu2) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libdebconfclient0_0.256ubuntu4_amd64.deb ... Unpacking libdebconfclient0:amd64 (0.256ubuntu4) over (0.256ubuntu3) ... Setting up libdebconfclient0:amd64 (0.256ubuntu4) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../base-passwd_3.5.52_amd64.deb ... Unpacking base-passwd (3.5.52) over (3.5.51) ... Setting up base-passwd (3.5.52) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../ncurses-base_6.2+20210905-1_all.deb ... Unpacking ncurses-base (6.2+20210905-1) over (6.2+20201114-2build1) ... Setting up ncurses-base (6.2+20210905-1) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../sysvinit-utils_2.96-7ubuntu2_amd64.deb ... Unpacking sysvinit-utils (2.96-7ubuntu2) over (2.96-7ubuntu1) ... Setting up sysvinit-utils (2.96-7ubuntu2) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../bzip2_1.0.8-4ubuntu4_amd64.deb ... Unpacking bzip2 (1.0.8-4ubuntu4) over (1.0.8-4ubuntu3) ... Preparing to unpack .../libbz2-1.0_1.0.8-4ubuntu4_amd64.deb ... Unpacking libbz2-1.0:amd64 (1.0.8-4ubuntu4) over (1.0.8-4ubuntu3) ... Setting up libbz2-1.0:amd64 (1.0.8-4ubuntu4) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../liblz4-1_1.9.3-2build1_amd64.deb ... Unpacking liblz4-1:amd64 (1.9.3-2build1) over (1.9.3-2) ... Setting up liblz4-1:amd64 (1.9.3-2build1) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../liblzma5_5.2.5-2build1_amd64.deb ... Unpacking liblzma5:amd64 (5.2.5-2build1) over (5.2.5-2) ... Setting up liblzma5:amd64 (5.2.5-2build1) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libzstd1_1.4.8+dfsg-3_amd64.deb ... Unpacking libzstd1:amd64 (1.4.8+dfsg-3) over (1.4.8+dfsg-2.1) ... Setting up libzstd1:amd64 (1.4.8+dfsg-3) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libapt-pkg6.0_2.3.10_amd64.deb ... Unpacking libapt-pkg6.0:amd64 (2.3.10) over (2.3.9) ... Setting up libapt-pkg6.0:amd64 (2.3.10) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libseccomp2_2.5.1-1ubuntu2_amd64.deb ... Unpacking libseccomp2:amd64 (2.5.1-1ubuntu2) over (2.5.1-1ubuntu1) ... Setting up libseccomp2:amd64 (2.5.1-1ubuntu2) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../archives/apt_2.3.10_amd64.deb ... Unpacking apt (2.3.10) over (2.3.9) ... Setting up apt (2.3.10) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../mount_2.36.1-8ubuntu2_amd64.deb ... Unpacking mount (2.36.1-8ubuntu2) over (2.36.1-8ubuntu1) ... Preparing to unpack .../libattr1_1%3a2.5.1-1_amd64.deb ... Unpacking libattr1:amd64 (1:2.5.1-1) over (1:2.4.48-6build2) ... Setting up libattr1:amd64 (1:2.5.1-1) ... Installing new version of config file /etc/xattr.conf ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libaudit-common_1%3a3.0-2ubuntu3_all.deb ... Unpacking libaudit-common (1:3.0-2ubuntu3) over (1:3.0-2ubuntu2) ... Setting up libaudit-common (1:3.0-2ubuntu3) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libcap-ng0_0.7.9-2.2build2_amd64.deb ... Unpacking libcap-ng0:amd64 (0.7.9-2.2build2) over (0.7.9-2.2build1) ... Setting up libcap-ng0:amd64 (0.7.9-2.2build2) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libaudit1_1%3a3.0-2ubuntu3_amd64.deb ... Unpacking libaudit1:amd64 (1:3.0-2ubuntu3) over (1:3.0-2ubuntu2) ... Setting up libaudit1:amd64 (1:3.0-2ubuntu3) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libblkid1_2.36.1-8ubuntu2_amd64.deb ... Unpacking libblkid1:amd64 (2.36.1-8ubuntu2) over (2.36.1-8ubuntu1) ... Setting up libblkid1:amd64 (2.36.1-8ubuntu2) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libcap2_1%3a2.44-1build2_amd64.deb ... Unpacking libcap2:amd64 (1:2.44-1build2) over (1:2.44-1build1) ... Setting up libcap2:amd64 (1:2.44-1build2) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libdb5.3_5.3.28+dfsg1-0.8ubuntu2_amd64.deb ... Unpacking libdb5.3:amd64 (5.3.28+dfsg1-0.8ubuntu2) over (5.3.28+dfsg1-0.8ubuntu1) ... Setting up libdb5.3:amd64 (5.3.28+dfsg1-0.8ubuntu2) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libgmp10_2%3a6.2.1+dfsg-1ubuntu3_amd64.deb ... Unpacking libgmp10:amd64 (2:6.2.1+dfsg-1ubuntu3) over (2:6.2.1+dfsg-1ubuntu2) ... Setting up libgmp10:amd64 (2:6.2.1+dfsg-1ubuntu3) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libgpg-error0_1.42-3_amd64.deb ... Unpacking libgpg-error0:amd64 (1.42-3) over (1.38-2build1) ... Setting up libgpg-error0:amd64 (1.42-3) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libk5crypto3_1.18.3-7_amd64.deb ... Unpacking libk5crypto3:amd64 (1.18.3-7) over (1.18.3-6) ... Setting up libk5crypto3:amd64 (1.18.3-7) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libkrb5support0_1.18.3-7_amd64.deb ... Unpacking libkrb5support0:amd64 (1.18.3-7) over (1.18.3-6) ... Setting up libkrb5support0:amd64 (1.18.3-7) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libkrb5-3_1.18.3-7_amd64.deb ... Unpacking libkrb5-3:amd64 (1.18.3-7) over (1.18.3-6) ... Setting up libkrb5-3:amd64 (1.18.3-7) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libgssapi-krb5-2_1.18.3-7_amd64.deb ... Unpacking libgssapi-krb5-2:amd64 (1.18.3-7) over (1.18.3-6) ... Setting up libgssapi-krb5-2:amd64 (1.18.3-7) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libkeyutils1_1.6.1-2ubuntu2_amd64.deb ... Unpacking libkeyutils1:amd64 (1.6.1-2ubuntu2) over (1.6.1-2ubuntu1) ... Setting up libkeyutils1:amd64 (1.6.1-2ubuntu2) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libselinux1_3.1-3build3_amd64.deb ... Unpacking libselinux1:amd64 (3.1-3build3) over (3.1-3build2) ... Setting up libselinux1:amd64 (3.1-3build3) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libmount1_2.36.1-8ubuntu2_amd64.deb ... Unpacking libmount1:amd64 (2.36.1-8ubuntu2) over (2.36.1-8ubuntu1) ... Setting up libmount1:amd64 (2.36.1-8ubuntu2) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libpcre3_2%3a8.39-13build4_amd64.deb ... Unpacking libpcre3:amd64 (2:8.39-13build4) over (2:8.39-13build3) ... Setting up libpcre3:amd64 (2:8.39-13build4) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libsemanage-common_3.1-1ubuntu3_all.deb ... Unpacking libsemanage-common (3.1-1ubuntu3) over (3.1-1ubuntu2) ... Setting up libsemanage-common (3.1-1ubuntu3) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libsemanage1_3.1-1ubuntu3_amd64.deb ... Unpacking libsemanage1:amd64 (3.1-1ubuntu3) over (3.1-1ubuntu2) ... Setting up libsemanage1:amd64 (3.1-1ubuntu3) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libsmartcols1_2.36.1-8ubuntu2_amd64.deb ... Unpacking libsmartcols1:amd64 (2.36.1-8ubuntu2) over (2.36.1-8ubuntu1) ... Setting up libsmartcols1:amd64 (2.36.1-8ubuntu2) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libuuid1_2.36.1-8ubuntu2_amd64.deb ... Unpacking libuuid1:amd64 (2.36.1-8ubuntu2) over (2.36.1-8ubuntu1) ... Setting up libuuid1:amd64 (2.36.1-8ubuntu2) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libnettle8_3.7.3-1build1_amd64.deb ... Unpacking libnettle8:amd64 (3.7.3-1build1) over (3.7.3-1) ... Setting up libnettle8:amd64 (3.7.3-1build1) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libhogweed6_3.7.3-1build1_amd64.deb ... Unpacking libhogweed6:amd64 (3.7.3-1build1) over (3.7.3-1) ... Setting up libhogweed6:amd64 (3.7.3-1build1) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libidn2-0_2.3.2-2_amd64.deb ... Unpacking libidn2-0:amd64 (2.3.2-2) over (2.3.1-1) ... Setting up libidn2-0:amd64 (2.3.2-2) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libp11-kit0_0.24.0-5_amd64.deb ... Unpacking libp11-kit0:amd64 (0.24.0-5) over (0.23.22-1build1) ... Setting up libp11-kit0:amd64 (0.24.0-5) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../libtasn1-6_4.17.0-2_amd64.deb ... Unpacking libtasn1-6:amd64 (4.17.0-2) over (4.16.0-2) ... Setting up libtasn1-6:amd64 (4.17.0-2) ... (Reading database ... 13253 files and directories currently installed.) Preparing to unpack .../00-mawk_1.3.4.20200120-2build1_amd64.deb ... Unpacking mawk (1.3.4.20200120-2build1) over (1.3.4.20200120-2) ... Preparing to unpack .../01-sensible-utils_0.0.17_all.deb ... Unpacking sensible-utils (0.0.17) over (0.0.14) ... Preparing to unpack .../02-ca-certificates_20211016_all.deb ... Unpacking ca-certificates (20211016) over (20210119ubuntu1) ... Preparing to unpack .../03-libapparmor1_3.0.3-0ubuntu2_amd64.deb ... Unpacking libapparmor1:amd64 (3.0.3-0ubuntu2) over (3.0.3-0ubuntu1) ... Preparing to unpack .../04-libargon2-1_0~20171227-0.2build22_amd64.deb ... Unpacking libargon2-1:amd64 (0~20171227-0.2build22) over (0~20171227-0.2build21.04.0) ... Preparing to unpack .../05-libip4tc2_1.8.7-1ubuntu3_amd64.deb ... Unpacking libip4tc2:amd64 (1.8.7-1ubuntu3) over (1.8.7-1ubuntu2) ... Preparing to unpack .../06-libjson-c5_0.15-2build3_amd64.deb ... Unpacking libjson-c5:amd64 (0.15-2build3) over (0.15-2build2) ... Preparing to unpack .../07-readline-common_8.1-2build1_all.deb ... Unpacking readline-common (8.1-2build1) over (8.1-2) ... Preparing to unpack .../08-libreadline8_8.1-2build1_amd64.deb ... Unpacking libreadline8:amd64 (8.1-2build1) over (8.1-2) ... Preparing to unpack .../09-libsqlite3-0_3.36.0-2_amd64.deb ... Unpacking libsqlite3-0:amd64 (3.36.0-2) over (3.35.5-1) ... Preparing to unpack .../10-libgdbm6_1.21-1_amd64.deb ... Unpacking libgdbm6:amd64 (1.21-1) over (1.19-2) ... Preparing to unpack .../11-xz-utils_5.2.5-2build1_amd64.deb ... Unpacking xz-utils (5.2.5-2build1) over (5.2.5-2) ... Preparing to unpack .../12-libfakeroot_1.25.3-1.1ubuntu3_amd64.deb ... Unpacking libfakeroot:amd64 (1.25.3-1.1ubuntu3) over (1.25.3-1.1ubuntu2) ... Preparing to unpack .../13-fakeroot_1.25.3-1.1ubuntu3_amd64.deb ... Unpacking fakeroot (1.25.3-1.1ubuntu3) over (1.25.3-1.1ubuntu2) ... Preparing to unpack .../14-libgdbm-compat4_1.21-1_amd64.deb ... Unpacking libgdbm-compat4:amd64 (1.21-1) over (1.19-2) ... Preparing to unpack .../15-libisl23_0.24-2_amd64.deb ... Unpacking libisl23:amd64 (0.24-2) over (0.24-1) ... Preparing to unpack .../16-libmpfr6_4.1.0-3build2_amd64.deb ... Unpacking libmpfr6:amd64 (4.1.0-3build2) over (4.1.0-3build1) ... Preparing to unpack .../17-libnpth0_1.6-3build1_amd64.deb ... Unpacking libnpth0:amd64 (1.6-3build1) over (1.6-3) ... Preparing to unpack .../18-lockfile-progs_0.1.19_amd64.deb ... Unpacking lockfile-progs (0.1.19) over (0.1.18build1) ... Preparing to unpack .../19-make_4.3-4ubuntu2_amd64.deb ... Unpacking make (4.3-4ubuntu2) over (4.3-4ubuntu1) ... Preparing to unpack .../20-optipng_0.7.7-2_amd64.deb ... Unpacking optipng (0.7.7-2) over (0.7.7-1build1) ... Preparing to unpack .../21-patch_2.7.6-7build1_amd64.deb ... Unpacking patch (2.7.6-7build1) over (2.7.6-7) ... Preparing to unpack .../22-pinentry-curses_1.1.1-1build1_amd64.deb ... Unpacking pinentry-curses (1.1.1-1build1) over (1.1.1-1) ... Preparing to unpack .../23-libmpc3_1.2.1-1_amd64.deb ... Unpacking libmpc3:amd64 (1.2.1-1) over (1.2.0-1build1) ... Setting up libip4tc2:amd64 (1.8.7-1ubuntu3) ... Setting up libapparmor1:amd64 (3.0.3-0ubuntu2) ... Setting up libargon2-1:amd64 (0~20171227-0.2build22) ... Setting up libsqlite3-0:amd64 (3.36.0-2) ... Setting up libnpth0:amd64 (1.6-3build1) ... Setting up bzip2 (1.0.8-4ubuntu4) ... Setting up libfakeroot:amd64 (1.25.3-1.1ubuntu3) ... Setting up fakeroot (1.25.3-1.1ubuntu3) ... Setting up ca-certificates (20211016) ... Updating certificates in /etc/ssl/certs... rehash: warning: skipping ca-certificates.crt,it does not contain exactly one certificate or CRL 7 added, 8 removed; done. Setting up make (4.3-4ubuntu2) ... Setting up libmpfr6:amd64 (4.1.0-3build2) ... Setting up optipng (0.7.7-2) ... Setting up libncurses6:amd64 (6.2+20210905-1) ... Setting up xz-utils (5.2.5-2build1) ... Setting up libmpc3:amd64 (1.2.1-1) ... Setting up lockfile-progs (0.1.19) ... Setting up patch (2.7.6-7build1) ... Setting up libncursesw6:amd64 (6.2+20210905-1) ... Setting up mount (2.36.1-8ubuntu2) ... Setting up sensible-utils (0.0.17) ... Setting up libcrypt-dev:amd64 (1:4.4.18-4ubuntu2) ... Setting up mawk (1.3.4.20200120-2build1) ... Setting up libisl23:amd64 (0.24-2) ... Setting up libjson-c5:amd64 (0.15-2build3) ... Setting up readline-common (8.1-2build1) ... Setting up libgdbm6:amd64 (1.21-1) ... Setting up pinentry-curses (1.1.1-1build1) ... Setting up libreadline8:amd64 (8.1-2build1) ... Setting up libgdbm-compat4:amd64 (1.21-1) ... Processing triggers for libc-bin (2.34-0ubuntu3) ... Processing triggers for ca-certificates (20211016) ... Updating certificates in /etc/ssl/certs... 0 added, 0 removed; done. Running hooks in /etc/ca-certificates/update.d... done. RUN: /usr/share/launchpad-buildd/bin/sbuild-package PACKAGEBUILD-22293618 amd64 jammy-proposed -c chroot:build-PACKAGEBUILD-22293618 --arch=amd64 --dist=jammy-proposed --nolog -A fasta3_36.3.8h.2020-02-11-4.dsc Initiating build PACKAGEBUILD-22293618 with 4 jobs across 4 processor cores. Kernel reported to sbuild: 4.15.0-159-generic #167-Ubuntu SMP Tue Sep 21 08:55:05 UTC 2021 x86_64 sbuild (Debian sbuild) 0.75.0 (21 Mar 2018) on lcy01-amd64-019.buildd +==============================================================================+ | fasta3 36.3.8h.2020-02-11-4 (amd64) Tue, 19 Oct 2021 19:08:34 +0000 | +==============================================================================+ Package: fasta3 Version: 36.3.8h.2020-02-11-4 Source Version: 36.3.8h.2020-02-11-4 Distribution: jammy-proposed Machine Architecture: amd64 Host Architecture: amd64 Build Architecture: amd64 Build Type: binary I: NOTICE: Log filtering will replace 'home/buildd/build-PACKAGEBUILD-22293618/chroot-autobuild' with '<>' +------------------------------------------------------------------------------+ | Fetch source files | +------------------------------------------------------------------------------+ Local sources ------------- fasta3_36.3.8h.2020-02-11-4.dsc exists in .; copying to chroot I: NOTICE: Log filtering will replace 'build/fasta3-det58n/fasta3-36.3.8h.2020-02-11' with '<>' I: NOTICE: Log filtering will replace 'build/fasta3-det58n' with '<>' +------------------------------------------------------------------------------+ | Install build-essential | +------------------------------------------------------------------------------+ Setup apt archive ----------------- Merged Build-Depends: build-essential, fakeroot Filtered Build-Depends: build-essential, fakeroot dpkg-deb: building package 'sbuild-build-depends-core-dummy' in '/<>/resolver-7pBiOw/apt_archive/sbuild-build-depends-core-dummy.deb'. dpkg-scanpackages: warning: Packages in archive but missing from override file: dpkg-scanpackages: warning: sbuild-build-depends-core-dummy dpkg-scanpackages: info: Wrote 1 entries to output Packages file. Ign:1 copy:/<>/resolver-7pBiOw/apt_archive ./ InRelease Get:2 copy:/<>/resolver-7pBiOw/apt_archive ./ Release [957 B] Ign:3 copy:/<>/resolver-7pBiOw/apt_archive ./ Release.gpg Get:4 copy:/<>/resolver-7pBiOw/apt_archive ./ Sources [349 B] Get:5 copy:/<>/resolver-7pBiOw/apt_archive ./ Packages [432 B] Fetched 1738 B in 0s (106 kB/s) Reading package lists... Reading package lists... Install core build dependencies (apt-based resolver) ---------------------------------------------------- Installing build dependencies Reading package lists... Building dependency tree... Reading state information... The following NEW packages will be installed: sbuild-build-depends-core-dummy 0 upgraded, 1 newly installed, 0 to remove and 0 not upgraded. Need to get 654 B of archives. After this operation, 0 B of additional disk space will be used. Get:1 copy:/<>/resolver-7pBiOw/apt_archive ./ sbuild-build-depends-core-dummy 0.invalid.0 [654 B] debconf: delaying package configuration, since apt-utils is not installed Fetched 654 B in 0s (49.7 kB/s) Selecting previously unselected package sbuild-build-depends-core-dummy. (Reading database ... 13260 files and directories currently installed.) Preparing to unpack .../sbuild-build-depends-core-dummy_0.invalid.0_amd64.deb ... Unpacking sbuild-build-depends-core-dummy (0.invalid.0) ... Setting up sbuild-build-depends-core-dummy (0.invalid.0) ... +------------------------------------------------------------------------------+ | Check architectures | +------------------------------------------------------------------------------+ Arch check ok (amd64 included in any all) +------------------------------------------------------------------------------+ | Install package build dependencies | +------------------------------------------------------------------------------+ Setup apt archive ----------------- Merged Build-Depends: debhelper-compat (= 13), libsimde-dev Filtered Build-Depends: debhelper-compat (= 13), libsimde-dev dpkg-deb: building package 'sbuild-build-depends-fasta3-dummy' in '/<>/resolver-7pBiOw/apt_archive/sbuild-build-depends-fasta3-dummy.deb'. dpkg-scanpackages: warning: Packages in archive but missing from override file: dpkg-scanpackages: warning: sbuild-build-depends-core-dummy sbuild-build-depends-fasta3-dummy dpkg-scanpackages: info: Wrote 2 entries to output Packages file. Ign:1 copy:/<>/resolver-7pBiOw/apt_archive ./ InRelease Get:2 copy:/<>/resolver-7pBiOw/apt_archive ./ Release [963 B] Ign:3 copy:/<>/resolver-7pBiOw/apt_archive ./ Release.gpg Get:4 copy:/<>/resolver-7pBiOw/apt_archive ./ Sources [498 B] Get:5 copy:/<>/resolver-7pBiOw/apt_archive ./ Packages [575 B] Fetched 2036 B in 0s (154 kB/s) Reading package lists... Reading package lists... Install fasta3 build dependencies (apt-based resolver) ------------------------------------------------------ Installing build dependencies Reading package lists... Building dependency tree... Reading state information... The following additional packages will be installed: autoconf automake autopoint autotools-dev bsdextrautils debhelper debugedit dh-autoreconf dh-strip-nondeterminism dwz file gettext gettext-base groff-base intltool-debian libarchive-zip-perl libdebhelper-perl libdw1 libelf1 libfile-stripnondeterminism-perl libicu67 libmagic-mgc libmagic1 libpipeline1 libsigsegv2 libsimde-dev libsub-override-perl libtool libuchardet0 libxml2 m4 man-db po-debconf Suggested packages: autoconf-archive gnu-standards autoconf-doc dh-make gettext-doc libasprintf-dev libgettextpo-dev groff libtool-doc gfortran | fortran95-compiler gcj-jdk m4-doc apparmor less www-browser libmail-box-perl Recommended packages: curl | wget | lynx libarchive-cpio-perl libltdl-dev libmail-sendmail-perl The following NEW packages will be installed: autoconf automake autopoint autotools-dev bsdextrautils debhelper debugedit dh-autoreconf dh-strip-nondeterminism dwz file gettext gettext-base groff-base intltool-debian libarchive-zip-perl libdebhelper-perl libdw1 libelf1 libfile-stripnondeterminism-perl libicu67 libmagic-mgc libmagic1 libpipeline1 libsigsegv2 libsimde-dev libsub-override-perl libtool libuchardet0 libxml2 m4 man-db po-debconf sbuild-build-depends-fasta3-dummy 0 upgraded, 34 newly installed, 0 to remove and 0 not upgraded. Need to get 18.2 MB of archives. After this operation, 67.8 MB of additional disk space will be used. Get:1 copy:/<>/resolver-7pBiOw/apt_archive ./ sbuild-build-depends-fasta3-dummy 0.invalid.0 [672 B] Get:2 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 bsdextrautils amd64 2.36.1-8ubuntu2 [75.0 kB] Get:3 http://ftpmaster.internal/ubuntu jammy/main amd64 libuchardet0 amd64 0.0.7-1build1 [76.7 kB] Get:4 http://ftpmaster.internal/ubuntu jammy/main amd64 groff-base amd64 1.22.4-7 [956 kB] Get:5 http://ftpmaster.internal/ubuntu jammy/main amd64 libpipeline1 amd64 1.5.3-1build1 [23.2 kB] Get:6 http://ftpmaster.internal/ubuntu jammy/main amd64 man-db amd64 2.9.4-2build1 [1180 kB] Get:7 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libelf1 amd64 0.185-2 [51.3 kB] Get:8 http://ftpmaster.internal/ubuntu jammy/main amd64 libicu67 amd64 67.1-7ubuntu1 [10.1 MB] Get:9 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libxml2 amd64 2.9.12+dfsg-5 [761 kB] Get:10 http://ftpmaster.internal/ubuntu jammy/main amd64 libmagic-mgc amd64 1:5.39-3build1 [236 kB] Get:11 http://ftpmaster.internal/ubuntu jammy/main amd64 libmagic1 amd64 1:5.39-3build1 [88.7 kB] Get:12 http://ftpmaster.internal/ubuntu jammy/main amd64 file amd64 1:5.39-3build1 [24.5 kB] Get:13 http://ftpmaster.internal/ubuntu jammy/main amd64 gettext-base amd64 0.21-4ubuntu3 [36.6 kB] Get:14 http://ftpmaster.internal/ubuntu jammy/main amd64 libsigsegv2 amd64 2.13-1ubuntu2 [14.6 kB] Get:15 http://ftpmaster.internal/ubuntu jammy/main amd64 m4 amd64 1.4.18-5ubuntu1 [199 kB] Get:16 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 autoconf all 2.71-2 [338 kB] Get:17 http://ftpmaster.internal/ubuntu jammy/main amd64 autotools-dev all 20180224.1+nmu1 [39.4 kB] Get:18 http://ftpmaster.internal/ubuntu jammy/main amd64 automake all 1:1.16.4-2 [557 kB] Get:19 http://ftpmaster.internal/ubuntu jammy/main amd64 autopoint all 0.21-4ubuntu3 [422 kB] Get:20 http://ftpmaster.internal/ubuntu jammy/main amd64 libdebhelper-perl all 13.3.4ubuntu2 [62.5 kB] Get:21 http://ftpmaster.internal/ubuntu jammy/main amd64 libtool all 2.4.6-15build1 [164 kB] Get:22 http://ftpmaster.internal/ubuntu jammy/main amd64 dh-autoreconf all 20 [16.1 kB] Get:23 http://ftpmaster.internal/ubuntu jammy/main amd64 libarchive-zip-perl all 1.68-1 [90.2 kB] Get:24 http://ftpmaster.internal/ubuntu jammy/main amd64 libsub-override-perl all 0.09-2 [9532 B] Get:25 http://ftpmaster.internal/ubuntu jammy/main amd64 libfile-stripnondeterminism-perl all 1.12.0-1 [17.5 kB] Get:26 http://ftpmaster.internal/ubuntu jammy/main amd64 dh-strip-nondeterminism all 1.12.0-1 [5228 B] Get:27 http://ftpmaster.internal/ubuntu jammy-proposed/main amd64 libdw1 amd64 0.185-2 [249 kB] Get:28 http://ftpmaster.internal/ubuntu jammy/main amd64 debugedit amd64 1:5.0-0ubuntu2 [47.9 kB] Get:29 http://ftpmaster.internal/ubuntu jammy/main amd64 dwz amd64 0.14-1build1 [104 kB] Get:30 http://ftpmaster.internal/ubuntu jammy/main amd64 gettext amd64 0.21-4ubuntu3 [824 kB] Get:31 http://ftpmaster.internal/ubuntu jammy/main amd64 intltool-debian all 0.35.0+20060710.5 [24.9 kB] Get:32 http://ftpmaster.internal/ubuntu jammy/main amd64 po-debconf all 1.0.21+nmu1 [233 kB] Get:33 http://ftpmaster.internal/ubuntu jammy/main amd64 debhelper all 13.3.4ubuntu2 [921 kB] Get:34 http://ftpmaster.internal/ubuntu jammy/universe amd64 libsimde-dev all 0.7.2-4 [258 kB] debconf: delaying package configuration, since apt-utils is not installed Fetched 18.2 MB in 0s (53.0 MB/s) Selecting previously unselected package bsdextrautils. (Reading database ... 13260 files and directories currently installed.) Preparing to unpack .../00-bsdextrautils_2.36.1-8ubuntu2_amd64.deb ... Unpacking bsdextrautils (2.36.1-8ubuntu2) ... Selecting previously unselected package libuchardet0:amd64. Preparing to unpack .../01-libuchardet0_0.0.7-1build1_amd64.deb ... Unpacking libuchardet0:amd64 (0.0.7-1build1) ... Selecting previously unselected package groff-base. Preparing to unpack .../02-groff-base_1.22.4-7_amd64.deb ... Unpacking groff-base (1.22.4-7) ... Selecting previously unselected package libpipeline1:amd64. Preparing to unpack .../03-libpipeline1_1.5.3-1build1_amd64.deb ... Unpacking libpipeline1:amd64 (1.5.3-1build1) ... Selecting previously unselected package man-db. Preparing to unpack .../04-man-db_2.9.4-2build1_amd64.deb ... Unpacking man-db (2.9.4-2build1) ... Selecting previously unselected package libelf1:amd64. Preparing to unpack .../05-libelf1_0.185-2_amd64.deb ... Unpacking libelf1:amd64 (0.185-2) ... Selecting previously unselected package libicu67:amd64. Preparing to unpack .../06-libicu67_67.1-7ubuntu1_amd64.deb ... Unpacking libicu67:amd64 (67.1-7ubuntu1) ... Selecting previously unselected package libxml2:amd64. Preparing to unpack .../07-libxml2_2.9.12+dfsg-5_amd64.deb ... Unpacking libxml2:amd64 (2.9.12+dfsg-5) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../08-libmagic-mgc_1%3a5.39-3build1_amd64.deb ... Unpacking libmagic-mgc (1:5.39-3build1) ... Selecting previously unselected package libmagic1:amd64. Preparing to unpack .../09-libmagic1_1%3a5.39-3build1_amd64.deb ... Unpacking libmagic1:amd64 (1:5.39-3build1) ... Selecting previously unselected package file. Preparing to unpack .../10-file_1%3a5.39-3build1_amd64.deb ... Unpacking file (1:5.39-3build1) ... Selecting previously unselected package gettext-base. Preparing to unpack .../11-gettext-base_0.21-4ubuntu3_amd64.deb ... Unpacking gettext-base (0.21-4ubuntu3) ... Selecting previously unselected package libsigsegv2:amd64. Preparing to unpack .../12-libsigsegv2_2.13-1ubuntu2_amd64.deb ... Unpacking libsigsegv2:amd64 (2.13-1ubuntu2) ... Selecting previously unselected package m4. Preparing to unpack .../13-m4_1.4.18-5ubuntu1_amd64.deb ... Unpacking m4 (1.4.18-5ubuntu1) ... Selecting previously unselected package autoconf. Preparing to unpack .../14-autoconf_2.71-2_all.deb ... Unpacking autoconf (2.71-2) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../15-autotools-dev_20180224.1+nmu1_all.deb ... Unpacking autotools-dev (20180224.1+nmu1) ... Selecting previously unselected package automake. Preparing to unpack .../16-automake_1%3a1.16.4-2_all.deb ... Unpacking automake (1:1.16.4-2) ... Selecting previously unselected package autopoint. Preparing to unpack .../17-autopoint_0.21-4ubuntu3_all.deb ... Unpacking autopoint (0.21-4ubuntu3) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../18-libdebhelper-perl_13.3.4ubuntu2_all.deb ... Unpacking libdebhelper-perl (13.3.4ubuntu2) ... Selecting previously unselected package libtool. Preparing to unpack .../19-libtool_2.4.6-15build1_all.deb ... Unpacking libtool (2.4.6-15build1) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../20-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../21-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libsub-override-perl. Preparing to unpack .../22-libsub-override-perl_0.09-2_all.deb ... Unpacking libsub-override-perl (0.09-2) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../23-libfile-stripnondeterminism-perl_1.12.0-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.12.0-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../24-dh-strip-nondeterminism_1.12.0-1_all.deb ... Unpacking dh-strip-nondeterminism (1.12.0-1) ... Selecting previously unselected package libdw1:amd64. Preparing to unpack .../25-libdw1_0.185-2_amd64.deb ... Unpacking libdw1:amd64 (0.185-2) ... Selecting previously unselected package debugedit. Preparing to unpack .../26-debugedit_1%3a5.0-0ubuntu2_amd64.deb ... Unpacking debugedit (1:5.0-0ubuntu2) ... Selecting previously unselected package dwz. Preparing to unpack .../27-dwz_0.14-1build1_amd64.deb ... Unpacking dwz (0.14-1build1) ... Selecting previously unselected package gettext. Preparing to unpack .../28-gettext_0.21-4ubuntu3_amd64.deb ... Unpacking gettext (0.21-4ubuntu3) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../29-intltool-debian_0.35.0+20060710.5_all.deb ... Unpacking intltool-debian (0.35.0+20060710.5) ... Selecting previously unselected package po-debconf. Preparing to unpack .../30-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../31-debhelper_13.3.4ubuntu2_all.deb ... Unpacking debhelper (13.3.4ubuntu2) ... Selecting previously unselected package libsimde-dev. Preparing to unpack .../32-libsimde-dev_0.7.2-4_all.deb ... Unpacking libsimde-dev (0.7.2-4) ... Selecting previously unselected package sbuild-build-depends-fasta3-dummy. Preparing to unpack .../33-sbuild-build-depends-fasta3-dummy_0.invalid.0_amd64.deb ... Unpacking sbuild-build-depends-fasta3-dummy (0.invalid.0) ... Setting up libpipeline1:amd64 (1.5.3-1build1) ... Setting up libsimde-dev (0.7.2-4) ... Setting up bsdextrautils (2.36.1-8ubuntu2) ... update-alternatives: using /usr/bin/write.ul to provide /usr/bin/write (write) in auto mode Setting up libicu67:amd64 (67.1-7ubuntu1) ... Setting up libmagic-mgc (1:5.39-3build1) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libdebhelper-perl (13.3.4ubuntu2) ... Setting up libmagic1:amd64 (1:5.39-3build1) ... Setting up gettext-base (0.21-4ubuntu3) ... Setting up file (1:5.39-3build1) ... Setting up autotools-dev (20180224.1+nmu1) ... Setting up libsigsegv2:amd64 (2.13-1ubuntu2) ... Setting up autopoint (0.21-4ubuntu3) ... Setting up libuchardet0:amd64 (0.0.7-1build1) ... Setting up libsub-override-perl (0.09-2) ... Setting up libelf1:amd64 (0.185-2) ... Setting up libxml2:amd64 (2.9.12+dfsg-5) ... Setting up libfile-stripnondeterminism-perl (1.12.0-1) ... Setting up libdw1:amd64 (0.185-2) ... Setting up gettext (0.21-4ubuntu3) ... Setting up libtool (2.4.6-15build1) ... Setting up m4 (1.4.18-5ubuntu1) ... Setting up intltool-debian (0.35.0+20060710.5) ... Setting up autoconf (2.71-2) ... Setting up dh-strip-nondeterminism (1.12.0-1) ... Setting up dwz (0.14-1build1) ... Setting up groff-base (1.22.4-7) ... Setting up debugedit (1:5.0-0ubuntu2) ... Setting up automake (1:1.16.4-2) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up po-debconf (1.0.21+nmu1) ... Setting up man-db (2.9.4-2build1) ... Not building database; man-db/auto-update is not 'true'. Created symlink /etc/systemd/system/timers.target.wants/man-db.timer → /lib/systemd/system/man-db.timer. Setting up dh-autoreconf (20) ... Setting up debhelper (13.3.4ubuntu2) ... Setting up sbuild-build-depends-fasta3-dummy (0.invalid.0) ... Processing triggers for libc-bin (2.34-0ubuntu3) ... +------------------------------------------------------------------------------+ | Build environment | +------------------------------------------------------------------------------+ Kernel: Linux 4.15.0-159-generic amd64 (x86_64) Toolchain package versions: binutils_2.37-7ubuntu1 dpkg-dev_1.20.9ubuntu2 g++-11_11.2.0-7ubuntu2 gcc-11_11.2.0-7ubuntu2 libc6-dev_2.34-0ubuntu3 libstdc++-11-dev_11.2.0-7ubuntu2 libstdc++6_11.2.0-7ubuntu2 linux-libc-dev_5.13.0-19.19 Package versions: adduser_3.118ubuntu5 advancecomp_2.1-2.1ubuntu1 apt_2.3.10 autoconf_2.71-2 automake_1:1.16.4-2 autopoint_0.21-4ubuntu3 autotools-dev_20180224.1+nmu1 base-files_12ubuntu1 base-passwd_3.5.52 bash_5.1-3ubuntu2 binutils_2.37-7ubuntu1 binutils-common_2.37-7ubuntu1 binutils-x86-64-linux-gnu_2.37-7ubuntu1 bsdextrautils_2.36.1-8ubuntu2 bsdutils_1:2.36.1-8ubuntu2 build-essential_12.9ubuntu2 bzip2_1.0.8-4ubuntu4 ca-certificates_20211016 coreutils_8.32-4ubuntu3 cpp_4:11.2.0-1ubuntu1 cpp-11_11.2.0-7ubuntu2 dash_0.5.11+git20210120+802ebd4-1build1 debconf_1.5.77 debhelper_13.3.4ubuntu2 debianutils_5.5-1 debugedit_1:5.0-0ubuntu2 dh-autoreconf_20 dh-strip-nondeterminism_1.12.0-1 diffutils_1:3.8-0ubuntu1 dpkg_1.20.9ubuntu2 dpkg-dev_1.20.9ubuntu2 dwz_0.14-1build1 e2fsprogs_1.46.3-1ubuntu3 fakeroot_1.25.3-1.1ubuntu3 file_1:5.39-3build1 findutils_4.8.0-1ubuntu2 g++_4:11.2.0-1ubuntu1 g++-11_11.2.0-7ubuntu2 gcc_4:11.2.0-1ubuntu1 gcc-11_11.2.0-7ubuntu2 gcc-11-base_11.2.0-7ubuntu2 gettext_0.21-4ubuntu3 gettext-base_0.21-4ubuntu3 gpg_2.2.20-1ubuntu4 gpg-agent_2.2.20-1ubuntu4 gpgconf_2.2.20-1ubuntu4 gpgv_2.2.20-1ubuntu4 grep_3.7-0ubuntu1 groff-base_1.22.4-7 gzip_1.10-4ubuntu2 hostname_3.23ubuntu1 init_1.60build1 init-system-helpers_1.60build1 intltool-debian_0.35.0+20060710.5 libacl1_2.2.53-10ubuntu2 libapparmor1_3.0.3-0ubuntu2 libapt-pkg6.0_2.3.10 libarchive-zip-perl_1.68-1 libargon2-1_0~20171227-0.2build22 libasan6_11.2.0-7ubuntu2 libassuan0_2.5.5-1 libatomic1_11.2.0-7ubuntu2 libattr1_1:2.5.1-1 libaudit-common_1:3.0-2ubuntu3 libaudit1_1:3.0-2ubuntu3 libbinutils_2.37-7ubuntu1 libblkid1_2.36.1-8ubuntu2 libbz2-1.0_1.0.8-4ubuntu4 libc-bin_2.34-0ubuntu3 libc-dev-bin_2.34-0ubuntu3 libc6_2.34-0ubuntu3 libc6-dev_2.34-0ubuntu3 libcap-ng0_0.7.9-2.2build2 libcap2_1:2.44-1build2 libcc1-0_11.2.0-7ubuntu2 libcom-err2_1.46.3-1ubuntu3 libcrypt-dev_1:4.4.18-4ubuntu2 libcrypt1_1:4.4.18-4ubuntu2 libcryptsetup12_2:2.3.6-0ubuntu1 libctf-nobfd0_2.37-7ubuntu1 libctf0_2.37-7ubuntu1 libdb5.3_5.3.28+dfsg1-0.8ubuntu2 libdebconfclient0_0.256ubuntu4 libdebhelper-perl_13.3.4ubuntu2 libdevmapper1.02.1_2:1.02.175-2.1ubuntu3 libdpkg-perl_1.20.9ubuntu2 libdw1_0.185-2 libelf1_0.185-2 libext2fs2_1.46.3-1ubuntu3 libfakeroot_1.25.3-1.1ubuntu3 libffi8_3.4.2-1ubuntu5 libfile-stripnondeterminism-perl_1.12.0-1 libgcc-11-dev_11.2.0-7ubuntu2 libgcc-s1_11.2.0-7ubuntu2 libgcrypt20_1.8.7-5ubuntu2 libgdbm-compat4_1.21-1 libgdbm6_1.21-1 libgmp10_2:6.2.1+dfsg-1ubuntu3 libgnutls30_3.7.1-5ubuntu1 libgomp1_11.2.0-7ubuntu2 libgpg-error0_1.42-3 libgssapi-krb5-2_1.18.3-7 libhogweed6_3.7.3-1build1 libicu67_67.1-7ubuntu1 libidn2-0_2.3.2-2 libip4tc2_1.8.7-1ubuntu3 libisl23_0.24-2 libitm1_11.2.0-7ubuntu2 libjson-c5_0.15-2build3 libk5crypto3_1.18.3-7 libkeyutils1_1.6.1-2ubuntu2 libkmod2_28-1ubuntu4 libkrb5-3_1.18.3-7 libkrb5support0_1.18.3-7 liblockfile-bin_1.17-1build1 liblockfile1_1.17-1build1 liblsan0_11.2.0-7ubuntu2 liblz4-1_1.9.3-2build1 liblzma5_5.2.5-2build1 libmagic-mgc_1:5.39-3build1 libmagic1_1:5.39-3build1 libmount1_2.36.1-8ubuntu2 libmpc3_1.2.1-1 libmpfr6_4.1.0-3build2 libncurses6_6.2+20210905-1 libncursesw6_6.2+20210905-1 libnettle8_3.7.3-1build1 libnpth0_1.6-3build1 libnsl-dev_1.3.0-2build1 libnsl2_1.3.0-2build1 libp11-kit0_0.24.0-5 libpam-modules_1.3.1-5ubuntu11 libpam-modules-bin_1.3.1-5ubuntu11 libpam-runtime_1.3.1-5ubuntu11 libpam0g_1.3.1-5ubuntu11 libpcre2-8-0_10.37-0ubuntu2 libpcre3_2:8.39-13build4 libperl5.32_5.32.1-3ubuntu3 libpipeline1_1.5.3-1build1 libpng16-16_1.6.37-3build4 libprocps8_2:3.3.17-5ubuntu3 libquadmath0_11.2.0-7ubuntu2 libreadline8_8.1-2build1 libseccomp2_2.5.1-1ubuntu2 libselinux1_3.1-3build3 libsemanage-common_3.1-1ubuntu3 libsemanage1_3.1-1ubuntu3 libsepol1_3.1-1ubuntu2 libsigsegv2_2.13-1ubuntu2 libsimde-dev_0.7.2-4 libsmartcols1_2.36.1-8ubuntu2 libsqlite3-0_3.36.0-2 libss2_1.46.3-1ubuntu3 libssl1.1_1.1.1l-1ubuntu1 libstdc++-11-dev_11.2.0-7ubuntu2 libstdc++6_11.2.0-7ubuntu2 libsub-override-perl_0.09-2 libsystemd0_248.3-1ubuntu8 libtasn1-6_4.17.0-2 libtinfo6_6.2+20210905-1 libtirpc-common_1.3.2-2 libtirpc-dev_1.3.2-2 libtirpc3_1.3.2-2 libtool_2.4.6-15build1 libtsan0_11.2.0-7ubuntu2 libubsan1_11.2.0-7ubuntu2 libuchardet0_0.0.7-1build1 libudev1_248.3-1ubuntu8 libunistring2_0.9.10-6 libuuid1_2.36.1-8ubuntu2 libxml2_2.9.12+dfsg-5 libxxhash0_0.8.0-2build1 libzstd1_1.4.8+dfsg-3 linux-libc-dev_5.13.0-19.19 lockfile-progs_0.1.19 login_1:4.8.1-1ubuntu9 logsave_1.46.3-1ubuntu3 lsb-base_11.1.0ubuntu3 lto-disabled-list_16 m4_1.4.18-5ubuntu1 make_4.3-4ubuntu2 man-db_2.9.4-2build1 mawk_1.3.4.20200120-2build1 mount_2.36.1-8ubuntu2 ncurses-base_6.2+20210905-1 ncurses-bin_6.2+20210905-1 openssl_1.1.1l-1ubuntu1 optipng_0.7.7-2 passwd_1:4.8.1-1ubuntu9 patch_2.7.6-7build1 perl_5.32.1-3ubuntu3 perl-base_5.32.1-3ubuntu3 perl-modules-5.32_5.32.1-3ubuntu3 pinentry-curses_1.1.1-1build1 pkgbinarymangler_148 po-debconf_1.0.21+nmu1 policyrcd-script-zg2_0.1-3 procps_2:3.3.17-5ubuntu3 readline-common_8.1-2build1 rpcsvc-proto_1.4.2-0ubuntu5 sbuild-build-depends-core-dummy_0.invalid.0 sbuild-build-depends-fasta3-dummy_0.invalid.0 sed_4.7-1ubuntu2 sensible-utils_0.0.17 systemd_248.3-1ubuntu8 systemd-sysv_248.3-1ubuntu8 systemd-timesyncd_248.3-1ubuntu8 sysvinit-utils_2.96-7ubuntu2 tar_1.34+dfsg-1build2 tzdata_2021a-2ubuntu1 ubuntu-keyring_2021.03.26 usrmerge_25ubuntu1 util-linux_2.36.1-8ubuntu2 xz-utils_5.2.5-2build1 zlib1g_1:1.2.11.dfsg-2ubuntu7 +------------------------------------------------------------------------------+ | Build | +------------------------------------------------------------------------------+ Unpack source ------------- gpgv: Signature made Thu Sep 9 07:45:51 2021 UTC gpgv: using RSA key F1F007320A035541F0A663CA578A0494D1C646D1 gpgv: issuer "tille@debian.org" gpgv: Can't check signature: No public key dpkg-source: warning: failed to verify signature on ./fasta3_36.3.8h.2020-02-11-4.dsc dpkg-source: info: extracting fasta3 in /<> dpkg-source: info: unpacking fasta3_36.3.8h.2020-02-11.orig.tar.gz dpkg-source: info: unpacking fasta3_36.3.8h.2020-02-11-4.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying Makefile.patch dpkg-source: info: applying simde dpkg-source: info: applying local_tests dpkg-source: info: applying adjust-scripts Check disk space ---------------- Sufficient free space for build User Environment ---------------- APT_CONFIG=/var/lib/sbuild/apt.conf DEB_BUILD_OPTIONS=parallel=4 HOME=/sbuild-nonexistent LANG=C.UTF-8 LC_ALL=C.UTF-8 LOGNAME=buildd PATH=/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin:/usr/games SCHROOT_ALIAS_NAME=build-PACKAGEBUILD-22293618 SCHROOT_CHROOT_NAME=build-PACKAGEBUILD-22293618 SCHROOT_COMMAND=env SCHROOT_GID=2501 SCHROOT_GROUP=buildd SCHROOT_SESSION_ID=build-PACKAGEBUILD-22293618 SCHROOT_UID=2001 SCHROOT_USER=buildd SHELL=/bin/sh TERM=unknown USER=buildd V=1 dpkg-buildpackage ----------------- dpkg-buildpackage: info: source package fasta3 dpkg-buildpackage: info: source version 36.3.8h.2020-02-11-4 dpkg-buildpackage: info: source distribution unstable dpkg-source --before-build . dpkg-buildpackage: info: host architecture amd64 debian/rules clean dh clean --sourcedirectory src debian/rules override_dh_auto_clean make[1]: Entering directory '/<>' if [ -d src ]; then cd src && /usr/bin/make -f "../make/Makefile.linux64" clean-up; fi make[2]: Entering directory '/<>/src' rm -f *.o fasta36 ssearch36 lalign36 fasts36 fastx36 tfastx36 fasty36 tfasty36 tfasts36 fastm36 tfastm36 fastf36 tfastf36 glsearch36 ggsearch36 map_db; rm -rf ../bin/* make[2]: Leaving directory '/<>/src' make[1]: Leaving directory '/<>' dh_autoreconf_clean -O--sourcedirectory=src dh_clean -O--sourcedirectory=src debian/rules binary dh binary --sourcedirectory src dh_update_autotools_config -O--sourcedirectory=src dh_autoreconf -O--sourcedirectory=src dh_auto_configure -O--sourcedirectory=src debian/rules override_dh_auto_build make[1]: Entering directory '/<>' dh_auto_build --sourcedirectory make --builddirectory src --buildsystem makefile -- -f "../make/Makefile.linux64" cd src && make -j4 "INSTALL=install --strip-program=true" -f ../make/Makefile.linux64 make[2]: Entering directory '/<>/src' cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DCOMP_THR -DCOMP_MLIB -c comp_lib9.c -o comp_mthr9.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c work_thr2.c cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c pthr_subs2.c cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DCOMP_THR -DCOMP_MLIB -c compacc2e.c -o compacc2_t.o compacc2e.c: In function ‘save_best’: compacc2e.c:2547:87: warning: format ‘%lld’ expects argument of type ‘long long int’, but argument 19 has type ‘off_t’ {aka ‘long int’} [-Wformat=] 2547 | "%-12s %6d %d %.5f %.5f %4d %4d %4d %2d %2d %4d %4d %4d %2d %2d %5d %8lld\n", | ~~~~^ | | | long long int | %8ld ...... 2555 | rbuf_dp->stats_idx, rbuf_dp->mseq->lseek); | ~~~~~~~~~~~~~~~~~~~~ | | | off_t {aka long int} compacc2e.c: In function ‘save_best2’: compacc2e.c:2731:87: warning: format ‘%lld’ expects argument of type ‘long long int’, but argument 19 has type ‘off_t’ {aka ‘long int’} [-Wformat=] 2731 | "%-12s %6d %d %.5f %.5f %4d %4d %4d %2d %2d %4d %4d %4d %2d %2d %5d %8lld\n", | ~~~~^ | | | long long int | %8ld ...... 2739 | rbuf_dp->stats_idx, rbuf_dp->mseq->lseek); | ~~~~~~~~~~~~~~~~~~~~ | | | off_t {aka long int} cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c mshowbest.c -o showbest.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c build_ares.c -o build_ares.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c re_getlib.c comp_lib9.c: In function ‘main’: comp_lib9.c:965:40: warning: ‘ fragments’ directive writing 10 bytes into a region of size between 0 and 22 [-Wformat-overflow=] 965 | sprintf(tmp_str," - %d %s in %d fragments", m_msg.n0 - (m_msg.nm0-1), m_msg.sqnam, m_msg.nm0); | ^~~~~~~~~~ In file included from /usr/include/stdio.h:888, from comp_lib9.c:37: /usr/include/x86_64-linux-gnu/bits/stdio2.h:38:10: note: ‘__sprintf_chk’ output between 21 and 43 bytes into a destination of size 32 38 | return __builtin___sprintf_chk (__s, __USE_FORTIFY_LEVEL - 1, | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 39 | __glibc_objsize (__s), __fmt, | ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 40 | __va_arg_pack ()); | ~~~~~~~~~~~~~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DCOMP_THR -c mshowalign2.c -o mshowalign2_t.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c htime.c cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c apam.c cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c doinit.c cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTA initfa.c -o init_fa.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DLOCAL_SCORE -c scaleswn.c -o scale_se.o initfa.c: In function ‘get_lambda.constprop.0’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c karlin.c initfa.c: In function ‘get_lambda’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c dropnfa.c -o drop_nfa.o cc -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -Wdate-time -D_FORTIFY_SOURCE=2 -c -o wm_align.o wm_align.c cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTA -c cal_cons2.c -o calcons_fa.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c nmgetlib.c -o lgetlib.o nmgetlib.c: In function ‘agetlib’: nmgetlib.c:621:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 621 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR/2,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:623:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 623 | fgets(&lm_fd->lline[MAX_STR/2],MAX_STR/2,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:667:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 667 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR-strlen(lm_fd->lline),lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:682:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 682 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘aranlib’: nmgetlib.c:702:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 702 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘qgetlib’: nmgetlib.c:766:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 766 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR/2,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:768:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 768 | fgets(&lm_fd->lline[MAX_STR/2],MAX_STR/2,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:800:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 800 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR-strlen(lm_fd->lline),lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘qranlib’: nmgetlib.c:823:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 823 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘lgetlib’: nmgetlib.c:878:7: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 878 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:916:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 916 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘lget_ann’: nmgetlib.c:940:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 940 | fgets(desc,sizeof(desc),lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:942:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 942 | fgets(desc,sizeof(desc),lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:946:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 946 | fgets(acc,sizeof(acc),lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:948:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 948 | fgets(acc,sizeof(acc),lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:956:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 956 | fgets(ver,sizeof(ver),lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:958:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 958 | fgets(ver,sizeof(ver),lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘lranlib’: nmgetlib.c:1032:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1032 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1039:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1039 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘pgetlib’: nmgetlib.c:1078:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1078 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); /* get the extra line */ | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1100:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1100 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘pranlib’: nmgetlib.c:1124:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1124 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1128:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1128 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1130:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1130 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1136:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1136 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘egetlib’: nmgetlib.c:1220:1: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1220 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘eranlib’: nmgetlib.c:1250:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1250 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1255:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1255 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1258:56: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1258 | while (lm_fd->lline[0]!='D' || lm_fd->lline[1]!='E') fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1265:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1265 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘igetlib’: nmgetlib.c:1297:46: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1297 | while (lm_fd->lline[0]==';') fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1329:13: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1329 | fgets(lm_fd->lline,MAX_STR-strlen(lm_fd->lline),lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1333:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1333 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘iranlib’: nmgetlib.c:1360:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1360 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1371:38: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1371 | while (lm_fd->lline[0]==';') fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1380:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1380 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘vgetlib’: nmgetlib.c:1419:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1419 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1459:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1459 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR-strlen(lm_fd->lline),lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1465:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1465 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘vranlib’: nmgetlib.c:1492:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1492 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1508:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1508 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1525:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1525 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘gcg_getlib’: nmgetlib.c:1567:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1567 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1570:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1570 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR/2,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1572:7: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1572 | fgets(&lm_fd->lline[strlen(lm_fd->lline)-MAX_STR/2],MAX_STR/2,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1592:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1592 | fread((char *)seqp,(size_t)r_block,(size_t)1,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1607:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1607 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘gcg_ranlib’: nmgetlib.c:1631:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1631 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1641:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1641 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1672:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1672 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c mmgetaa.c -o lgetaa_m.o mmgetaa.c: In function ‘load_mmap’: mmgetaa.c:167:63: warning: format ‘%lld’ expects argument of type ‘long long int’, but argument 3 has type ‘fseek_t’ {aka ‘long int’} [-Wformat=] 167 | fprintf(stderr,"\n *** Warning *** database too large (%lld) for 32-bit mmap()\n",f_size); | ~~~^ ~~~~~~ | | | | long long int fseek_t {aka long int} | %ld mmgetaa.c:205:41: warning: format ‘%lld’ expects argument of type ‘long long int’, but argument 4 has type ‘__off_t’ {aka ‘long int’} [-Wformat=] 205 | fprintf(stderr," %s file size (%lld) and expected size (%lld) don't match\n", | ~~~^ | | | long long int | %ld 206 | bname,statbuf.st_size,f_size); | ~~~~~~~~~~~~~~~ | | | __off_t {aka long int} mmgetaa.c:205:66: warning: format ‘%lld’ expects argument of type ‘long long int’, but argument 5 has type ‘fseek_t’ {aka ‘long int’} [-Wformat=] 205 | fprintf(stderr," %s file size (%lld) and expected size (%lld) don't match\n", | ~~~^ | | | long long int | %ld 206 | bname,statbuf.st_size,f_size); | ~~~~~~ | | | fseek_t {aka long int} mmgetaa.c:296:41: warning: format ‘%lld’ expects argument of type ‘long long int’, but argument 4 has type ‘__off_t’ {aka ‘long int’} [-Wformat=] 296 | fprintf(stderr," %s file size (%lld) and expected size (%lld) don't match\n", | ~~~^ | | | long long int | %ld 297 | sname,statbuf.st_size,f_size); | ~~~~~~~~~~~~~~~ | | | __off_t {aka long int} mmgetaa.c:296:66: warning: format ‘%lld’ expects argument of type ‘long long int’, but argument 5 has type ‘fseek_t’ {aka ‘long int’} [-Wformat=] 296 | fprintf(stderr," %s file size (%lld) and expected size (%lld) don't match\n", | ~~~^ | | | long long int | %ld 297 | sname,statbuf.st_size,f_size); | ~~~~~~ | | | fseek_t {aka long int} mmgetaa.c: In function ‘check_mmap’: mmgetaa.c:1077:31: warning: format ‘%lld’ expects argument of type ‘long long int’, but argument 4 has type ‘MM_OFF’ {aka ‘long int’} [-Wformat=] 1077 | fprintf(stderr,"%d:\t%lld\t%lld\t%lld\n", | ~~~^ | | | long long int | %ld 1078 | i,m_fd->d_pos_arr[i],m_fd->s_pos_arr[i], | ~~~~~~~~~~~~~~~~~~ | | | MM_OFF {aka long int} mmgetaa.c:1077:37: warning: format ‘%lld’ expects argument of type ‘long long int’, but argument 5 has type ‘MM_OFF’ {aka ‘long int’} [-Wformat=] 1077 | fprintf(stderr,"%d:\t%lld\t%lld\t%lld\n", | ~~~^ | | | long long int | %ld 1078 | i,m_fd->d_pos_arr[i],m_fd->s_pos_arr[i], | ~~~~~~~~~~~~~~~~~~ | | | MM_OFF {aka long int} mmgetaa.c:1077:43: warning: format ‘%lld’ expects argument of type ‘long long int’, but argument 6 has type ‘MM_OFF’ {aka ‘long int’} [-Wformat=] 1077 | fprintf(stderr,"%d:\t%lld\t%lld\t%lld\n", | ~~~^ | | | long long int | %ld 1078 | i,m_fd->d_pos_arr[i],m_fd->s_pos_arr[i], 1079 | m_fd->d_pos_arr[i+1]-m_fd->s_pos_arr[i]); | ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ | | | MM_OFF {aka long int} cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c c_dispn.c cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c ncbl2_mlib.c -o ncbl2_mlib.o ncbl2_mlib.c: In function ‘ncbl2_getliba’: ncbl2_mlib.c:1104:59: warning: format ‘%lld’ expects argument of type ‘long long int’, but argument 3 has type ‘fseek_t’ {aka ‘long int’} [-Wformat=] 1104 | fprintf(stderr," could not read sequence record: %lld %ld != %ld\n", | ~~~^ | | | long long int | %ld 1105 | *libpos,tmp,seq_len); | ~~~~~~~ | | | fseek_t {aka long int} ncbl2_mlib.c:1149:49: warning: format ‘%lld’ expects argument of type ‘long long int’, but argument 4 has type ‘fseek_t’ {aka ‘long int’} [-Wformat=] 1149 | error: fprintf(stderr," error reading %s at %lld\n",libstr,*libpos); | ~~~^ ~~~~~~~ | | | | | fseek_t {aka long int} | long long int | %ld ncbl2_mlib.c: In function ‘ncbl2_getlibn’: ncbl2_mlib.c:1433:57: warning: format ‘%lld’ expects argument of type ‘long long int’, but argument 4 has type ‘fseek_t’ {aka ‘long int’} [-Wformat=] 1433 | " could not read sequence record: %s %lld %ld != %ld: %d\n", | ~~~^ | | | long long int | %ld 1434 | libstr,*libpos,tmp,seqcnt,*seq); | ~~~~~~~ | | | fseek_t {aka long int} ncbl2_mlib.c:1453:61: warning: format ‘%lld’ expects argument of type ‘long long int’, but argument 3 has type ‘fseek_t’ {aka ‘long int’} [-Wformat=] 1453 | fprintf(stderr," could not read sequence record: %lld %ld/%ld\n", | ~~~^ | | | long long int | %ld 1454 | *libpos,tmp,seqcnt); | ~~~~~~~ | | | fseek_t {aka long int} ncbl2_mlib.c:1677:49: warning: format ‘%lld’ expects argument of type ‘long long int’, but argument 4 has type ‘fseek_t’ {aka ‘long int’} [-Wformat=] 1677 | error: fprintf(stderr," error reading %s at %lld\n",libstr,*libpos); | ~~~^ ~~~~~~~ | | | | | fseek_t {aka long int} | long long int | %ld ncbl2_mlib.c: In function ‘load_ncbl2’: ncbl2_mlib.c:810:5: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 810 | fread(title_str,(size_t)1,(size_t)title_len,ifile); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c:820:7: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 820 | fread(pdb_title_str,(size_t)1,(size_t)pdb_title_len,ifile); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c:831:5: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 831 | fread(date_str,(size_t)1,(size_t)date_len,ifile); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c: In function ‘ncbl2_ranlib’: ncbl2_mlib.c:1719:5: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1719 | fread(str,(size_t)1,(size_t)(llen),m_fd->hfile); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c:1734:5: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1734 | fread(my_buff,(size_t)1,llen,m_fd->hfile); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c: In function ‘src_int4_read’: ncbl2_mlib.c:1840:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1840 | fread((char *)&b[0],(size_t)1,(size_t)4,fd); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c: In function ‘src_long4_read’: ncbl2_mlib.c:1855:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1855 | fread((char *)&b[0],(size_t)1,(size_t)4,fd); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c: In function ‘src_uint4_read’: ncbl2_mlib.c:1868:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1868 | fread((char *)&b[0],(size_t)1,(size_t)4,fd); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c: In function ‘src_long8_read’: ncbl2_mlib.c:1883:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1883 | fread((char *)&b[0],(size_t)1,(size_t)8,fd); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c: In function ‘ncbi_long8_read’: ncbl2_mlib.c:1903:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1903 | fread((char *)&b[0],(size_t)1,(size_t)8,fd); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c: In function ‘src_char_read’: ncbl2_mlib.c:1910:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1910 | fread(val,(size_t)1,(size_t)1,fd); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c: In function ‘src_fstr_read’: ncbl2_mlib.c:1915:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1915 | fread(val,(size_t)slen,(size_t)1,fd); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c lib_sel.c cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c url_subs.c cc -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -Wdate-time -D_FORTIFY_SOURCE=2 -c -o mrandom.o mrandom.c cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DSW_SSE2 -DSSEARCH initfa.c -o init_sw_sse.o ncbl2_mlib.c: In function ‘get_asn_textseq_id’: ncbl2_mlib.c:2046:25: warning: ‘%d’ directive writing between 1 and 10 bytes into a region of size 9 [-Wformat-overflow=] 2046 | sprintf(ver_str,".%d",version); | ^~ ncbl2_mlib.c:2046:23: note: directive argument in the range [0, 2147483647] 2046 | sprintf(ver_str,".%d",version); | ^~~~~ In file included from /usr/include/stdio.h:888, from ncbl2_mlib.c:37: /usr/include/x86_64-linux-gnu/bits/stdio2.h:38:10: note: ‘__sprintf_chk’ output between 3 and 12 bytes into a destination of size 10 38 | return __builtin___sprintf_chk (__s, __USE_FORTIFY_LEVEL - 1, | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 39 | __glibc_objsize (__s), __fmt, | ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 40 | __va_arg_pack ()); | ~~~~~~~~~~~~~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSW_SSE2 -c dropgsw2.c -o dropgsw2_sse.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSW_SSE2 -c smith_waterman_sse2.c initfa.c: In function ‘get_lambda.constprop.0’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c wm_align.c -o lwm_align.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSSEARCH -c cal_cons2.c -o calcons_sw.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c pssm_asn_subs.c cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DCOMP_MLIB -c comp_lib9.c -o comp_mlib9.o initfa.c: In function ‘get_lambda’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DCOMP_MLIB -c compacc2e.c -o compacc2_s.o compacc2e.c: In function ‘save_best’: compacc2e.c:2547:87: warning: format ‘%lld’ expects argument of type ‘long long int’, but argument 19 has type ‘off_t’ {aka ‘long int’} [-Wformat=] 2547 | "%-12s %6d %d %.5f %.5f %4d %4d %4d %2d %2d %4d %4d %4d %2d %2d %5d %8lld\n", | ~~~~^ | | | long long int | %8ld ...... 2555 | rbuf_dp->stats_idx, rbuf_dp->mseq->lseek); | ~~~~~~~~~~~~~~~~~~~~ | | | off_t {aka long int} compacc2e.c: In function ‘save_best2’: compacc2e.c:2731:87: warning: format ‘%lld’ expects argument of type ‘long long int’, but argument 19 has type ‘off_t’ {aka ‘long int’} [-Wformat=] 2731 | "%-12s %6d %d %.5f %.5f %4d %4d %4d %2d %2d %4d %4d %4d %2d %2d %5d %8lld\n", | ~~~~^ | | | long long int | %8ld ...... 2739 | rbuf_dp->stats_idx, rbuf_dp->mseq->lseek); | ~~~~~~~~~~~~~~~~~~~~ | | | off_t {aka long int} comp_lib9.c: In function ‘main’: comp_lib9.c:965:40: warning: ‘ fragments’ directive writing 10 bytes into a region of size between 0 and 22 [-Wformat-overflow=] 965 | sprintf(tmp_str," - %d %s in %d fragments", m_msg.n0 - (m_msg.nm0-1), m_msg.sqnam, m_msg.nm0); | ^~~~~~~~~~ In file included from /usr/include/stdio.h:888, from comp_lib9.c:37: /usr/include/x86_64-linux-gnu/bits/stdio2.h:38:10: note: ‘__sprintf_chk’ output between 21 and 43 bytes into a destination of size 32 38 | return __builtin___sprintf_chk (__s, __USE_FORTIFY_LEVEL - 1, | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 39 | __glibc_objsize (__s), __fmt, | ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 40 | __va_arg_pack ()); | ~~~~~~~~~~~~~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DLALIGN -c mshowalign2.c -o lshowalign.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DLALIGN initfa.c -o init_lal.o initfa.c: In function ‘get_lambda.constprop.0’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c last_thresh.c cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -DLALIGN -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSW_SSE2 -c dropgsw2.c -o droplal2_sse.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c lsim4.c cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -DLALIGN -DLCAL_CONS -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c cal_cons2.c -o calcons_la.o initfa.c: In function ‘get_lambda’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTS initfa.c -o init_fs.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c scaleswt.c -o scaleswts.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c last_tat.c cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTS tatstats.c -o tatstats_fs.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTS -c dropfs2.c -o drop_fs2.o initfa.c: In function ‘get_lambda.constprop.0’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTS -c cal_consf.c -o calcons_fs.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTX initfa.c -o init_fx.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c faatran.c initfa.c: In function ‘get_lambda’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ initfa.c: In function ‘get_lambda.constprop.0’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c dropfx2.c -o drop_fx.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTX -DTFAST initfa.c -o init_tfx.o initfa.c: In function ‘get_lambda.constprop.0’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DTFAST dropfx2.c -o drop_tfx.o initfa.c: In function ‘get_lambda’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ initfa.c: In function ‘get_lambda’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTY initfa.c -o init_fy.o initfa.c: In function ‘get_lambda.constprop.0’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c dropfz3.c -o drop_fz.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTY -DTFAST initfa.c -o init_tfy.o initfa.c: In function ‘get_lambda.constprop.0’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ initfa.c: In function ‘get_lambda’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DTFAST dropfz3.c -o drop_tfz.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTS -DTFAST initfa.c -o init_tfs.o initfa.c: In function ‘get_lambda’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ initfa.c: In function ‘get_lambda.constprop.0’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DTFAST -DFASTS dropfs2.c -o drop_tfs.o initfa.c: In function ‘get_lambda’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DTFAST -DFASTS -c cal_consf.c -o calcons_tfs.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTM initfa.c -o init_fm.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTM tatstats.c -o tatstats_fm.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTM dropfs2.c -o drop_fm.o initfa.c: In function ‘get_lambda.constprop.0’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTM -c cal_consf.c -o calcons_fm.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c mshowalign2.c -o mshowalign2_s.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTM -DTFAST initfa.c -o init_tfm.o initfa.c: In function ‘get_lambda’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ initfa.c: In function ‘get_lambda.constprop.0’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DTFAST -DFASTM dropfs2.c -o drop_tfm.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DTFAST -DFASTM -c cal_consf.c -o calcons_tfm.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTF initfa.c -o init_ff.o initfa.c: In function ‘get_lambda.constprop.0’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTF -c scaleswt.c -o scaleswtf.o initfa.c: In function ‘get_lambda’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTF tatstats.c -o tatstats_ff.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTF dropff2.c -o drop_ff2.o initfa.c: In function ‘get_lambda’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTF -c cal_consf.c -o calcons_ff.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTF -DTFAST initfa.c -o init_tf.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTF -DTFAST dropff2.c -o drop_tff.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DTFAST -DFASTF -c cal_consf.c -o calcons_tff.o initfa.c: In function ‘get_lambda.constprop.0’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -DNORMAL_DIST -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c scaleswn.c -o scale_sn.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DSW_SSE2 -DGLSEARCH initfa.c -o init_lnw_sse.o initfa.c: In function ‘get_lambda.constprop.0’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -DSW_SSE2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c dropnnw2.c -o droplnw_sse.o initfa.c: In function ‘get_lambda’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSW_SSE2 -c glocal_sse2.c cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DGGSEARCH -c wm_align.c -o gwm_align.o initfa.c: In function ‘get_lambda’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DSW_SSE2 -DGGSEARCH initfa.c -o init_gnw_sse.o cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -DGLOBAL_GLOBAL -DSW_SSE2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c dropnnw2.c -o dropgnw_sse.o initfa.c: In function ‘get_lambda.constprop.0’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSW_SSE2 -c global_sse2.c cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -flto=auto -ffat-lto-objects -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -o ../bin/map_db map_db.c cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/fasta36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fa.o drop_nfa.o wm_align.o calcons_fa.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o -lm -lpthread map_db.c: In function ‘main’: map_db.c:370:47: warning: format ‘%lld’ expects argument of type ‘long long int’, but argument 4 has type ‘fseek_t’ {aka ‘long int’} [-Wformat=] 370 | fprintf(stderr," wrote %d sequences (tot=%lld, max=%ld) to %s\n", | ~~~^ | | | long long int | %ld 371 | nlib,tot_len,max_len,iname); | ~~~~~~~ | | | fseek_t {aka long int} map_db.c:149:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 149 | fgets(lname,sizeof(lname),stdin); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ map_db.c: In function ‘gbf_get_ent’: map_db.c:512:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 512 | fgets(lline,MAXLINE,libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~ map_db.c: In function ‘src_int4_read’: map_db.c:524:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 524 | fread((char *)&b[0],(size_t)1,(size_t)4,fd); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 1 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch] 250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn, | ^ initfa.c:2036:1: note: type mismatch in parameter 6 2036 | last_calc( | ^ initfa.c:2036:1: note: ‘last_calc’ was previously declared here mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 4 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/ssearch36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_sw_sse.o dropgsw2_sse.o smith_waterman_sse2.o lwm_align.o calcons_sw.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm -lpthread initfa.c: In function ‘get_lambda’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In file included from initfa.c:43: /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^~~~~~ compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 1 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch] 250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn, | ^ initfa.c:2036:1: note: type mismatch in parameter 6 2036 | last_calc( | ^ initfa.c:2036:1: note: ‘last_calc’ was previously declared here mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 4 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/lalign36 comp_mlib9.o compacc2_s.o showbest.o build_ares.o re_getlib.o lshowalign.o htime.o apam.o doinit.o init_lal.o droplal2_sse.o smith_waterman_sse2.o lsim4.o calcons_la.o scale_se.o karlin.o last_thresh.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 1 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 4 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/fasts36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fs.o drop_fs2.o calcons_fs.o scaleswts.o last_tat.o tatstats_fs.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o mrandom.o url_subs.o -lm -lpthread compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 1 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch] 236 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: type mismatch in parameter 7 164 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: ‘process_hist’ was previously declared here scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 4 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used initfa.c: In function ‘get_lambda.constprop’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^ /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^ /usr/bin/ld: /tmp/ccbWz0kk.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/fastx36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fx.o drop_fx.o faatran.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o -lm -lpthread compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 1 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch] 250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn, | ^ initfa.c:2036:1: note: type mismatch in parameter 6 2036 | last_calc( | ^ initfa.c:2036:1: note: ‘last_calc’ was previously declared here mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 4 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used /usr/bin/ld: /tmp/ccPEdxBv.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/tfastx36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tfx.o drop_tfx.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o url_subs.o mrandom.o -lm -lpthread compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 1 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch] 250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn, | ^ initfa.c:2036:1: note: type mismatch in parameter 6 2036 | last_calc( | ^ initfa.c:2036:1: note: ‘last_calc’ was previously declared here mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 4 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used initfa.c: In function ‘get_lambda.constprop’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^ /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^ /usr/bin/ld: /tmp/ccKmuQta.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/fasty36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fy.o drop_fz.o faatran.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o -lm -lpthread compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 1 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch] 250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn, | ^ initfa.c:2036:1: note: type mismatch in parameter 6 2036 | last_calc( | ^ initfa.c:2036:1: note: ‘last_calc’ was previously declared here mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 4 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used /usr/bin/ld: /tmp/ccVyjyTL.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/tfasty36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tfy.o drop_tfz.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o url_subs.o mrandom.o -lm -lpthread compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 1 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch] 250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn, | ^ initfa.c:2036:1: note: type mismatch in parameter 6 2036 | last_calc( | ^ initfa.c:2036:1: note: ‘last_calc’ was previously declared here mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 4 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used /usr/bin/ld: /tmp/cc96XDvG.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/tfasts36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tfs.o drop_tfs.o calcons_tfs.o scaleswts.o last_tat.o tatstats_fs.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o mrandom.o url_subs.o -lm -lpthread compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 1 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch] 236 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: type mismatch in parameter 7 164 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: ‘process_hist’ was previously declared here scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 4 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used /usr/bin/ld: /tmp/ccwNlHUc.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/fastm36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fm.o drop_fm.o calcons_fm.o scaleswts.o last_tat.o tatstats_fm.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o mrandom.o url_subs.o -lm -lpthread compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 1 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch] 236 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: type mismatch in parameter 7 164 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: ‘process_hist’ was previously declared here scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 4 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used /usr/bin/ld: /tmp/cc10cGul.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/tfastm36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_s.o htime.o apam.o doinit.o init_tfm.o drop_tfm.o calcons_tfm.o scaleswts.o tatstats_fm.o last_tat.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o mrandom.o url_subs.o -lm -lpthread compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 1 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch] 236 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: type mismatch in parameter 7 164 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: ‘process_hist’ was previously declared here scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 4 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowalign2.c:85:1: warning: type of ‘buf_align_seq’ does not match original declaration [-Wlto-type-mismatch] 85 | buf_align_seq(unsigned char **aa0, int n0, | ^ compacc2e.c:3575:1: note: type mismatch in parameter 8 3575 | buf_align_seq(unsigned char **aa0, int n0, | ^ compacc2e.c:3575:1: note: ‘buf_align_seq’ was previously declared here comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used /usr/bin/ld: /tmp/ccjYCrzQ.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/fastf36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_ff.o drop_ff2.o calcons_ff.o scaleswtf.o last_tat.o tatstats_ff.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o mrandom.o url_subs.o -lm -lpthread compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 1 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch] 236 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: type mismatch in parameter 7 164 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: ‘process_hist’ was previously declared here scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 4 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used /usr/bin/ld: /tmp/ccU804iY.ltrans0.ltrans.o: in function `main': /usr/bin/ld: /tmp/cc4NM20T.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/tfastf36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tf.o drop_tff.o calcons_tff.o scaleswtf.o last_tat.o tatstats_ff.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o mrandom.o url_subs.o -lm -lpthread cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/glsearch36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_lnw_sse.o droplnw_sse.o glocal_sse2.o gwm_align.o calcons_sw.o scale_sn.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm -lpthread compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 1 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch] 236 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: type mismatch in parameter 7 164 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: ‘process_hist’ was previously declared here scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 4 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 1 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch] 250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn, | ^ initfa.c:2036:1: note: type mismatch in parameter 6 2036 | last_calc( | ^ initfa.c:2036:1: note: ‘last_calc’ was previously declared here mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 4 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used /usr/bin/ld: /tmp/cc7CawYf.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' cc -Wl,-Bsymbolic-functions -flto=auto -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/ggsearch36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_gnw_sse.o dropgnw_sse.o global_sse2.o gwm_align.o calcons_sw.o scale_sn.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm -lpthread compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 1 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch] 250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn, | ^ initfa.c:2036:1: note: type mismatch in parameter 6 2036 | last_calc( | ^ initfa.c:2036:1: note: ‘last_calc’ was previously declared here mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 4 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type ‘long int’ should match type ‘int’ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used /usr/bin/ld: /tmp/cc3XiHO3.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' initfa.c: In function ‘get_lambda.constprop’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^ /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^ initfa.c: In function ‘get_lambda.constprop’: initfa.c:2224:24: warning: argument 1 value ‘18446744071709551617’ exceeds maximum object size 9223372036854775807 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^ /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^ /usr/bin/ld: /tmp/ccCgZKqU.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' /usr/bin/ld: /tmp/cczPvPYZ.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' /usr/bin/ld: /tmp/ccRrQZAY.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' make[2]: Leaving directory '/<>/src' # convoluted, but necessary to allow cross builds make[1]: Leaving directory '/<>' debian/rules override_dh_auto_test make[1]: Entering directory '/<>' cd test ; ./test2G.sh && ./test.sh && ../bin/fasta36 -q ../seq/mgstm1.aa ../seq/prot_test.lseg STARTING FASTA36 Tue Oct 19 19:10:01 UTC 2021 on lcy01-amd64-019 Linux lcy01-amd64-019 4.15.0-159-generic #167-Ubuntu SMP Tue Sep 21 08:55:05 UTC 2021 x86_64 x86_64 x86_64 GNU/Linux starting prss36(ssearch/fastx) Tue Oct 19 19:10:01 UTC 2021 done starting lalign36 Tue Oct 19 19:10:01 UTC 2021 FINISHED Tue Oct 19 19:10:19 UTC 2021 STARTING FASTA36 Tue Oct 19 19:10:19 UTC 2021 on lcy01-amd64-019 Linux lcy01-amd64-019 4.15.0-159-generic #167-Ubuntu SMP Tue Sep 21 08:55:05 UTC 2021 x86_64 x86_64 x86_64 GNU/Linux starting prss36(ssearch/fastx) Tue Oct 19 19:10:19 UTC 2021 done starting lalign36 Tue Oct 19 19:10:19 UTC 2021 FINISHED Tue Oct 19 19:10:38 UTC 2021 # ../bin/fasta36 -q ../seq/mgstm1.aa ../seq/prot_test.lseg FASTA searches a protein or DNA sequence data bank version 36.3.8h Aug, 2019 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: ../seq/mgstm1.aa 1>>>sp|P10649|GSTM1_MOUSE Glutathione S-transferase Mu 1; GST 1-1; GST class-mu 1; Glutathione S-transferase GT8.7; pmGT10 - 218 aa Library: ../seq/prot_test.lseg 2267 residues in 12 sequences Statistics: (shuffled [486]) MLE statistics: Lambda= 0.1709; K=0.006184 statistics sampled from 4 (4) to 485 sequences Algorithm: FASTA (3.8 Nov 2011) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.667), E-opt: 0.2 (0.333), width: 16 Scan time: 0.010 The best scores are: opt bits E(12) sp|P09488|GSTM1_HUMAN Glutathione S-transferase Mu ( 218) 1242 315.3 7.1e-90 sp|P00502|GSTA1_RAT Glutathione S-transferase alph ( 222) 237 67.5 2.7e-15 sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Ho ( 142) 51 21.7 0.11 sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinas ( 351) 43 19.7 1 sp|P14960|RBS_GUITH Ribulose bisphosphate carboxyl ( 139) 36 18.0 1.3 sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG ( 108) 31 16.7 2.3 sp|P99998|CYC_PANTR Cytochrome c OS=Pan troglodyte ( 105) 30 16.5 2.6 sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle ( 160) 30 16.5 3.8 sp|P03435|HEMA_I75A3 Hemagglutinin OS=Influenza A ( 567) 37 18.2 4 sp|P60615|NXL1A_BUNMU Alpha-bungarotoxin isoform A ( 95) 26 15.5 4.3 sp|P00193|FER_PEPAS Ferredoxin OS=Peptostreptococc ( 54) 22 14.5 4.7 sp|P01834|IGKC_HUMAN Ig kappa chain C region OS=Ho ( 106) 23 14.8 6.7 >>sp|P09488|GSTM1_HUMAN Glutathione S-transferase Mu 1 O (218 aa) initn: 1242 init1: 1242 opt: 1242 Z-score: 1665.4 bits: 315.3 E(12): 7.1e-90 Smith-Waterman score: 1242; 78.0% identity (95.4% similar) in 218 aa overlap (1-218:1-218) 10 20 30 40 50 60 sp|P10 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNL ::::::::..:::.: ::.:::::::::.::.::::::::.::::::::::::::::::: sp|P09 MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL 10 20 30 40 50 60 70 80 90 100 110 120 sp|P10 PYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDF ::::::.:::::::::: :.::::.: ::::::.::.::.:::.::..::: :.::::.: sp|P09 PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF 70 80 90 100 110 120 130 140 150 160 170 180 sp|P10 EKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPN :: ::..:. .:::.:::::::::::::::.:.:.::::.::.:: .:.::::::::::: sp|P09 EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN 130 140 150 160 170 180 190 200 210 sp|P10 LRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK :.::..:::::.::::::::::.. :.::::: :.:: sp|P09 LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 190 200 210 >>sp|P00502|GSTA1_RAT Glutathione S-transferase alpha-1 (222 aa) initn: 204 init1: 73 opt: 237 Z-score: 326.3 bits: 67.5 E(12): 2.7e-15 Smith-Waterman score: 237; 27.4% identity (57.0% similar) in 223 aa overlap (4-218:6-218) 10 20 30 40 50 sp|P10 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKL--GLD .: :.:.:: . :: :: . .::: : .: ::.: .: sp|P00 MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEK---------FIQSPEDLEKLKKDGNLM 10 20 30 40 50 60 70 80 90 100 110 sp|P10 FPNLPYL-IDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMD-TRMQLIML : ..:.. ::: :..:. ::: :.: :. : :. .:: :. . ..: :.: . .. sp|P00 FDQVPMVEIDG-MKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLV 60 70 80 90 100 110 120 130 140 150 160 170 sp|P10 CYNPDFEKQKPEFLK--TIPEKMKLYSEFLGK--RPWFAGDKVTYVDFLAYDILDQYRMF :: .. : . : : . . . . : . . ...:...: ::. ..: . : sp|P00 ICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEF 120 130 140 150 160 170 180 190 200 210 sp|P10 EPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK . . : .:: :. : .:. .: ... ... . :. .:. . . : sp|P00 DASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF 180 190 200 210 220 >>sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo s (142 aa) initn: 40 init1: 40 opt: 51 Z-score: 82.0 bits: 21.7 E(12): 0.11 Smith-Waterman score: 51; 25.6% identity (69.2% similar) in 39 aa overlap (177-214:36-73) 150 160 170 180 190 200 sp|P10 WFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKS-SRYIA .::. . .. .:. :.. :: .:. .. .: sp|P69 ADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFD-LSHGSAQVKGHGKKVA 10 20 30 40 50 60 210 sp|P10 TPIFSKMAHWSNK . . .:: sp|P69 DALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHA 70 80 90 100 110 120 >>sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase ca (351 aa) initn: 43 init1: 43 opt: 43 Z-score: 64.3 bits: 19.7 E(12): 1 Smith-Waterman score: 54; 23.6% identity (47.2% similar) in 72 aa overlap (137-206:229-300) 110 120 130 140 150 160 sp|P10 TRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQ .: : :.:: . . . .. . sp|P00 LCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRF 200 210 220 230 240 250 170 180 190 200 210 sp|P10 YRMFEPKCLDAFPNLR--DFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK : : . :: :. :: .::. .:. ...:: sp|P00 PSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPK 260 270 280 290 300 310 sp|P00 FKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF 320 330 340 350 >>sp|P14960|RBS_GUITH Ribulose bisphosphate carboxylase (139 aa) initn: 56 init1: 36 opt: 36 Z-score: 62.2 bits: 18.0 E(12): 1.3 Smith-Waterman score: 36; 57.1% identity (85.7% similar) in 7 aa overlap (7-13:47-53) 10 20 30 sp|P10 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMG ::.. :: sp|P14 EQIVKQIQYAISKNWALNVEWTDDPHPRNAYWDLWGLPLFGIKDPAAVMFEINACRKAKP 20 30 40 50 60 70 40 50 60 70 80 90 sp|P10 DAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIR sp|P14 ACYVKVNAFDNSRGVESCCLSFIVQRPTSNEPGFQLIRSEVDSRNIRYTIQSYASTRPEG 80 90 100 110 120 130 >>sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS= (108 aa) initn: 31 init1: 31 opt: 31 Z-score: 57.5 bits: 16.7 E(12): 2.3 Smith-Waterman score: 33; 36.0% identity (54.0% similar) in 50 aa overlap (150-190:16-64) 120 130 140 150 160 170 sp|P10 FEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDI---LDQYRMFE---PK ::.:: . . :: :. :.. :: sp|P01 DIQMTQSPSSLSASVGDRVTITCQASQDINHYLNWYQQGPKKAPK 10 20 30 40 180 190 200 210 sp|P10 CL--DAFPNLRDFL-ARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK : :: ::. . .:: : sp|P01 ILIYDA-SNLETGVPSRFSGSGFGTDFTFTISGLQPEDIATYYCQQYDTLPRTFGQGTKL 50 60 70 80 90 100 >>sp|P99998|CYC_PANTR Cytochrome c OS=Pan troglodytes GN (105 aa) initn: 30 init1: 30 opt: 30 Z-score: 56.4 bits: 16.5 E(12): 2.6 Smith-Waterman score: 36; 26.5% identity (54.4% similar) in 68 aa overlap (129-193:28-88) 100 110 120 130 140 150 sp|P10 IVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWF---AGDKVTY :: :. :... :. : . :..: sp|P99 MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKG 10 20 30 40 50 160 170 180 190 200 210 sp|P10 VDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHW . . . : : .: . .:: .:. . . : :.:: sp|P99 I-IWGEDTLMEY-LENPK--KYIPGTKMI---FVGIKKKEERADLIAYLKKATNE 60 70 80 90 100 sp|P10 SNK >>sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle OS=H (160 aa) initn: 30 init1: 30 opt: 30 Z-score: 53.1 bits: 16.5 E(12): 3.8 Smith-Waterman score: 41; 25.9% identity (63.0% similar) in 54 aa overlap (44-92:13-62) 20 30 40 50 60 70 sp|P10 THPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKIT-- :. . .:: ..:. . ::. :. sp|P02 MTDQQAEARSYLSEEMIAEFKAAFDM----FDADGGGDISVK 10 20 30 80 90 100 110 120 sp|P10 QSNAILRYLAR---KHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFL . ....:.:.. :..::. :: sp|P02 ELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAE 40 50 60 70 80 90 >>sp|P03435|HEMA_I75A3 Hemagglutinin OS=Influenza A viru (567 aa) initn: 37 init1: 37 opt: 37 Z-score: 52.6 bits: 18.2 E(12): 4 Smith-Waterman score: 50; 28.2% identity (64.1% similar) in 39 aa overlap (74-111:399-437) 50 60 70 80 90 100 sp|P10 SQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARK-HHLDGETEEERIRADIVEN : ... .: :... : : . : . .:. sp|P03 GFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEK 370 380 390 400 410 420 110 120 130 140 150 160 sp|P10 QVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYD : ::...: sp|P03 YVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEDMGNGCFKIYH 430 440 450 460 470 480 >>sp|P60615|NXL1A_BUNMU Alpha-bungarotoxin isoform A31 O (95 aa) initn: 26 init1: 26 opt: 26 Z-score: 51.9 bits: 15.5 E(12): 4.3 Smith-Waterman score: 30; 54.5% identity (63.6% similar) in 11 aa overlap (115-125:86-94) 90 100 110 120 130 140 sp|P10 HLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGK : :: ::.: sp|P60 SRGKVVELGCAATCPSKKPYEEVTCCSTDKC-NPH-PKQRPG 60 70 80 90 150 160 170 180 190 200 sp|P10 RPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYI >>sp|P00193|FER_PEPAS Ferredoxin OS=Peptostreptococcus a (54 aa) initn: 22 init1: 22 opt: 22 Z-score: 50.9 bits: 14.5 E(12): 4.7 Smith-Waterman score: 25; 50.0% identity (100.0% similar) in 4 aa overlap (171-174:15-18) 150 160 170 180 190 200 sp|P10 FLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKS .:.: sp|P00 AYVINDSCIACGACKPECPVNIQQGSIYAIDADSCIDCGSCASV 10 20 30 40 210 sp|P10 SRYIATPIFSKMAHWSNK sp|P00 CPVGAPNPED 50 >>sp|P01834|IGKC_HUMAN Ig kappa chain C region OS=Homo s (106 aa) initn: 23 init1: 23 opt: 23 Z-score: 47.0 bits: 14.8 E(12): 6.7 Smith-Waterman score: 35; 18.3% identity (53.5% similar) in 71 aa overlap (58-124:12-82) 30 40 50 60 70 80 sp|P10 YDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKIT--QSNAILRYLARKHH :. : .:. ... .: : . . sp|P01 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWK 10 20 30 40 90 100 110 120 130 140 sp|P10 LDGETEEERIRADIVENQVMDTRMQL--IMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLG .:. . . ...:.. :. ..: . . :.::.: sp|P01 VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF 50 60 70 80 90 100 150 160 170 180 190 200 sp|P10 KRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRY sp|P01 NRGEC 218 residues in 1 query sequences 2267 residues in 12 library sequences Tcomplib [36.3.8h Aug, 2019] (4 proc in memory [0G]) start: Tue Oct 19 19:10:38 2021 done: Tue Oct 19 19:10:38 2021 Total Scan time: 0.010 Total Display time: 0.010 Function used was FASTA [36.3.8h Aug, 2019] make[1]: Leaving directory '/<>' create-stamp debian/debhelper-build-stamp dh_testroot -O--sourcedirectory=src dh_prep -O--sourcedirectory=src dh_auto_install -O--sourcedirectory=src dh_install -O--sourcedirectory=src dh_installdocs -O--sourcedirectory=src dh_installchangelogs -O--sourcedirectory=src dh_installexamples -O--sourcedirectory=src dh_installman -O--sourcedirectory=src dh_installsystemduser -O--sourcedirectory=src dh_perl -O--sourcedirectory=src dh_link -O--sourcedirectory=src dh_strip_nondeterminism -O--sourcedirectory=src debian/rules override_dh_compress make[1]: Entering directory '/<>' dh_compress --exclude=.pdf make[1]: Leaving directory '/<>' dh_fixperms -O--sourcedirectory=src dh_missing -O--sourcedirectory=src dh_dwz -a -O--sourcedirectory=src dh_strip -a -O--sourcedirectory=src debugedit: debian/fasta3/usr/bin/tfastx36: Unknown DWARF DW_FORM_0x1f20 d25887c3baa6f1f498d28234f4101a68f67bfdbe debugedit: debian/fasta3/usr/bin/fasta36: Unknown DWARF DW_FORM_0x1f20 bdc4428109958dc285a05b94ac93a5393bf103bb debugedit: debian/fasta3/usr/bin/lalign36: Unknown DWARF DW_FORM_0x1f21 bb3c4967edde43926fea54833d469599770c9ded debugedit: debian/fasta3/usr/bin/ssearch36: Unknown DWARF DW_FORM_0x1f20 7827d3fddd9a2e9267e31fd5a01bd3d7c3c34bcf debugedit: debian/fasta3/usr/bin/tfastf36: Unknown DWARF DW_FORM_0x1f21 dba2c5fd57f134cbe5b660ca0fb1eb9ea2e143da debugedit: debian/fasta3/usr/bin/fastx36: Unknown DWARF DW_FORM_0x1f20 c3c37347509cc9d8d1d8f59ae0d4bcf360bc0aef debugedit: debian/fasta3/usr/bin/fasty36: Unknown DWARF DW_FORM_0x1f20 fefd0d81f43acdb75205e503b03355dcd0b393e5 debugedit: debian/fasta3/usr/bin/fasts36: Unknown DWARF DW_FORM_0x1f21 84952970bb59156776ff87756595a40c9858a36d debugedit: debian/fasta3/usr/bin/tfastm36: Unknown DWARF DW_FORM_0x1f21 3d5734354987ac67568e69f60caa420cda0a7fe8 debugedit: debian/fasta3/usr/bin/tfasty36: Unknown DWARF DW_FORM_0x1f20 6ff632d768f9033281586fb5f0ed00202b792839 debugedit: debian/fasta3/usr/bin/fastm36: Unknown DWARF DW_FORM_0x1f21 447d202d1bac4215f4aa9e9e1c97e08fb97a7d7b debugedit: debian/fasta3/usr/bin/tfasts36: Unknown DWARF DW_FORM_0x1f21 ba9da547ca8921320671ce2ad02eb90901cb037c debugedit: debian/fasta3/usr/bin/ggsearch36: Unknown DWARF DW_FORM_0x1f21 0926ead7b3105a96bb718524a006b898dc2ae581 debugedit: debian/fasta3/usr/bin/glsearch36: Unknown DWARF DW_FORM_0x1f20 36e4534a4ce08cbff3c6396b1ea15fd8d15e9d7d debugedit: debian/fasta3/usr/bin/fastf36: Unknown DWARF DW_FORM_0x1f21 3ac7f13b3e33f7a7a5bcb9e771d5f6298a8e9add debugedit: debian/fasta3/usr/bin/map_db: Unknown DWARF DW_FORM_0x1f20 722f9fb6c608fa95ae4f3a643be1ab496e7f0547 dh_makeshlibs -a -O--sourcedirectory=src dh_shlibdeps -a -O--sourcedirectory=src dh_installdeb -O--sourcedirectory=src dh_gencontrol -O--sourcedirectory=src dh_md5sums -O--sourcedirectory=src dh_builddeb -O--sourcedirectory=src /usr/bin/which: this version of `which' is deprecated; use `command -v' in scripts instead. /usr/bin/which: this version of `which' is deprecated; use `command -v' in scripts instead. /usr/bin/which: this version of `which' is deprecated; use `command -v' in scripts instead. /usr/bin/which: this version of `which' is deprecated; use `command -v' in scripts instead. /usr/bin/which: this version of `which' is deprecated; use `command -v' in scripts instead. /usr/bin/which: this version of `which' is deprecated; use `command -v' in scripts instead. INFO: pkgstriptranslations version 148 INFO: pkgstriptranslations version 148 INFO: pkgstriptranslations version 148 pkgstriptranslations: processing fasta3 (in debian/fasta3); do_strip: , oemstrip: pkgstriptranslations: processing fasta3-doc (in debian/fasta3-doc); do_strip: , oemstrip: pkgstriptranslations: processing fasta3-dbgsym (in debian/.debhelper/fasta3/dbgsym-root); do_strip: , oemstrip: /usr/bin/which: this version of `which' is deprecated; use `command -v' in scripts instead. /usr/bin/which: this version of `which' is deprecated; use `command -v' in scripts instead. pkgmaintainermangler: Maintainer field overridden to "Ubuntu Developers " pkgmaintainermangler: Maintainer field overridden to "Ubuntu Developers " /usr/bin/which: this version of `which' is deprecated; use `command -v' in scripts instead. /usr/bin/which: this version of `which' is deprecated; use `command -v' in scripts instead. pkgstripfiles: processing control file: debian/fasta3/DEBIAN/control, package fasta3, directory debian/fasta3 pkgstripfiles: processing control file: debian/.debhelper/fasta3/dbgsym-root/DEBIAN/control, package fasta3-dbgsym, directory debian/.debhelper/fasta3/dbgsym-root dpkg-deb: building package 'fasta3-dbgsym' in 'debian/.debhelper/scratch-space/build-fasta3/fasta3-dbgsym_36.3.8h.2020-02-11-4_amd64.deb'. pkgstripfiles: Running PNG optimization (using 4 cpus) for package fasta3 ... pkgstripfiles: No PNG files. dpkg-deb: building package 'fasta3' in '../fasta3_36.3.8h.2020-02-11-4_amd64.deb'. Renaming fasta3-dbgsym_36.3.8h.2020-02-11-4_amd64.deb to fasta3-dbgsym_36.3.8h.2020-02-11-4_amd64.ddeb /usr/bin/which: this version of `which' is deprecated; use `command -v' in scripts instead. pkgmaintainermangler: Maintainer field overridden to "Ubuntu Developers " /usr/bin/which: this version of `which' is deprecated; use `command -v' in scripts instead. pkgstripfiles: processing control file: debian/fasta3-doc/DEBIAN/control, package fasta3-doc, directory debian/fasta3-doc pkgstripfiles: Disabled PNG optimization for -doc package fasta3-doc (to save build time) dpkg-deb: building package 'fasta3-doc' in '../fasta3-doc_36.3.8h.2020-02-11-4_all.deb'. dpkg-genbuildinfo --build=binary dpkg-genchanges --build=binary -mLaunchpad Build Daemon >../fasta3_36.3.8h.2020-02-11-4_amd64.changes dpkg-genchanges: info: binary-only upload (no source code included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) -------------------------------------------------------------------------------- Build finished at 2021-10-19T19:10:52Z Finished -------- I: Built successfully +------------------------------------------------------------------------------+ | Post Build Chroot | +------------------------------------------------------------------------------+ +------------------------------------------------------------------------------+ | Changes | +------------------------------------------------------------------------------+ fasta3_36.3.8h.2020-02-11-4_amd64.changes: ------------------------------------------ Format: 1.8 Date: Thu, 09 Sep 2021 09:29:56 +0200 Source: fasta3 Binary: fasta3 fasta3-doc Built-For-Profiles: noudeb Architecture: amd64 all Version: 36.3.8h.2020-02-11-4 Distribution: jammy-proposed Urgency: medium Maintainer: Launchpad Build Daemon Changed-By: Andreas Tille Description: fasta3 - tools for searching collections of biological sequences fasta3-doc - user guide for FASTA tools Changes: fasta3 (36.3.8h.2020-02-11-4) unstable; urgency=medium . [ Michael R. Crusoe ] * Team upload. * Install scripts, matrics, and misc scripts in /usr/share/fasta3/{scripts,data,misc} * Install all the example SQL scripts and data . [ Steffen Moeller ] * Fix watchfile to detect new versions on github (routine-update) . [ Andreas Tille ] * Standards-Version: 4.6.0 (routine-update) * debhelper-compat 13 (routine-update) * Depends: python3 Checksums-Sha1: 90b36f81ab3856fd93d4841153b7c4fbf2cec448 5944476 fasta3-dbgsym_36.3.8h.2020-02-11-4_amd64.ddeb 185a7cd6704e503316694be1d98a4aab94ba518a 268790 fasta3-doc_36.3.8h.2020-02-11-4_all.deb 528d1933313b236d7a13a53a4a05b70f2e72358b 6132 fasta3_36.3.8h.2020-02-11-4_amd64.buildinfo 25009bc558749be63564e3db41c48a0b2f7ca56e 936030 fasta3_36.3.8h.2020-02-11-4_amd64.deb Checksums-Sha256: 10b968424700b76cb3fa1ac25eb0750663a766f33ef1e623136bb1e50642df2e 5944476 fasta3-dbgsym_36.3.8h.2020-02-11-4_amd64.ddeb c9b54f4fc355b68d0631cbb60964f8b1d403d8fa98cabbbf56dfcbd12879c20e 268790 fasta3-doc_36.3.8h.2020-02-11-4_all.deb 470fb741c594a291b0f9d0872c8b87ec238d1eceb36b12a1582fd1bf8eb8a63f 6132 fasta3_36.3.8h.2020-02-11-4_amd64.buildinfo f10e19859b61ef557e44594bf0dc769d15d6d54f93782b1bc3e642775feb066b 936030 fasta3_36.3.8h.2020-02-11-4_amd64.deb Files: 9eff0166f811bba2f90176029215207e 5944476 debug optional fasta3-dbgsym_36.3.8h.2020-02-11-4_amd64.ddeb b0f56314e0d11e461717ffc2ad8f62f9 268790 doc optional fasta3-doc_36.3.8h.2020-02-11-4_all.deb 49df7e5c7582aab1ffab7e8ee7c6a117 6132 science optional fasta3_36.3.8h.2020-02-11-4_amd64.buildinfo 951a157ecbed780184eac4b4a4f28e10 936030 science optional fasta3_36.3.8h.2020-02-11-4_amd64.deb +------------------------------------------------------------------------------+ | Buildinfo | +------------------------------------------------------------------------------+ Format: 1.0 Source: fasta3 Binary: fasta3 fasta3-dbgsym fasta3-doc Architecture: all amd64 Version: 36.3.8h.2020-02-11-4 Checksums-Md5: 9eff0166f811bba2f90176029215207e 5944476 fasta3-dbgsym_36.3.8h.2020-02-11-4_amd64.ddeb b0f56314e0d11e461717ffc2ad8f62f9 268790 fasta3-doc_36.3.8h.2020-02-11-4_all.deb 951a157ecbed780184eac4b4a4f28e10 936030 fasta3_36.3.8h.2020-02-11-4_amd64.deb Checksums-Sha1: 90b36f81ab3856fd93d4841153b7c4fbf2cec448 5944476 fasta3-dbgsym_36.3.8h.2020-02-11-4_amd64.ddeb 185a7cd6704e503316694be1d98a4aab94ba518a 268790 fasta3-doc_36.3.8h.2020-02-11-4_all.deb 25009bc558749be63564e3db41c48a0b2f7ca56e 936030 fasta3_36.3.8h.2020-02-11-4_amd64.deb Checksums-Sha256: 10b968424700b76cb3fa1ac25eb0750663a766f33ef1e623136bb1e50642df2e 5944476 fasta3-dbgsym_36.3.8h.2020-02-11-4_amd64.ddeb c9b54f4fc355b68d0631cbb60964f8b1d403d8fa98cabbbf56dfcbd12879c20e 268790 fasta3-doc_36.3.8h.2020-02-11-4_all.deb f10e19859b61ef557e44594bf0dc769d15d6d54f93782b1bc3e642775feb066b 936030 fasta3_36.3.8h.2020-02-11-4_amd64.deb Build-Origin: Ubuntu Build-Architecture: amd64 Build-Date: Tue, 19 Oct 2021 19:10:51 +0000 Build-Path: /<> Build-Tainted-By: merged-usr-via-aliased-dirs usr-local-has-programs Installed-Build-Depends: autoconf (= 2.71-2), automake (= 1:1.16.4-2), autopoint (= 0.21-4ubuntu3), autotools-dev (= 20180224.1+nmu1), base-files (= 12ubuntu1), base-passwd (= 3.5.52), bash (= 5.1-3ubuntu2), binutils (= 2.37-7ubuntu1), binutils-common (= 2.37-7ubuntu1), binutils-x86-64-linux-gnu (= 2.37-7ubuntu1), bsdextrautils (= 2.36.1-8ubuntu2), bsdutils (= 1:2.36.1-8ubuntu2), build-essential (= 12.9ubuntu2), bzip2 (= 1.0.8-4ubuntu4), coreutils (= 8.32-4ubuntu3), cpp (= 4:11.2.0-1ubuntu1), cpp-11 (= 11.2.0-7ubuntu2), dash (= 0.5.11+git20210120+802ebd4-1build1), debconf (= 1.5.77), debhelper (= 13.3.4ubuntu2), debianutils (= 5.5-1), debugedit (= 1:5.0-0ubuntu2), dh-autoreconf (= 20), dh-strip-nondeterminism (= 1.12.0-1), diffutils (= 1:3.8-0ubuntu1), dpkg (= 1.20.9ubuntu2), dpkg-dev (= 1.20.9ubuntu2), dwz (= 0.14-1build1), file (= 1:5.39-3build1), findutils (= 4.8.0-1ubuntu2), g++ (= 4:11.2.0-1ubuntu1), g++-11 (= 11.2.0-7ubuntu2), gcc (= 4:11.2.0-1ubuntu1), gcc-11 (= 11.2.0-7ubuntu2), gcc-11-base (= 11.2.0-7ubuntu2), gettext (= 0.21-4ubuntu3), gettext-base (= 0.21-4ubuntu3), grep (= 3.7-0ubuntu1), groff-base (= 1.22.4-7), gzip (= 1.10-4ubuntu2), hostname (= 3.23ubuntu1), init-system-helpers (= 1.60build1), intltool-debian (= 0.35.0+20060710.5), libacl1 (= 2.2.53-10ubuntu2), libarchive-zip-perl (= 1.68-1), libasan6 (= 11.2.0-7ubuntu2), libatomic1 (= 11.2.0-7ubuntu2), libattr1 (= 1:2.5.1-1), libaudit-common (= 1:3.0-2ubuntu3), libaudit1 (= 1:3.0-2ubuntu3), libbinutils (= 2.37-7ubuntu1), libblkid1 (= 2.36.1-8ubuntu2), libbz2-1.0 (= 1.0.8-4ubuntu4), libc-bin (= 2.34-0ubuntu3), libc-dev-bin (= 2.34-0ubuntu3), libc6 (= 2.34-0ubuntu3), libc6-dev (= 2.34-0ubuntu3), libcap-ng0 (= 0.7.9-2.2build2), libcap2 (= 1:2.44-1build2), libcc1-0 (= 11.2.0-7ubuntu2), libcom-err2 (= 1.46.3-1ubuntu3), libcrypt-dev (= 1:4.4.18-4ubuntu2), libcrypt1 (= 1:4.4.18-4ubuntu2), libctf-nobfd0 (= 2.37-7ubuntu1), libctf0 (= 2.37-7ubuntu1), libdb5.3 (= 5.3.28+dfsg1-0.8ubuntu2), libdebconfclient0 (= 0.256ubuntu4), libdebhelper-perl (= 13.3.4ubuntu2), libdpkg-perl (= 1.20.9ubuntu2), libdw1 (= 0.185-2), libelf1 (= 0.185-2), libfile-stripnondeterminism-perl (= 1.12.0-1), libgcc-11-dev (= 11.2.0-7ubuntu2), libgcc-s1 (= 11.2.0-7ubuntu2), libgcrypt20 (= 1.8.7-5ubuntu2), libgdbm-compat4 (= 1.21-1), libgdbm6 (= 1.21-1), libgmp10 (= 2:6.2.1+dfsg-1ubuntu3), libgomp1 (= 11.2.0-7ubuntu2), libgpg-error0 (= 1.42-3), libgssapi-krb5-2 (= 1.18.3-7), libicu67 (= 67.1-7ubuntu1), libisl23 (= 0.24-2), libitm1 (= 11.2.0-7ubuntu2), libk5crypto3 (= 1.18.3-7), libkeyutils1 (= 1.6.1-2ubuntu2), libkrb5-3 (= 1.18.3-7), libkrb5support0 (= 1.18.3-7), liblsan0 (= 11.2.0-7ubuntu2), liblz4-1 (= 1.9.3-2build1), liblzma5 (= 5.2.5-2build1), libmagic-mgc (= 1:5.39-3build1), libmagic1 (= 1:5.39-3build1), libmount1 (= 2.36.1-8ubuntu2), libmpc3 (= 1.2.1-1), libmpfr6 (= 4.1.0-3build2), libnsl-dev (= 1.3.0-2build1), libnsl2 (= 1.3.0-2build1), libpam-modules (= 1.3.1-5ubuntu11), libpam-modules-bin (= 1.3.1-5ubuntu11), libpam-runtime (= 1.3.1-5ubuntu11), libpam0g (= 1.3.1-5ubuntu11), libpcre2-8-0 (= 10.37-0ubuntu2), libpcre3 (= 2:8.39-13build4), libperl5.32 (= 5.32.1-3ubuntu3), libpipeline1 (= 1.5.3-1build1), libquadmath0 (= 11.2.0-7ubuntu2), libseccomp2 (= 2.5.1-1ubuntu2), libselinux1 (= 3.1-3build3), libsigsegv2 (= 2.13-1ubuntu2), libsimde-dev (= 0.7.2-4), libsmartcols1 (= 2.36.1-8ubuntu2), libssl1.1 (= 1.1.1l-1ubuntu1), libstdc++-11-dev (= 11.2.0-7ubuntu2), libstdc++6 (= 11.2.0-7ubuntu2), libsub-override-perl (= 0.09-2), libsystemd0 (= 248.3-1ubuntu8), libtinfo6 (= 6.2+20210905-1), libtirpc-common (= 1.3.2-2), libtirpc-dev (= 1.3.2-2), libtirpc3 (= 1.3.2-2), libtool (= 2.4.6-15build1), libtsan0 (= 11.2.0-7ubuntu2), libubsan1 (= 11.2.0-7ubuntu2), libuchardet0 (= 0.0.7-1build1), libudev1 (= 248.3-1ubuntu8), libunistring2 (= 0.9.10-6), libuuid1 (= 2.36.1-8ubuntu2), libxml2 (= 2.9.12+dfsg-5), libzstd1 (= 1.4.8+dfsg-3), linux-libc-dev (= 5.13.0-19.19), login (= 1:4.8.1-1ubuntu9), lsb-base (= 11.1.0ubuntu3), lto-disabled-list (= 16), m4 (= 1.4.18-5ubuntu1), make (= 4.3-4ubuntu2), man-db (= 2.9.4-2build1), mawk (= 1.3.4.20200120-2build1), ncurses-base (= 6.2+20210905-1), ncurses-bin (= 6.2+20210905-1), patch (= 2.7.6-7build1), perl (= 5.32.1-3ubuntu3), perl-base (= 5.32.1-3ubuntu3), perl-modules-5.32 (= 5.32.1-3ubuntu3), po-debconf (= 1.0.21+nmu1), rpcsvc-proto (= 1.4.2-0ubuntu5), sed (= 4.7-1ubuntu2), sensible-utils (= 0.0.17), sysvinit-utils (= 2.96-7ubuntu2), tar (= 1.34+dfsg-1build2), util-linux (= 2.36.1-8ubuntu2), xz-utils (= 5.2.5-2build1), zlib1g (= 1:1.2.11.dfsg-2ubuntu7) Environment: DEB_BUILD_OPTIONS="parallel=4" DEB_BUILD_PROFILES="noudeb" LANG="C.UTF-8" LC_ALL="C.UTF-8" SOURCE_DATE_EPOCH="1631172596" +------------------------------------------------------------------------------+ | Package contents | +------------------------------------------------------------------------------+ fasta3-doc_36.3.8h.2020-02-11-4_all.deb --------------------------------------- new Debian package, version 2.0. size 268790 bytes: control archive=910 bytes. 1050 bytes, 25 lines control 279 bytes, 4 lines md5sums Package: fasta3-doc Source: fasta3 Version: 36.3.8h.2020-02-11-4 Architecture: all Maintainer: Ubuntu Developers Original-Maintainer: Debian Med Packaging Team Installed-Size: 277 Breaks: fasta3 (<< 36.3.8h) Replaces: fasta3 (<< 36.3.8h) Section: doc Priority: optional Multi-Arch: foreign Homepage: https://fasta.bioch.virginia.edu Description: user guide for FASTA tools The FASTA programs find regions of local or global similarity between Protein or DNA sequences, either by searching Protein or DNA databases, or by identifying local duplications within a sequence. Other programs provide information on the statistical significance of an alignment. Like BLAST, FASTA can be used to infer functional and evolutionary relationships between sequences as well as help identify members of gene families. . The use of the package's many binaries and the equally representated conceptual approaches towards sequence analyses are summarised in this PDF. drwxr-xr-x root/root 0 2021-09-09 07:29 ./ drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/ drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/ drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/doc-base/ -rw-r--r-- root/root 678 2021-09-09 07:29 ./usr/share/doc-base/fasta3 drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/doc/ drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/doc/fasta3-doc/ -rw-r--r-- root/root 1274 2021-09-09 07:29 ./usr/share/doc/fasta3-doc/changelog.Debian.gz -rw-r--r-- root/root 2874 2021-09-09 07:29 ./usr/share/doc/fasta3-doc/copyright drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/doc/fasta3/ -rw-r--r-- root/root 268476 2020-02-10 19:14 ./usr/share/doc/fasta3/fasta_guide.pdf fasta3_36.3.8h.2020-02-11-4_amd64.deb ------------------------------------- new Debian package, version 2.0. size 936030 bytes: control archive=5868 bytes. 2231 bytes, 54 lines control 13535 bytes, 183 lines md5sums Package: fasta3 Version: 36.3.8h.2020-02-11-4 Architecture: amd64 Maintainer: Ubuntu Developers Original-Maintainer: Debian Med Packaging Team Installed-Size: 6455 Depends: libc6 (>= 2.34), python3 Suggests: perl:any, libdbi-perl, libwww-perl, libjson-perl, libhtml-tableextract-perl, libxml-twig-perl, liburi-encode-perl, libdbd-mysql-perl, python3-mysqldb, ncbi-blast+, bedtools Section: science Priority: optional Homepage: https://fasta.bioch.virginia.edu Description: tools for searching collections of biological sequences The FASTA programs find regions of local or global similarity between Protein or DNA sequences, either by searching Protein or DNA databases, or by identifying local duplications within a sequence. Other programs provide information on the statistical significance of an alignment. Like BLAST, FASTA can be used to infer functional and evolutionary relationships between sequences as well as help identify members of gene families. . * Protein - Protein-protein FASTA - Protein-protein Smith-Waterman (ssearch) - Global Protein-protein (Needleman-Wunsch) (ggsearch) - Global/Local protein-protein (glsearch) - Protein-protein with unordered peptides (fasts) - Protein-protein with mixed peptide sequences (fastf) . * Nucleotide - Nucleotide-Nucleotide (DNA/RNA fasta) - Ordered Nucleotides vs Nucleotide (fastm) - Un-ordered Nucleotides vs Nucleotide (fasts) . * Translated - Translated DNA (with frameshifts, e.g. ESTs) vs Proteins (fastx/fasty) - Protein vs Translated DNA (with frameshifts) (tfastx/tfasty) - Peptides vs Translated DNA (tfasts) . * Statistical Significance - Protein vs Protein shuffle (prss) - DNA vs DNA shuffle (prss) - Translated DNA vs Protein shuffle (prfx) . * Local Duplications - Local Protein alignments (lalign) - Plot Protein alignment "dot-plot" (plalign) - Local DNA alignments (lalign) - Plot DNA alignment "dot-plot" (plalign) . This software is often used via a web service at the EBI with readily indexed reference databases at http://www.ebi.ac.uk/Tools/fasta/. drwxr-xr-x root/root 0 2021-09-09 07:29 ./ drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/ drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/bin/ -rwxr-xr-x root/root 385864 2021-09-09 07:29 ./usr/bin/fasta36 -rwxr-xr-x root/root 326744 2021-09-09 07:29 ./usr/bin/fastf36 -rwxr-xr-x root/root 330776 2021-09-09 07:29 ./usr/bin/fastm36 -rwxr-xr-x root/root 330776 2021-09-09 07:29 ./usr/bin/fasts36 -rwxr-xr-x root/root 377768 2021-09-09 07:29 ./usr/bin/fastx36 -rwxr-xr-x root/root 381864 2021-09-09 07:29 ./usr/bin/fasty36 -rwxr-xr-x root/root 397960 2021-09-09 07:29 ./usr/bin/ggsearch36 -rwxr-xr-x root/root 397960 2021-09-09 07:29 ./usr/bin/glsearch36 -rwxr-xr-x root/root 389832 2021-09-09 07:29 ./usr/bin/lalign36 -rwxr-xr-x root/root 18816 2021-09-09 07:29 ./usr/bin/map_db -rwxr-xr-x root/root 398120 2021-09-09 07:29 ./usr/bin/ssearch36 -rwxr-xr-x root/root 335232 2021-09-09 07:29 ./usr/bin/tfastf36 -rwxr-xr-x root/root 335168 2021-09-09 07:29 ./usr/bin/tfastm36 -rwxr-xr-x root/root 335168 2021-09-09 07:29 ./usr/bin/tfasts36 -rwxr-xr-x root/root 377768 2021-09-09 07:29 ./usr/bin/tfastx36 -rwxr-xr-x root/root 381864 2021-09-09 07:29 ./usr/bin/tfasty36 drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/ drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/doc/ drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/doc/fasta3/ -rw-r--r-- root/root 1274 2021-09-09 07:29 ./usr/share/doc/fasta3/changelog.Debian.gz -rw-r--r-- root/root 2874 2021-09-09 07:29 ./usr/share/doc/fasta3/copyright drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/doc/fasta3/examples/ drwxr-xr-x root/root 0 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/ -rw-r--r-- root/root 2528 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/bovgh.seq -rw-r--r-- root/root 986 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/bovprl.seq -rw-r--r-- root/root 3159 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/dna_test_s.nlib -rw-r--r-- root/root 261 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/dyr_human.aa -rw-r--r-- root/root 1286 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/egmsmg.aa -rw-r--r-- root/root 806 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/grou_drome.pseg -rw-r--r-- root/root 18633 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gst.nlib -rw-r--r-- root/root 1405 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gst.seq -rw-r--r-- root/root 309 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gstm1_human.vaa -rw-r--r-- root/root 1226 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gstm1b_human.nt -rw-r--r-- root/root 1226 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gstm1b_human_fs.nt -rw-r--r-- root/root 314 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gstt1_drome.aa -rw-r--r-- root/root 311 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gtm1_human.aa -rw-r--r-- root/root 291 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gtt1_drome.aa -rw-r--r-- root/root 247 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/h10_human.aa -rw-r--r-- root/root 225 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/hahu.aa -rw-r--r-- root/root 7118 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/hsgstm1b.gcg -rw-r--r-- root/root 2788 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/hsgstm1b.seq -rw-r--r-- root/root 1323 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/humgstd.seq -rw-r--r-- root/root 271 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/lcbo.aa -rw-r--r-- root/root 56 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/m1r.aa -rw-r--r-- root/root 50 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/m2.aa -rw-r--r-- root/root 189 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mchu.aa -rw-r--r-- root/root 3440 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.3nt -rw-r--r-- root/root 342 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.aa -rw-r--r-- root/root 310 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.aaa -rw-r--r-- root/root 1220 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.e05 -rw-r--r-- root/root 1122 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.eeq -rw-r--r-- root/root 1116 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.esq -rw-r--r-- root/root 406 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.gcg -rw-r--r-- root/root 282 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.lc -rw-r--r-- root/root 677 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt -rw-r--r-- root/root 682 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt1 -rw-r--r-- root/root 1352 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt12r -rw-r--r-- root/root 2033 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt13 -rw-r--r-- root/root 2028 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt13r -rw-r--r-- root/root 681 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt1r -rw-r--r-- root/root 160 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.nts -rw-r--r-- root/root 259 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.raa -rw-r--r-- root/root 1167 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.rev -rw-r--r-- root/root 1158 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.seq -rw-r--r-- root/root 148692 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1_genclone.seq -rw-r--r-- root/root 1286 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgtt2_x.seq -rw-r--r-- root/root 43 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/ms1.aa -rw-r--r-- root/root 2361 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mu.lib -rw-r--r-- root/root 275 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/musplfm.aa -rw-r--r-- root/root 2047 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mwkw.aa -rw-r--r-- root/root 500 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mwrtc1.aa -rw-r--r-- root/root 1294 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/myosin_bp.aa -rw-r--r-- root/root 27 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/n0.aa -rw-r--r-- root/root 47 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/n1.aa -rw-r--r-- root/root 692 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/n2.aa -rw-r--r-- root/root 1482 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/n2_fs.lib -rw-r--r-- root/root 178 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/n2s.aa -rw-r--r-- root/root 243 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/n2t.aa -rw-r--r-- root/root 330 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/n_fs.lib -rw-r--r-- root/root 217 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/ngt.aa -rw-r--r-- root/root 111 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/ngts.aa -rw-r--r-- root/root 385 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/oohu.aa -rw-r--r-- root/root 401 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/oohu.raa -rw-r--r-- root/root 340 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/prio_atepa.aa -rw-r--r-- root/root 2741 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/prot_test.lib -rw-r--r-- root/root 3391 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/prot_test.lseg -rw-r--r-- root/root 1530 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/prot_test_s.lseg -rw-r--r-- root/root 914 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/qrhuld.aa -rw-r--r-- root/root 34874 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/titin_hum.aa -rw-r--r-- root/root 83286 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/titin_hum.seq -rw-r--r-- root/root 302 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/xurt8c.aa -rw-r--r-- root/root 302 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/xurt8c.lc -rw-r--r-- root/root 281 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/xurtg.aa drwxr-xr-x root/root 0 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/ -rw-r--r-- root/root 992 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/README -rw-r--r-- root/root 536 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/create_seq_demo.sql -rwxr-xr-x root/root 3227 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/join_up50.pl -rw-r--r-- root/root 347 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/mysql_demo1.sql -rw-r--r-- root/root 388 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/mysql_demo_pv.sql -rwxr-xr-x root/root 3300 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/nr_to_sql.pl -rw-r--r-- root/root 230 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/pirpsd.sql -rw-r--r-- root/root 317 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/psql_demo.sql -rw-r--r-- root/root 373 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/psql_demo1.sql -rw-r--r-- root/root 343 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/psql_demo_pv.sql drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/fasta3/ drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/fasta3/data/ -rw-r--r-- root/root 2764 2020-02-10 19:14 ./usr/share/fasta3/data/VTML_10.mat -rw-r--r-- root/root 2548 2020-02-10 19:14 ./usr/share/fasta3/data/VTML_120.mat -rw-r--r-- root/root 2548 2020-02-10 19:14 ./usr/share/fasta3/data/VTML_160.mat -rw-r--r-- root/root 2546 2020-02-10 19:14 ./usr/share/fasta3/data/VTML_20.mat -rw-r--r-- root/root 2548 2020-02-10 19:14 ./usr/share/fasta3/data/VTML_200.mat -rw-r--r-- root/root 2546 2020-02-10 19:14 ./usr/share/fasta3/data/VTML_40.mat -rw-r--r-- root/root 2545 2020-02-10 19:14 ./usr/share/fasta3/data/VTML_80.mat -rw-r--r-- root/root 1922 2020-02-10 19:14 ./usr/share/fasta3/data/blosum45.mat -rw-r--r-- root/root 1921 2020-02-10 19:14 ./usr/share/fasta3/data/blosum50.mat -rw-r--r-- root/root 1922 2020-02-10 19:14 ./usr/share/fasta3/data/blosum62.mat -rw-r--r-- root/root 1924 2020-02-10 19:14 ./usr/share/fasta3/data/blosum80.mat -rw-r--r-- root/root 976 2020-02-10 19:14 ./usr/share/fasta3/data/dna.mat -rw-r--r-- root/root 2256 2020-02-10 19:14 ./usr/share/fasta3/data/idn_aa.mat -rw-r--r-- root/root 2255 2020-02-10 19:14 ./usr/share/fasta3/data/md_10.mat -rw-r--r-- root/root 2256 2020-02-10 19:14 ./usr/share/fasta3/data/md_20.mat -rw-r--r-- root/root 2255 2020-02-10 19:14 ./usr/share/fasta3/data/md_40.mat -rw-r--r-- root/root 1922 2020-02-10 19:14 ./usr/share/fasta3/data/pam120.mat -rw-r--r-- root/root 1923 2020-02-10 19:14 ./usr/share/fasta3/data/pam250.mat -rw-r--r-- root/root 998 2020-02-10 19:14 ./usr/share/fasta3/data/rna.mat -rw-r--r-- root/root 2771 2020-02-10 19:14 ./usr/share/fasta3/data/vtml160.mat drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/fasta3/misc/ -rw-r--r-- root/root 424 2020-02-10 19:14 ./usr/share/fasta3/misc/README -rwxr-xr-x root/root 3447 2020-02-10 19:14 ./usr/share/fasta3/misc/parse_m9.pl -rwxr-xr-x root/root 367 2020-02-10 19:14 ./usr/share/fasta3/misc/res2R.pl -rwxr-xr-x root/root 3177 2020-02-10 19:14 ./usr/share/fasta3/misc/shuffle_embed.pl drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/fasta3/scripts/ -rw-r--r-- root/root 5789 2020-02-10 19:14 ./usr/share/fasta3/scripts/README -rw-r--r-- root/root 3182 2020-02-10 19:14 ./usr/share/fasta3/scripts/README.scripts -rw-r--r-- root/root 76 2020-02-10 19:14 ./usr/share/fasta3/scripts/acc_examples -rwxr-xr-x root/root 12507 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_exons_all.pl -rwxr-xr-x root/root 7198 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_exons_ens.pl -rwxr-xr-x root/root 4691 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_exons_ncbi.pl -rwxr-xr-x root/root 8501 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_exons_up_sql.pl -rwxr-xr-x root/root 12193 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_exons_up_sql_www.pl -rwxr-xr-x root/root 9074 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_exons_up_www.pl -rwxr-xr-x root/root 15898 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_feats2ipr.pl -rwxr-xr-x root/root 15966 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_feats2ipr_e.pl -rwxr-xr-x root/root 13489 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_feats_up_sql.pl -rwxr-xr-x root/root 12705 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_feats_up_www2.pl -rwxr-xr-x root/root 14506 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_ipr_www.pl -rwxr-xr-x root/root 9490 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_pdb_cath.pl -rwxr-xr-x root/root 8375 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_pdb_vast.pl -rwxr-xr-x root/root 27672 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_pfam30_tmptbl.pl -rwxr-xr-x root/root 27255 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_pfam_sql.pl -rwxr-xr-x root/root 20385 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_pfam_www.pl -rw-r--r-- root/root 321 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_script_list -rwxr-xr-x root/root 23627 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_upfeats_pfam_www_e.pl -rwxr-xr-x root/root 44866 2021-09-09 07:29 ./usr/share/fasta3/scripts/annot_blast_btop2.pl -rwxr-xr-x root/root 25321 2021-09-09 07:29 ./usr/share/fasta3/scripts/annot_blast_btop3.py -rwxr-xr-x root/root 26399 2021-09-09 07:29 ./usr/share/fasta3/scripts/annot_blast_btop4.py -rwxr-xr-x root/root 1779 2021-09-09 07:29 ./usr/share/fasta3/scripts/blastp_annot_cmd.sh -rwxr-xr-x root/root 753 2021-09-09 07:29 ./usr/share/fasta3/scripts/blastp_cmd.sh -rwxr-xr-x root/root 4583 2020-02-10 19:14 ./usr/share/fasta3/scripts/color_defs.pl -rwxr-xr-x root/root 4564 2021-09-09 07:29 ./usr/share/fasta3/scripts/exp_up_ensg.pl -rwxr-xr-x root/root 3275 2021-09-09 07:29 ./usr/share/fasta3/scripts/expand_links.pl -rwxr-xr-x root/root 5572 2021-09-09 07:29 ./usr/share/fasta3/scripts/expand_refseq_isoforms.pl -rwxr-xr-x root/root 2576 2021-09-09 07:29 ./usr/share/fasta3/scripts/expand_uniref50.pl -rwxr-xr-x root/root 6043 2021-09-09 07:29 ./usr/share/fasta3/scripts/expand_up_isoforms.pl -rwxr-xr-x root/root 1590 2021-09-09 07:29 ./usr/share/fasta3/scripts/fasta_annot_cmd.sh -rwxr-xr-x root/root 1676 2021-09-09 07:29 ./usr/share/fasta3/scripts/get_genome_seq.py -rwxr-xr-x root/root 2234 2021-09-09 07:29 ./usr/share/fasta3/scripts/get_protein.py -rwxr-xr-x root/root 1497 2021-09-09 07:29 ./usr/share/fasta3/scripts/get_protein_sql.py -rwxr-xr-x root/root 4000 2021-09-09 07:29 ./usr/share/fasta3/scripts/get_protein_sql_www.py -rwxr-xr-x root/root 878 2021-09-09 07:29 ./usr/share/fasta3/scripts/get_refseq.py -rwxr-xr-x root/root 441 2021-09-09 07:29 ./usr/share/fasta3/scripts/get_uniprot.py -rwxr-xr-x root/root 1188 2021-09-09 07:29 ./usr/share/fasta3/scripts/get_up_prot_iso_sql.py -rwxr-xr-x root/root 8976 2021-09-09 07:29 ./usr/share/fasta3/scripts/lav2plt.pl -rwxr-xr-x root/root 14885 2021-09-09 07:29 ./usr/share/fasta3/scripts/lavplt_ps.pl -rwxr-xr-x root/root 13069 2021-09-09 07:29 ./usr/share/fasta3/scripts/lavplt_svg.pl -rwxr-xr-x root/root 1909 2021-09-09 07:29 ./usr/share/fasta3/scripts/links2sql.pl -rwxr-xr-x root/root 11092 2021-09-09 07:29 ./usr/share/fasta3/scripts/m8_btop_msa.pl -rwxr-xr-x root/root 18926 2021-09-09 07:29 ./usr/share/fasta3/scripts/m9B_btop_msa.pl -rwxr-xr-x root/root 16976 2021-09-09 07:29 ./usr/share/fasta3/scripts/map_exon_coords.py -rwxr-xr-x root/root 7659 2021-09-09 07:29 ./usr/share/fasta3/scripts/merge_blast_btab.pl -rwxr-xr-x root/root 9415 2021-09-09 07:29 ./usr/share/fasta3/scripts/merge_fasta_btab.pl -rwxr-xr-x root/root 19093 2020-02-10 19:14 ./usr/share/fasta3/scripts/plot_domain2t.cgi -rwxr-xr-x root/root 5135 2021-09-09 07:29 ./usr/share/fasta3/scripts/relabel_domains.py -rwxr-xr-x root/root 30354 2021-09-09 07:29 ./usr/share/fasta3/scripts/rename_exons.py -rwxr-xr-x root/root 3042 2021-09-09 07:29 ./usr/share/fasta3/scripts/summ_domain_ident.pl -rwxr-xr-x root/root 706 2021-09-09 07:29 ./usr/share/fasta3/scripts/test_ann_scripts.sh -rwxr-xr-x root/root 2978 2021-09-09 07:29 ./usr/share/fasta3/scripts/test_py.sh drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/man/ drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/man/man1/ -rw-r--r-- root/root 7358 2021-09-09 07:29 ./usr/share/man/man1/fasta36.1.gz -rw-r--r-- root/root 2195 2021-09-09 07:29 ./usr/share/man/man1/fastf3.1.gz -rw-r--r-- root/root 2119 2021-09-09 07:29 ./usr/share/man/man1/fasts3.1.gz -rw-r--r-- root/root 523 2021-09-09 07:29 ./usr/share/man/man1/map_db.1.gz -rw-r--r-- root/root 2146 2021-09-09 07:29 ./usr/share/man/man1/prss3.1.gz -rw-r--r-- root/root 402 2021-09-09 07:29 ./usr/share/man/man1/ps_lav.1.gz +------------------------------------------------------------------------------+ | Post Build | +------------------------------------------------------------------------------+ +------------------------------------------------------------------------------+ | Cleanup | +------------------------------------------------------------------------------+ Purging /<> Not removing build depends: as requested +------------------------------------------------------------------------------+ | Summary | +------------------------------------------------------------------------------+ Build Architecture: amd64 Build Type: binary Build-Space: n/a Build-Time: 117 Distribution: jammy-proposed Host Architecture: amd64 Install-Time: 19 Job: fasta3_36.3.8h.2020-02-11-4.dsc Machine Architecture: amd64 Package: fasta3 Package-Time: 138 Source-Version: 36.3.8h.2020-02-11-4 Space: n/a Status: successful Version: 36.3.8h.2020-02-11-4 -------------------------------------------------------------------------------- Finished at 2021-10-19T19:10:52Z Build needed 00:02:18, no disk space Adding user buildd to group lxd RUN: /usr/share/launchpad-buildd/bin/in-target scan-for-processes --backend=chroot --series=jammy --arch=amd64 PACKAGEBUILD-22293618 Scanning for processes to kill in build PACKAGEBUILD-22293618